{
    "uniprot_canonical_ac": "P0DW85-1",
    "uniprot_ac": "P0DW85",
    "uniprot_id": "H2BN1_HUMAN",
    "mass": {
        "chemical_mass": 14207.0,
        "monoisotopic_mass": 14207.0
    },
    "refseq": {},
    "gene_names": [
        {
            "name": "H2BN1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/P0DW85",
            "id": "P0DW85"
        }
    ],
    "protein_names": [
        {
            "name": "Histone H2A.N",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "P0DW85"
        },
        {
            "name": "H2B.N variant histone 1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P0DW85"
        },
        {
            "name": "H2B.N",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P0DW85"
        }
    ],
    "function": [
        {
            "annotation": "Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P0DW85",
                    "url": "https://www.uniprot.org/uniprot/P0DW85#function"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Homo sapiens",
            "taxid": 9606,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P0DW85",
                    "url": "https://www.uniprot.org/uniprot/P0DW85"
                }
            ],
            "common_name": "Human"
        }
    ],
    "gene": [
        {
            "name": "H2BN1",
            "url": "https://www.uniprot.org/uniprot/P0DW85",
            "locus": {
                "chromosome": "17",
                "start_pos": 32906586,
                "end_pos": 32895433,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSG00000290320",
                        "url": "https://www.ensembl.org/id/ENSG00000290320"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "H2BN1",
            "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=H2BN1",
            "database": "GeneCards",
            "categories": [
                "Gene Annotation",
                "Organism-specific"
            ]
        },
        {
            "id": "56200",
            "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=56200",
            "database": "HGNC",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "IPR000558",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000558",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR009072",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR009072",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "P0DW85",
            "url": "https://www.uniprot.org/uniprot/P0DW85",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P0DW85-1",
            "url": "https://www.uniprot.org/uniprot/P0DW85-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MYFICLNDLRFPKNKTELYFPVKKKHEWANSATGKKRRWRKKRRKEAYFSYMGKILKQIHPDFSGRSWVLYALGALNAWQLEWVSLEAFRLSFYNHRRAITGREILGAVKQRSSQKSF",
        "length": 118,
        "header": "sp|P0DW85-1|H2BN1_HUMAN Isoform 1 of Histone H2A.N  OS=Homo sapiens OX=9606 GN=H2BN1 PE=2 SV=1 CANONICAL=P0DW85-1"
    },
    "isoforms": [
        {
            "isoform_ac": "P0DW85-1",
            "url": "",
            "sequence": {
                "sequence": "MYFICLNDLRFPKNKTELYFPVKKKHEWANSATGKKRRWRKKRRKEAYFSYMGKILKQIHPDFSGRSWVLYALGALNAWQLEWVSLEAFRLSFYNHRRAITGREILGAVKQRSSQKSF",
                "length": 118,
                "header": "sp|P0DW85-1|H2BN1_HUMAN Isoform 1 of Histone H2A.N  OS=Homo sapiens OX=9606 GN=H2BN1 PE=2 SV=1 CANONICAL=P0DW85-1"
            },
            "locus": {
                "chromosome": "17",
                "start_pos": 32906370,
                "end_pos": 32895433,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000704639.1",
                        "url": "https://www.ensembl.org/id/ENST00000704639.1"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000515970.1",
                        "url": "https://www.ensembl.org/id/ENSP00000515970.1"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [],
    "pathway": [],
    "orthologs": [],
    "go_annotation": {
        "categories": [
            {
                "name": "Molecular Function",
                "total": 3,
                "go_terms": [
                    {
                        "name": "DNA binding",
                        "id": "GO:0003677",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P0DW85",
                                "url": "https://www.uniprot.org/uniprot/P0DW85"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "protein heterodimerization activity",
                        "id": "GO:0046982",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046982",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P0DW85",
                                "url": "https://www.uniprot.org/uniprot/P0DW85"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "structural constituent of chromatin",
                        "id": "GO:0030527",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030527",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P0DW85",
                                "url": "https://www.uniprot.org/uniprot/P0DW85"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 2,
                "go_terms": [
                    {
                        "name": "nucleus",
                        "id": "GO:0005634",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P0DW85",
                                "url": "https://www.uniprot.org/uniprot/P0DW85"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "nucleosome",
                        "id": "GO:0000786",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000786",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P0DW85",
                                "url": "https://www.uniprot.org/uniprot/P0DW85"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 14,
            "end_pos": 16,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [],
    "sequence_features": {
        "n_linked_sites": [],
        "o_linked_sites": [],
        "snv_sites": [],
        "glycation_sites": [],
        "phosphorylation_sites": [],
        "sequon_annotation_sites": [
            {
                "start_pos": 14,
                "end_pos": 16
            }
        ]
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                }
            ],
            "sort_fields": []
        }
    ]
}