{ "uniprot_canonical_ac": "P0DW81-1", "uniprot_ac": "P0DW81", "uniprot_id": "PACMP_HUMAN", "mass": { "chemical_mass": 4877.0, "monoisotopic_mass": 4877.0 }, "refseq": {}, "gene_names": [ { "name": "MARCHF6-DT", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P0DW81", "id": "P0DW81" }, { "name": "PACMP", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P0DW81", "id": "P0DW81" } ], "protein_names": [ { "name": "Poly-ADP-ribosylation-amplifying and CtIP-maintaining micropeptide", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P0DW81" }, { "name": "PAR-amplifying and CtIP-maintaining micropeptide", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DW81" } ], "function": [ { "annotation": "Micropeptide that acts as a regulator of DNA repair both by preventing KLHL15-mediated ubiquitination and degradation of RBBP8/CtIP, and by promoting the poly-ADP-ribosyltransferase activity of PARP1 (PubMed:35219381). Prevents KLHL15-mediated ubiquitination of RBBP8/CtIP by competitively blocking the association between KLHL15 and RBBP8/CtIP (PubMed:35219381). Recruited to DNA damage sites via association with poly-ADP-ribose chains, and enhances the poly-ADP-ribosyltransferase activity of PARP1 (PubMed:35219381).", "evidence": [ { "database": "UniProtKB", "id": "P0DW81", "url": "https://www.uniprot.org/uniprot/P0DW81#function" }, { "database": "PubMed", "id": "35219381", "url": "https://glygen.org/publication/PubMed/35219381" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 23, "end_pos": 42, "sequence_org": "RPSRRARQRPRRGALRKAGR", "sequence_mut": "APSAAAAQAPAAGALRAAGA", "comment": "In 10A mutant; impaired binding to poly-ADP-ribose chains.", "evidence": [ { "database": "UniProtKB", "id": "P0DW81", "url": "https://www.uniprot.org/uniprot/P0DW81" }, { "database": "PubMed", "id": "35219381", "url": "https://glygen.org/publication/PubMed/35219381" } ] }, { "start_pos": 38, "end_pos": 42, "sequence_org": "RKAGR", "sequence_mut": "AAAGA", "comment": "In 4A mutant; impaired binding to poly-ADP-ribose chains.", "evidence": [ { "database": "UniProtKB", "id": "P0DW81", "url": "https://www.uniprot.org/uniprot/P0DW81" }, { "database": "PubMed", "id": "35219381", "url": "https://glygen.org/publication/PubMed/35219381" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DW81", "url": "https://www.uniprot.org/uniprot/P0DW81" } ], "common_name": "Human" } ], "gene": [ { "name": "MARCHF6-DT", "url": "https://www.uniprot.org/uniprot/P0DW81", "locus": {} } ], "crossref": [ { "id": "MARCHF6-DT", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=MARCHF6-DT", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "56238", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=56238", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P0DW81", "url": "https://www.uniprot.org/uniprot/P0DW81", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0DW81-1", "url": "https://www.uniprot.org/uniprot/P0DW81-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAASGGTKKAQSGGRRLREPSSRPSRRARQRPRRGALRKAGRFL", "length": 44, "header": "sp|P0DW81-1|PACMP_HUMAN Isoform 1 of Poly-ADP-ribosylation-amplifying and CtIP-maintaining micropeptide OS=Homo sapiens OX=9606 GN=MARCHF6-DT PE=1 SV=1 CANONICAL=P0DW81-1" }, "isoforms": [ { "isoform_ac": "P0DW81-1", "url": "", "sequence": { "sequence": "MAASGGTKKAQSGGRRLREPSSRPSRRARQRPRRGALRKAGRFL", "length": 44, "header": "sp|P0DW81-1|PACMP_HUMAN Isoform 1 of Poly-ADP-ribosylation-amplifying and CtIP-maintaining micropeptide OS=Homo sapiens OX=9606 GN=MARCHF6-DT PE=1 SV=1 CANONICAL=P0DW81-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Micropeptide PACMP inhibition elicits synthetic lethal effects by decreasing CtIP and poly(ADP-ribosyl)ation.", "journal": "Molecular cell", "date": "2022", "authors": "Zhang C, Zhou B, Gu F, Liu H, Wu H, Yao F, Zheng H, Fu H, Chong W, Cai S, Huang M, Ma X, Guo Z, Li T, Deng W, Zheng M, Ji Q, Zhao Y, Ma Y, Wang QE, Tang TS, Guo C", "evidence": [ { "database": "UniProtKB", "id": "P0DW81", "url": "https://www.uniprot.org/uniprot/P0DW81" } ], "reference": [ { "type": "PubMed", "id": "35219381", "url": "https://glygen.org/publication/PubMed/35219381" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "poly-ADP-D-ribose binding", "id": "GO:0072572", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072572", "evidence": [ { "database": "UniProtKB", "id": "P0DW81", "url": "https://www.uniprot.org/uniprot/P0DW81" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleolus", "id": "GO:0005730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "evidence": [ { "database": "UniProtKB", "id": "P0DW81", "url": "https://www.uniprot.org/uniprot/P0DW81" } ], "pmid": "" }, { "name": "site of DNA damage", "id": "GO:0090734", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090734", "evidence": [ { "database": "UniProtKB", "id": "P0DW81", "url": "https://www.uniprot.org/uniprot/P0DW81" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "positive regulation of DNA repair", "id": "GO:0045739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045739", "evidence": [ { "database": "UniProtKB", "id": "P0DW81", "url": "https://www.uniprot.org/uniprot/P0DW81" } ], "pmid": "" }, { "name": "negative regulation of protein ubiquitination", "id": "GO:0031397", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031397", "evidence": [ { "database": "UniProtKB", "id": "P0DW81", "url": "https://www.uniprot.org/uniprot/P0DW81" } ], "pmid": "" }, { "name": "regulation of protein ADP-ribosylation", "id": "GO:0010835", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010835", "evidence": [ { "database": "UniProtKB", "id": "P0DW81", "url": "https://www.uniprot.org/uniprot/P0DW81" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }