{ "uniprot_canonical_ac": "P0DUH7-1", "uniprot_ac": "P0DUH7", "uniprot_id": "HRURF_HUMAN", "mass": { "chemical_mass": 3757.0, "monoisotopic_mass": 3757.0 }, "refseq": {}, "gene_names": [ { "name": "HRURF", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P0DUH7", "id": "P0DUH7" }, { "name": "U2HR", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P0DUH7", "id": "P0DUH7" } ], "protein_names": [ { "name": "Protein HRURF", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P0DUH7" }, { "name": "HR upstream open reading frame protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DUH7" } ], "function": [ { "annotation": "May function as an inhibitory translational control element that can negatively regulate protein translation of HR gene.", "evidence": [ { "database": "UniProtKB", "id": "P0DUH7", "url": "https://www.uniprot.org/uniprot/P0DUH7#function" }, { "database": "PubMed", "id": "19122663", "url": "https://glygen.org/publication/PubMed/19122663" } ] } ], "disease": [ { "disease_id": "DOID:0110701", "recommended_name": { "id": "DOID:0110701", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110701", "name": "hypotrichosis 4", "description": "A hypotrichosis that has_material_basis_in a autosomal dominant mutation of HR on chromosome 8p21.3." }, "synonyms": [ { "id": "DOID:0110701", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110701", "name": "Hypotrichosis, Marie Unna Type, 1", "description": "" }, { "id": "DOID:0110701", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110701", "name": "Hypt4", "description": "" }, { "id": "DOID:0110701", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110701", "name": "Marie Unna Hereditary Hypotrichosis 1", "description": "" }, { "id": "DOID:0110701", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110701", "name": "Muhh1", "description": "" }, { "id": "MONDO:0100522", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100522", "name": "hypotrichosis 4", "description": "" }, { "id": "MONDO:0100522", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100522", "name": "HYPT4", "description": "" }, { "id": "MONDO:0100522", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100522", "name": "MUHH1", "description": "" }, { "id": "MONDO:0100522", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100522", "name": "Marie Unna hereditary hypotrichosis 1", "description": "" }, { "id": "MONDO:0100522", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100522", "name": "hypotrichosis 4", "description": "" }, { "id": "MONDO:0100522", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100522", "name": "hypotrichosis type 4", "description": "" }, { "id": "MONDO:0100522", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100522", "name": "hypotrichosis, Marie Unna type, 1", "description": "" }, { "id": "MIM:146550", "resource": "MIM", "url": "https://www.omim.org/entry/146550", "name": "Hypotrichosis 4", "description": "Hypotrichosis 4" } ], "evidence": [ { "id": "146550", "database": "MIM", "url": "https://www.omim.org/entry/146550" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DUH7", "url": "https://www.uniprot.org/uniprot/P0DUH7" } ], "common_name": "Human" } ], "gene": [ { "name": "HRURF", "url": "https://www.uniprot.org/uniprot/P0DUH7", "locus": { "chromosome": "8", "start_pos": 22130458, "end_pos": 22131010, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000288677", "url": "https://www.ensembl.org/id/ENSG00000288677" } ] } } ], "crossref": [ { "id": "HRURF", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=HRURF", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "55085", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=55085", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "146550", "url": "http://www.omim.org/entry/146550", "database": "MIM", "categories": [ "Other" ] }, { "id": "619257", "url": "http://www.omim.org/entry/619257", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P0DUH7", "url": "https://www.nextprot.org/entry/NX_P0DUH7", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "PR_P0DUH7", "url": "http://purl.obolibrary.org/obo/PR_P0DUH7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "A0A7P0T8H1", "url": "https://www.uniprot.org/uniprot/A0A7P0T8H1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0T8H1-1", "url": "https://www.uniprot.org/uniprot/A0A7P0T8H1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0DUH7", "url": "https://www.uniprot.org/uniprot/P0DUH7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0DUH7-1", "url": "https://www.uniprot.org/uniprot/P0DUH7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAQPTASAQKLVRPIRAVCRILQIPESDPSNLRP", "length": 34, "header": "sp|P0DUH7-1|HRURF_HUMAN Isoform 1 of Protein HRURF OS=Homo sapiens OX=9606 GN=HRURF PE=1 SV=1 CANONICAL=P0DUH7-1" }, "isoforms": [ { "isoform_ac": "A0A7P0T8H1-1", "url": "", "sequence": { "sequence": "MAQPTASAQKLVRPIRAVCRILQIPESDPSNLRP", "length": 34, "header": "tr|A0A7P0T8H1-1|A0A7P0T8H1_HUMAN Computationally mapped isoform of Uncharacterized protein OS=Homo sapiens OX=9606 GN= PE=4 SV=1 CANONICAL=P0DUH7-1" }, "locus": { "chromosome": "8", "start_pos": 22130708, "end_pos": 22130607, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000518377", "url": "https://www.ensembl.org/id/ENST00000518377" }, { "database": "Ensembl Peptide", "id": "ENSP00000505144", "url": "https://www.ensembl.org/id/ENSP00000505144" } ] } }, { "isoform_ac": "P0DUH7-1", "url": "", "sequence": { "sequence": "MAQPTASAQKLVRPIRAVCRILQIPESDPSNLRP", "length": 34, "header": "sp|P0DUH7-1|HRURF_HUMAN Isoform 1 of Protein HRURF OS=Homo sapiens OX=9606 GN=HRURF PE=1 SV=1 CANONICAL=P0DUH7-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Marie Unna hereditary hypotrichosis gene maps to human chromosome 8p21 near hairless.", "journal": "The Journal of investigative dermatology", "date": "2000", "authors": "Sreekumar GP, Roberts JL, Wong CQ, Stenn KS, Parimoo S", "evidence": [ { "database": "UniProtKB", "id": "P0DUH7", "url": "https://www.uniprot.org/uniprot/P0DUH7" } ], "reference": [ { "type": "PubMed", "id": "10777357", "url": "https://glygen.org/publication/PubMed/10777357" } ] }, { "title": "A distinct gene close to the hairless locus on chromosome 8p underlies hereditary Marie Unna type hypotrichosis in a German family.", "journal": "The British journal of dermatology", "date": "2000", "authors": "Cichon S, Kruse R, Hillmer AM, Kukuk G, Anker M, Altland K, Knapp M, Propping P, Nothen MM", "evidence": [ { "database": "UniProtKB", "id": "P0DUH7", "url": "https://www.uniprot.org/uniprot/P0DUH7" } ], "reference": [ { "type": "PubMed", "id": "11069461", "url": "https://glygen.org/publication/PubMed/11069461" } ] }, { "title": "Loss-of-function mutations of an inhibitory upstream ORF in the human hairless transcript cause Marie Unna hereditary hypotrichosis.", "journal": "Nature genetics", "date": "2009", "authors": "Wen Y, Liu Y, Xu Y, Zhao Y, Hua R, Wang K, Sun M, Li Y, Yang S, Zhang XJ, Kruse R, Cichon S, Betz RC, Nothen MM, van Steensel MA, van Geel M, Steijlen PM, Hohl D, Huber M, Dunnill GS, Kennedy C, Messenger A, Munro CS, Terrinoni A, Hovnanian A, Bodemer C, de Prost Y, Paller AS, Irvine AD, Sinclair R, Green J, Shang D, Liu Q, Luo Y, Jiang L, Chen HD, Lo WH, McLean WH, He CD, Zhang X", "evidence": [ { "database": "UniProtKB", "id": "P0DUH7", "url": "https://www.uniprot.org/uniprot/P0DUH7" } ], "reference": [ { "type": "PubMed", "id": "19122663", "url": "https://glygen.org/publication/PubMed/19122663" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "regulation of translation", "id": "GO:0006417", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006417", "evidence": [ { "database": "UniProtKB", "id": "P0DUH7", "url": "https://www.uniprot.org/uniprot/P0DUH7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }