{
    "uniprot_canonical_ac": "P0DTW1-1",
    "uniprot_ac": "P0DTW1",
    "uniprot_id": "GAGE1_HUMAN",
    "mass": {
        "chemical_mass": 12885.0,
        "monoisotopic_mass": 12885.0
    },
    "refseq": {
        "ac": "NP_001035753",
        "name": "G antigen 1",
        "summary": "This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The antigenic peptide YRPRPRRY, which is also encoded by several other family members, is recognized by autologous cytolytic T lymphocytes. Nothing is presently known about the function of this protein. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2010].",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035753"
    },
    "gene_names": [
        {
            "name": "GAGE1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/P0DTW1",
            "id": "P0DTW1"
        },
        {
            "name": "CT4.1; CT4.4; GAGE-1; GAGE-4; GAGE4",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035753",
            "id": "NP_001035753"
        },
        {
            "name": "GAGE1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035753",
            "id": "NP_001035753"
        }
    ],
    "protein_names": [
        {
            "name": "G antigen 1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "P0DTW1"
        },
        {
            "name": "Antigen MZ2-F",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P0DTW1"
        },
        {
            "name": "CT4.1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P0DTW1"
        },
        {
            "name": "Cancer/testis antigen 4.1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P0DTW1"
        },
        {
            "name": "G antigen 1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035753",
            "id": "NP_001035753"
        },
        {
            "name": "GAGE-1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P0DTW1"
        },
        {
            "name": "cancer/testis antigen family 4, member 1; MZ2-F antigen; G antigen 4; Cancer/testis antigen 4.4; cancer/testis antigen 4.1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035753",
            "id": "NP_001035753"
        }
    ],
    "function": [
        {
            "annotation": "Antigen, recognized on melanoma by autologous cytolytic T-lymphocytes.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P0DTW1",
                    "url": "https://www.uniprot.org/uniprot/P0DTW1#function"
                },
                {
                    "database": "PubMed",
                    "id": "7544395",
                    "url": "https://glygen.org/publication/PubMed/7544395"
                }
            ]
        },
        {
            "annotation": "High GAGE1 expression is associated with metastasis in Head and Neck Squamous Cell Carcinoma.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001035753",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035753"
                },
                {
                    "database": "PubMed",
                    "id": "29577858",
                    "url": "https://glygen.org/publication/PubMed/29577858"
                }
            ]
        },
        {
            "annotation": "The circ_0016760/miR-1287/GAGE1 signaling might play vital roles in the tumorigenesis and progression of Non-small cell lung cancer (NSCLC).",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001035753",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035753"
                },
                {
                    "database": "PubMed",
                    "id": "30103946",
                    "url": "https://glygen.org/publication/PubMed/30103946"
                }
            ]
        },
        {
            "annotation": "These data illustrate that the GAGE1 protein exhibits moderate cancerrestricted pattern of expression and immunogenicity, laying the foundation for the application of GAGE1 in immunotherapy and for the diagnosis of HCC[hepatocellular carcinoma].",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001035753",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035753"
                },
                {
                    "database": "PubMed",
                    "id": "30297572",
                    "url": "https://glygen.org/publication/PubMed/30297572"
                }
            ]
        },
        {
            "annotation": "This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The antigenic peptide YRPRPRRY, which is also encoded by several other family members, is recognized by autologous cytolytic T lymphocytes. Nothing is presently known about the function of this protein. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2010].",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001035753",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035753"
                }
            ]
        },
        {
            "annotation": "Tumor-specific antigen GAGE may play a role in the occurrence and development of ovarian cancer and can be used as one of the important indicators for early diagnosis, efficacy evaluation and prognostic determination of ovarian cancer. Publication Status: Online-Only",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001035753",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035753"
                },
                {
                    "database": "PubMed",
                    "id": "20423514",
                    "url": "https://glygen.org/publication/PubMed/20423514"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Homo sapiens",
            "taxid": 9606,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P0DTW1",
                    "url": "https://www.uniprot.org/uniprot/P0DTW1"
                }
            ],
            "common_name": "Human"
        }
    ],
    "gene": [
        {
            "name": "GAGE1",
            "url": "https://www.uniprot.org/uniprot/P0DTW1",
            "locus": {
                "chromosome": "X",
                "start_pos": 49608538,
                "end_pos": 49599020,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSG00000205777",
                        "url": "https://www.ensembl.org/id/ENSG00000205777"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSG00000205777",
            "url": "https://bgee.org/?page=gene&gene_id=ENSG00000205777",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "GAGE1",
            "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=GAGE1",
            "database": "GeneCards",
            "categories": [
                "Gene Annotation",
                "Organism-specific"
            ]
        },
        {
            "id": "2543",
            "url": "https://www.ncbi.nlm.nih.gov/gene/2543",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "4098",
            "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4098",
            "database": "HGNC",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "IPR008625",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR008625",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR031320",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR031320",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "hsa:2543",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2543",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "300594",
            "url": "http://www.omim.org/entry/300594",
            "database": "MIM",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "NX_P0DTW1",
            "url": "https://www.nextprot.org/entry/NX_P0DTW1",
            "database": "neXtProt",
            "categories": [
                "Protein",
                "Organism-specific"
            ]
        },
        {
            "id": "4660048at2759",
            "url": "http://www.orthodb.org/?query=4660048at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR14047",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14047",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR14047:SF30",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14047:SF30",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF05831",
            "url": "http://pfam.xfam.org/family/PF05831",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_P0DTW1",
            "url": "http://purl.obolibrary.org/obo/PR_P0DTW1",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_001035753",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035753",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P0DTW1",
            "url": "https://www.uniprot.org/uniprot/P0DTW1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P0DTW1-1",
            "url": "https://www.uniprot.org/uniprot/P0DTW1-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEGQSQC",
        "length": 117,
        "header": "sp|P0DTW1-1|GAGE1_HUMAN Isoform 1 of G antigen 1  OS=Homo sapiens OX=9606 GN=GAGE1 PE=1 SV=1 CANONICAL=P0DTW1-1"
    },
    "isoforms": [
        {
            "isoform_ac": "P0DTW1-1",
            "url": "",
            "sequence": {
                "sequence": "MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEGQSQC",
                "length": 117,
                "header": "sp|P0DTW1-1|GAGE1_HUMAN Isoform 1 of G antigen 1  OS=Homo sapiens OX=9606 GN=GAGE1 PE=1 SV=1 CANONICAL=P0DTW1-1"
            },
            "locus": {
                "chromosome": "X",
                "start_pos": 49606012,
                "end_pos": 49600175,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000381700.11",
                        "url": "https://www.ensembl.org/id/ENST00000381700.11"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000371119.5",
                        "url": "https://www.ensembl.org/id/ENSP00000371119.5"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Characterization of the GAGE genes that are expressed in various human cancers and in normal testis.",
            "journal": "Cancer Res.",
            "date": "1999",
            "authors": "De Backer O, Arden KC, Boretti M, Vantomme V, De Smet C, Czekay S, Viars CS, De Plaen E, Brasseur F, Chomez P, Van den Eynde B, Boon T, van der Bruggen P",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P0DTW1",
                    "url": "https://www.uniprot.org/uniprot/P0DTW1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10397259",
                    "url": "https://glygen.org/publication/PubMed/10397259"
                }
            ]
        },
        {
            "title": "An overview of the GAGE cancer/testis antigen family with the inclusion of newly identified members.",
            "journal": "Tissue Antigens",
            "date": "2008",
            "authors": "Gjerstorff M F, Ditzel H J",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P0DTW1",
                    "url": "https://www.uniprot.org/uniprot/P0DTW1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18179644",
                    "url": "https://glygen.org/publication/PubMed/18179644"
                }
            ]
        },
        {
            "title": "Expression of tumor-specific antigen MAGE, GAGE and BAGE in ovarian cancer tissues and cell lines.",
            "journal": "BMC cancer",
            "date": "2010",
            "authors": "Zhang S, Zhou X, Yu H, Yu Y",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001035753",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035753"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20423514",
                    "url": "https://glygen.org/publication/PubMed/20423514"
                }
            ]
        },
        {
            "title": "Expression and Prognostic Relevance of GAGE1 and XAGE1 Cancer/Testis Antigens in Head and Neck Squamous Cell Carcinoma.",
            "journal": "Current molecular medicine",
            "date": "2017",
            "authors": "Karia BTR, Zamuner FT, Carlin V, de Oliveira CZ, Carvalho AL, Vettore AL",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001035753",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035753"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29577858",
                    "url": "https://glygen.org/publication/PubMed/29577858"
                }
            ]
        },
        {
            "title": "Upregulated circular RNA circ_0016760 indicates unfavorable prognosis in NSCLC and promotes cell progression through miR-1287/GAGE1 axis.",
            "journal": "Biochemical and biophysical research communications",
            "date": "2018",
            "authors": "Li Y, Hu J, Li L, Cai S, Zhang H, Zhu X, Guan G, Dong X",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001035753",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035753"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "30103946",
                    "url": "https://glygen.org/publication/PubMed/30103946"
                }
            ]
        },
        {
            "title": "Cancer-testis antigen GAGE-1 expression and serum immunoreactivity in hepatocellular carcinoma.",
            "journal": "Nigerian journal of clinical practice",
            "date": "2018",
            "authors": "Chao NX, Li LZ, Luo GR, Zhong WG, Huang RS, Fan R, Zhao FL",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001035753",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035753"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "30297572",
                    "url": "https://glygen.org/publication/PubMed/30297572"
                }
            ]
        },
        {
            "title": "A new family of genes coding for an antigen recognized by autologous cytolytic T lymphocytes on a human melanoma.",
            "journal": "The Journal of experimental medicine",
            "date": "1995-09-01",
            "authors": "Van den Eynde B, Peeters O, De Backer O, Gaugler B, Lucas S, Boon T",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P0DTW1",
                    "url": "https://www.uniprot.org/uniprot/P0DTW1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7544395",
                    "url": "https://glygen.org/publication/PubMed/7544395"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "hsa:2543",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2543",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [],
    "go_annotation": {},
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [],
    "sequence_features": {
        "n_linked_sites": [],
        "o_linked_sites": [],
        "snv_sites": [],
        "glycation_sites": [],
        "phosphorylation_sites": [],
        "sequon_annotation_sites": []
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 7
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}