{ "uniprot_canonical_ac": "P0DTE8-1", "uniprot_ac": "P0DTE8", "uniprot_id": "AMY1C_HUMAN", "mass": { "chemical_mass": 57768.0, "monoisotopic_mass": 57768.0 }, "refseq": { "ac": "NP_001008219", "name": "alpha-amylase 1B precursor", "summary": "Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the salivary gland. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008219" }, "gene_names": [ { "name": "AMY1C", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P0DTE8", "id": "P0DTE8" }, { "name": "AMY1B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008219", "id": "NP_001008219" }, { "name": "AMY1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008219", "id": "NP_001008219" }, { "name": "AMY1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P0DTE8", "id": "P0DTE8" } ], "protein_names": [ { "name": "Alpha-amylase 1C", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P0DTE8" }, { "name": "3.2.1.1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DTE8" }, { "name": "alpha-amylase 1B precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008219", "id": "NP_001008219" }, { "name": "glycogenase; amylase, salivary, alpha-1B; salivary amylase alpha 1B; alpha-amylase 1; salivary alpha-amylase; 1,4-alpha-D-glucan glucanohydrolase 1; amylase alpha 1B (salivary); alpha-amylase 1A; alpha-amylase 1B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008219", "id": "NP_001008219" } ], "function": [ { "annotation": "AMY1 Gene Copy Number Correlates With Glucose Absorption and Visceral Fat Volume, but Not with Insulin Resistance.", "evidence": [ { "database": "RefSeq", "id": "NP_001008219", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008219" }, { "database": "PubMed", "id": "32697825", "url": "https://glygen.org/publication/PubMed/32697825" } ] }, { "annotation": "AMY1 copy number was significantly correlated with the variation observed in salivary amylase production and enzyme activity but did not explain the majority of observed variation between individuals. AMY1-odd and AMY1-even haplotypes showed a different relationship between copy number and expression levels, but the difference was not statistically significant. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001008219", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008219" }, { "database": "PubMed", "id": "28219410", "url": "https://glygen.org/publication/PubMed/28219410" } ] }, { "annotation": "Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the salivary gland. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001008219", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008219" } ] }, { "annotation": "At baseline, a modest association between AMY1 gene copy number and BMI (P = 0.04) was observed but AMY1 gene copy was not associated with baseline glycemic variables.", "evidence": [ { "database": "RefSeq", "id": "NP_001008219", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008219" }, { "database": "PubMed", "id": "30982860", "url": "https://glygen.org/publication/PubMed/30982860" } ] }, { "annotation": "Calcium-binding enzyme that initiates starch digestion in the oral cavity (PubMed:12527308). Catalyzes the hydrolysis of internal (1->4)-alpha-D-glucosidic bonds, yielding a mixture of maltose, isomaltose, small amounts of glucose as well as small linear and branched oligosaccharides called dextrins (PubMed:12527308).", "evidence": [ { "database": "UniProtKB", "id": "P0DTE8", "url": "https://www.uniprot.org/uniprot/P0DTE8#function" }, { "database": "PubMed", "id": "12527308", "url": "https://glygen.org/publication/PubMed/12527308" } ] }, { "annotation": "Diurnal and stress-response salivary alpha amylase patterns were related to child adiposity: decreased morning alpha amylase was associated with increased BMI.", "evidence": [ { "database": "RefSeq", "id": "NP_001008219", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008219" }, { "database": "PubMed", "id": "25588701", "url": "https://glygen.org/publication/PubMed/25588701" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "P0DTE8", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P0DTE8" } ], "glycoeffect": [], "start_pos": 358, "end_pos": 358, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "1", "chr_pos": "103754786", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R358", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DTE8", "url": "https://www.uniprot.org/uniprot/P0DTE8" } ], "common_name": "Human" } ], "gene": [ { "name": "AMY1C", "url": "https://www.uniprot.org/uniprot/P0DTE8", "locus": { "chromosome": "1", "start_pos": 103758726, "end_pos": 103745323, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000187733", "url": "https://www.ensembl.org/id/ENSG00000187733" } ] } } ], "crossref": [ { "id": "ENSG00000187733", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000187733", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P0DTE8", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P0DTE8", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd11317", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd11317", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "AMY1C", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=AMY1C", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "276", "url": "https://www.ncbi.nlm.nih.gov/gene/276", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "277", "url": "https://www.ncbi.nlm.nih.gov/gene/277", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "278", "url": "https://www.ncbi.nlm.nih.gov/gene/278", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "28", "url": "https://glyconnect.expasy.org/browser/proteins/28", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "476", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=476", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR006046", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006046", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006047", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006047", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006048", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006048", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013780", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013780", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017853", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017853", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR031319", "url": "https://www.ebi.ac.uk/interpro/entry/IPR031319", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:276", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:276", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "hsa:277", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:277", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "hsa:278", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:278", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "104702", "url": "http://www.omim.org/entry/104702", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P0DTE8", "url": "https://www.nextprot.org/entry/NX_P0DTE8", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "TFVDNWD", "url": "https://omabrowser.org/oma/group/TFVDNWD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3249969at2759", "url": "http://www.orthodb.org/?query=3249969at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR43447", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43447", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR43447:SF50", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43447:SF50", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00128", "url": "http://pfam.xfam.org/family/PF00128", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02806", "url": "http://pfam.xfam.org/family/PF02806", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P0DTE8", "url": "http://purl.obolibrary.org/obo/PR_P0DTE8", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-189085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189085", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001008219", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008219", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A804HHZ3", "url": "https://www.uniprot.org/uniprot/A0A804HHZ3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A804HHZ3-1", "url": "https://www.uniprot.org/uniprot/A0A804HHZ3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0DTE8", "url": "https://www.uniprot.org/uniprot/P0DTE8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0DTE8-1", "url": "https://www.uniprot.org/uniprot/P0DTE8-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKLFWLLFTIGFCWAQYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL", "length": 511, "header": "sp|P0DTE8-1|AMY1C_HUMAN Isoform 1 of Alpha-amylase 1C OS=Homo sapiens OX=9606 GN=AMY1C PE=1 SV=1 CANONICAL=P0DTE8-1" }, "isoforms": [ { "isoform_ac": "A0A804HHZ3-1", "url": "", "sequence": { "sequence": "MKLFWLLFTIGFCWAQYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDK", "length": 228, "header": "tr|A0A804HHZ3-1|AMY1C_HUMAN Computationally mapped isoform of Alpha-amylase 1C OS=Homo sapiens OX=9606 GN=AMY1C PE=1 SV=1 CANONICAL=P0DTE8-1" }, "locus": { "chromosome": "1", "start_pos": 103752749, "end_pos": 103750470, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000683532.1", "url": "https://www.ensembl.org/id/ENST00000683532.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000506825.1", "url": "https://www.ensembl.org/id/ENSP00000506825.1" } ] } }, { "isoform_ac": "P0DTE8-1", "url": "", "sequence": { "sequence": "MKLFWLLFTIGFCWAQYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL", "length": 511, "header": "sp|P0DTE8-1|AMY1C_HUMAN Isoform 1 of Alpha-amylase 1C OS=Homo sapiens OX=9606 GN=AMY1C PE=1 SV=1 CANONICAL=P0DTE8-1" }, "locus": { "chromosome": "1", "start_pos": 103758655, "end_pos": 103750470, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000684141.1", "url": "https://www.ensembl.org/id/ENST00000684141.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000507077.1", "url": "https://www.ensembl.org/id/ENSP00000507077.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 427, "start_aa": "Asn", "end_pos": 427, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn427", "evidence": [ { "id": "P0DTE8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DTE8#ptm_processing" }, { "id": "16740002", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16740002" }, { "id": "1710976", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1710976" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 476, "start_aa": "Asn", "end_pos": 476, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn476", "evidence": [ { "id": "P0DTE8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DTE8#ptm_processing" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "28", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/28" }, { "id": "6155378", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6155378" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "28", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/28" }, { "id": "6155378", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6155378" } ] }, { "glytoucan_ac": "G52880ZN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "28", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/28" }, { "id": "6155378", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6155378" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "28", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/28" }, { "id": "6155378", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6155378" } ] }, { "glytoucan_ac": "G76478FT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "28", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/28" }, { "id": "6155378", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6155378" } ] }, { "glytoucan_ac": "G82252QI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "28", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/28" }, { "id": "6155378", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6155378" } ] }, { "glytoucan_ac": "G90348RI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "28", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/28" }, { "id": "6155378", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6155378" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_predicted", "glycoprotein_reported", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Subsite mapping of the human pancreatic alpha-amylase active site through structural, kinetic, and mutagenesis techniques.", "journal": "Biochemistry", "date": "2000", "authors": "Brayer GD, Sidhu G, Maurus R, Rydberg EH, Braun C, Wang Y, Nguyen NT, Overall CM, Withers SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-189085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189085" } ], "reference": [ { "type": "PubMed", "id": "10769135", "url": "https://glygen.org/publication/PubMed/10769135" } ] }, { "title": "Identification of a novel acidic mammalian chitinase distinct from chitotriosidase.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Boot RG, Blommaart EF, Swart E, Ghauharali-van der Vlugt K, Bijl N, Moe C, Place A, Aerts JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-189085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189085" } ], "reference": [ { "type": "PubMed", "id": "11085997", "url": "https://glygen.org/publication/PubMed/11085997" } ] }, { "title": "Probing the role of a mobile loop in substrate binding and enzyme activity of human salivary amylase.", "journal": "Journal of molecular biology", "date": "2003", "authors": "Ramasubbu N, Ragunath C, Mishra PJ", "evidence": [ { "database": "UniProtKB", "id": "P0DTE8", "url": "https://www.uniprot.org/uniprot/P0DTE8" } ], "reference": [ { "type": "PubMed", "id": "12527308", "url": "https://glygen.org/publication/PubMed/12527308" } ] }, { "title": "The maltase-glucoamylase gene: common ancestry to sucrase-isomaltase with complementary starch digestion activities.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Nichols BL, Avery S, Sen P, Swallow DM, Hahn D, Sterchi E", "evidence": [ { "database": "Reactome", "id": "R-HSA-189085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189085" } ], "reference": [ { "type": "PubMed", "id": "12547908", "url": "https://glygen.org/publication/PubMed/12547908" } ] }, { "title": "Changing genes; losing lactase.", "journal": "Gut", "date": "2003", "authors": "Grand RJ, Montgomery RK, Chitkara DK, Hirschhorn JN", "evidence": [ { "database": "Reactome", "id": "R-HSA-189085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189085" } ], "reference": [ { "type": "PubMed", "id": "12692040", "url": "https://glygen.org/publication/PubMed/12692040" } ] }, { "title": "Genetics of lactase persistence and lactose intolerance.", "journal": "Annual review of genetics", "date": "2003", "authors": "Swallow DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-189085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189085" } ], "reference": [ { "type": "PubMed", "id": "14616060", "url": "https://glygen.org/publication/PubMed/14616060" } ] }, { "title": "Structure of human salivary alpha-amylase at 1.6-A resolution: implications for its role in the oral cavity.", "journal": "Acta Crystallogr. D", "date": "1996", "authors": "Ramasubbu N, Paloth V, Luo Y, Brayer GD, Levine MJ", "evidence": [ { "database": "UniProtKB", "id": "P0DTE8", "url": "https://www.uniprot.org/uniprot/P0DTE8" }, { "database": "Reactome", "id": "R-HSA-189085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189085" } ], "reference": [ { "type": "PubMed", "id": "15299664", "url": "https://glygen.org/publication/PubMed/15299664" } ] }, { "title": "Kinetic characterization of recombinant human acidic mammalian chitinase.", "journal": "Biochemistry", "date": "2006", "authors": "Chou YT, Yao S, Czerwinski R, Fleming M, Krykbaev R, Xuan D, Zhou H, Brooks J, Fitz L, Strand J, Presman E, Lin L, Aulabaugh A, Huang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-189085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189085" } ], "reference": [ { "type": "PubMed", "id": "16584180", "url": "https://glygen.org/publication/PubMed/16584180" } ] }, { "title": "Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.", "journal": "Journal of proteome research", "date": "2006", "authors": "Ramachandran P, Boontheung P, Xie Y, Sondej M, Wong DT, Loo JA", "evidence": [ { "database": "UniProtKB", "id": "P0DTE8", "url": "https://www.uniprot.org/uniprot/P0DTE8#ptm_processing" }, { "database": "UniProtKB", "id": "P0DTE8", "url": "https://www.uniprot.org/uniprot/P0DTE8" } ], "reference": [ { "type": "PubMed", "id": "16740002", "url": "https://glygen.org/publication/PubMed/16740002" } ] }, { "title": "Rabbit small intestinal trehalase. Purification, cDNA cloning, expression, and verification of glycosylphosphatidylinositol anchoring.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Ruf J, Wacker H, James P, Maffia M, Seiler P, Galand G, von Kieckebusch A, Semenza G, Matei N", "evidence": [ { "database": "Reactome", "id": "R-HSA-189085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189085" } ], "reference": [ { "type": "PubMed", "id": "1697585", "url": "https://glygen.org/publication/PubMed/1697585" } ] }, { "title": "Electrophoretic characterization of posttranslational modifications of human parotid salivary alpha-amylase.", "journal": "Electrophoresis", "date": "1991", "authors": "Bank RA, Hettema EH, Arwert F, Amerongen AV, Pronk JC", "evidence": [ { "database": "UniProtKB", "id": "P0DTE8", "url": "https://www.uniprot.org/uniprot/P0DTE8#ptm_processing" }, { "database": "UniProtKB", "id": "P0DTE8", "url": "https://www.uniprot.org/uniprot/P0DTE8" } ], "reference": [ { "type": "PubMed", "id": "1710976", "url": "https://glygen.org/publication/PubMed/1710976" } ] }, { "title": "Acidic mammalian chitinase is secreted via an ADAM17/epidermal growth factor receptor-dependent pathway and stimulates chemokine production by pulmonary epithelial cells.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Hartl D, He CH, Koller B, Da Silva CA, Homer R, Lee CG, Elias JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-189085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189085" } ], "reference": [ { "type": "PubMed", "id": "18824549", "url": "https://glygen.org/publication/PubMed/18824549" } ] }, { "title": "Triad of polar residues implicated in pH specificity of acidic mammalian chitinase.", "journal": "Protein science : a publication of the Protein Society", "date": "2009", "authors": "Olland AM, Strand J, Presman E, Czerwinski R, Joseph-McCarthy D, Krykbaev R, Schlingmann G, Chopra R, Lin L, Fleming M, Kriz R, Stahl M, Somers W, Fitz L, Mosyak L", "evidence": [ { "database": "Reactome", "id": "R-HSA-189085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189085" } ], "reference": [ { "type": "PubMed", "id": "19241384", "url": "https://glygen.org/publication/PubMed/19241384" } ] }, { "title": "Differential enzymatic activity of common haplotypic versions of the human acidic Mammalian chitinase protein.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Seibold MA, Reese TA, Choudhry S, Salam MT, Beckman K, Eng C, Atakilit A, Meade K, Lenoir M, Watson HG, Thyne S, Kumar R, Weiss KB, Grammer LC, Avila P, Schleimer RP, Fahy JV, Rodriguez-Santana J, Rodriguez-Cintron W, Boot RG, Sheppard D, Gilliland FD, Locksley RM, Burchard EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-189085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189085" } ], "reference": [ { "type": "PubMed", "id": "19435888", "url": "https://glygen.org/publication/PubMed/19435888" } ] }, { "title": "Structural hierarchy of regulatory elements in the folding and transport of an intestinal multidomain protein.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Behrendt M, Polaina J, Naim HY", "evidence": [ { "database": "Reactome", "id": "R-HSA-189085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189085" } ], "reference": [ { "type": "PubMed", "id": "19955176", "url": "https://glygen.org/publication/PubMed/19955176" } ] }, { "title": "Structural basis for substrate selectivity in human maltase-glucoamylase and sucrase-isomaltase N-terminal domains.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Sim L, Willemsma C, Mohan S, Naim HY, Pinto BM, Rose DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-189085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189085" } ], "reference": [ { "type": "PubMed", "id": "20356844", "url": "https://glygen.org/publication/PubMed/20356844" } ] }, { "title": "Concerted evolution of human amylase genes.", "journal": "Molecular and cellular biology", "date": "1988", "authors": "Gumucio DL, Wiebauer K, Caldwell RM, Samuelson LC, Meisler MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-189085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189085" } ], "reference": [ { "type": "PubMed", "id": "2452973", "url": "https://glygen.org/publication/PubMed/2452973" } ] }, { "title": "Salivary alpha amylase diurnal pattern and stress response are associated with body mass index in low-income preschool-aged children.", "journal": "Psychoneuroendocrinology", "date": "2015", "authors": "Miller AL, Sturza J, Rosenblum K, Vazquez DM, Kaciroti N, Lumeng JC", "evidence": [ { "database": "RefSeq", "id": "NP_001008219", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008219" } ], "reference": [ { "type": "PubMed", "id": "25588701", "url": "https://glygen.org/publication/PubMed/25588701" } ] }, { "title": "Copy number variation of human AMY1 is a minor contributor to variation in salivary amylase expression and activity.", "journal": "Human genomics", "date": "2017", "authors": "Carpenter D, Mitchell LM, Armour JA", "evidence": [ { "database": "RefSeq", "id": "NP_001008219", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008219" } ], "reference": [ { "type": "PubMed", "id": "28219410", "url": "https://glygen.org/publication/PubMed/28219410" } ] }, { "title": "Salivary alpha-amylase copy number is not associated with weight trajectories and glycemic improvements following clinical weight loss: results from a 2-phase dietary intervention study.", "journal": "The American journal of clinical nutrition", "date": "2019", "authors": "Valsesia A, Kulkarni SS, Marquis J, Leone P, Mironova P, Walter O, Hjorth MF, Descombes P, Hager J, Saris WH, Astrup A, Darimont C, O'Callaghan NJ", "evidence": [ { "database": "RefSeq", "id": "NP_001008219", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008219" } ], "reference": [ { "type": "PubMed", "id": "30982860", "url": "https://glygen.org/publication/PubMed/30982860" } ] }, { "title": "Trehalase deficiency in Greenland.", "journal": "Scandinavian journal of gastroenterology", "date": "1988", "authors": "Gudmand-Hoyer E, Fenger HJ, Skovbjerg H, Kern-Hansen P, Madsen PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-189085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189085" } ], "reference": [ { "type": "PubMed", "id": "3227291", "url": "https://glygen.org/publication/PubMed/3227291" } ] }, { "title": "AMY1 Gene Copy Number Correlates With Glucose Absorption and Visceral Fat Volume, but Not with Insulin Resistance.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2020", "authors": "Barber TM, Bhatti AA, Elder PJD, Ball SP, Calvez R, Ramsden DB, Cuthbertson DJ, Pfeiffer AF, Burnett D, Weickert MO", "evidence": [ { "database": "RefSeq", "id": "NP_001008219", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008219" } ], "reference": [ { "type": "PubMed", "id": "32697825", "url": "https://glygen.org/publication/PubMed/32697825" } ] }, { "title": "Topology and quaternary structure of pro-sucrase/isomaltase and final-form sucrase/isomaltase.", "journal": "The Biochemical journal", "date": "1986", "authors": "Cowell GM, Tranum-Jensen J, Sjostrom H, Noren O", "evidence": [ { "database": "Reactome", "id": "R-HSA-189085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189085" } ], "reference": [ { "type": "PubMed", "id": "3800897", "url": "https://glygen.org/publication/PubMed/3800897" } ] }, { "title": "Expression and intracellular transport of microvillus membrane hydrolases in human intestinal epithelial cells.", "journal": "The Journal of cell biology", "date": "1985", "authors": "Hauri HP, Sterchi EE, Bienz D, Fransen JA, Marxer A", "evidence": [ { "database": "Reactome", "id": "R-HSA-189085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189085" } ], "reference": [ { "type": "PubMed", "id": "3897250", "url": "https://glygen.org/publication/PubMed/3897250" } ] }, { "title": "Trehalase deficiency in a family.", "journal": "Gastroenterology", "date": "1973", "authors": "Madzarovova-Nohejlova J", "evidence": [ { "database": "Reactome", "id": "R-HSA-189085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189085" } ], "reference": [ { "type": "PubMed", "id": "4737205", "url": "https://glygen.org/publication/PubMed/4737205" } ] }, { "title": "Trehalose malabsorption causing intolerance to mushrooms. Report of a probable case.", "journal": "Gastroenterology", "date": "1971", "authors": "Bergoz R", "evidence": [ { "database": "Reactome", "id": "R-HSA-189085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189085" } ], "reference": [ { "type": "PubMed", "id": "5104075", "url": "https://glygen.org/publication/PubMed/5104075" } ] }, { "title": "Structural studies of the sugar chains of human parotid alpha-amylase.", "journal": "The Journal of biological chemistry", "date": "1980", "authors": "Yamashita K, Tachibana Y, Nakayama T, Kitamura M, Endo Y, Kobata A", "evidence": [ { "database": "GlyConnect", "id": "28", "url": "https://glyconnect.expasy.org/browser/proteins/28" } ], "reference": [ { "type": "PubMed", "id": "6155378", "url": "https://glygen.org/publication/PubMed/6155378" } ] }, { "title": "Purification and characterization of kidney and intestinal brush-border membrane trehalases from the rabbit.", "journal": "Biochimica et biophysica acta", "date": "1984", "authors": "Galand G", "evidence": [ { "database": "Reactome", "id": "R-HSA-189085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189085" } ], "reference": [ { "type": "PubMed", "id": "6466686", "url": "https://glygen.org/publication/PubMed/6466686" } ] }, { "title": "Human lactase-phlorizin hydrolase: evidence of dimerization in the endoplasmic reticulum.", "journal": "Archives of biochemistry and biophysics", "date": "1995", "authors": "Grunberg J, Sterchi EE", "evidence": [ { "database": "Reactome", "id": "R-HSA-189085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189085" } ], "reference": [ { "type": "PubMed", "id": "7487100", "url": "https://glygen.org/publication/PubMed/7487100" } ] }, { "title": "Purification and characterization of human chitotriosidase, a novel member of the chitinase family of proteins.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Renkema GH, Boot RG, Muijsers AO, Donker-Koopman WE, Aerts JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-189085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189085" } ], "reference": [ { "type": "PubMed", "id": "7836450", "url": "https://glygen.org/publication/PubMed/7836450" } ] }, { "title": "Dimeric assembly of enterocyte brush border enzymes.", "journal": "Biochemistry", "date": "1994", "authors": "Danielsen EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-189085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189085" } ], "reference": [ { "type": "PubMed", "id": "7906143", "url": "https://glygen.org/publication/PubMed/7906143" } ] }, { "title": "Human intestinal sucrase-isomaltase. Identification of free sucrase and isomaltase and cleavage of the hybrid into active distinct subunits.", "journal": "The Journal of biological chemistry", "date": "1975", "authors": "Conklin KA, Yamashiro KM, Gray GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-189085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189085" } ], "reference": [ { "type": "PubMed", "id": "807575", "url": "https://glygen.org/publication/PubMed/807575" } ] }, { "title": "Proteolytic processing of human lactase-phlorizin hydrolase is a two-step event: identification of the cleavage sites.", "journal": "Archives of biochemistry and biophysics", "date": "1996", "authors": "Wuthrich M, Grunberg J, Hahn D, Jacob R, Radebach I, Naim HY, Sterchi EE", "evidence": [ { "database": "Reactome", "id": "R-HSA-189085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189085" } ], "reference": [ { "type": "PubMed", "id": "8951031", "url": "https://glygen.org/publication/PubMed/8951031" } ] }, { "title": "Molecular cloning, sequencing and expression of cDNA encoding human trehalase.", "journal": "Gene", "date": "1997", "authors": "Ishihara R, Taketani S, Sasai-Takedatsu M, Kino M, Tokunaga R, Kobayashi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-189085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189085" } ], "reference": [ { "type": "PubMed", "id": "9427547", "url": "https://glygen.org/publication/PubMed/9427547" } ] }, { "title": "Human small intestinal maltase-glucoamylase cDNA cloning. Homology to sucrase-isomaltase.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Nichols BL, Eldering J, Avery S, Hahn D, Quaroni A, Sterchi E", "evidence": [ { "database": "Reactome", "id": "R-HSA-189085", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189085" } ], "reference": [ { "type": "PubMed", "id": "9446624", "url": "https://glygen.org/publication/PubMed/9446624" } ] } ], "pathway": [ { "id": "hsa:276", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:276", "resource": "KEGG Pathway" }, { "id": "hsa:277", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:277", "resource": "KEGG Pathway" }, { "id": "hsa:278", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:278", "resource": "KEGG Pathway" }, { "id": "R-HSA-189085", "name": "Digestion of dietary carbohydrate", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189085", "resource": "Reactome", "description": "Digestion of dietary carbohydrate" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A8I5ZU41-1", "protein_name": "Alpha-amylase", "gene_name": "Amy1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MTLPLHFSLQRHLTREYCQHHSRMKFFLLLSLIGLCWAQYDPHTFYGRSSIVHLFEWRWVDIAKECERYLAPNGFGGVQVSPPNENIVVNSPFRPWWERYQPISYKICSRSGNEDEFRDMVNRCNNVGVRIYVDAVINHMCGVGAEAGQSSTCGSYFNPNNRDFPGVPYSGFDFNDGKCKTGSGGIENYNDAAQVRDCRLSGLLDLALEKDYVRTKVADYMNHLIDIGVAGFRLDASKHMWPGDIKAVLDKLHNLNTKWFSEGSKPFIYQEVIDLGGEAVSSNEYFGNGRVTEFKYGAKLGKVLRKWDGEKMAYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKMAVGFMLAHPYGFTRVMSSFHWPRYFENGKDVNDWVGPPNNNGATKEVTINSDSTCGNDWVCEHRWRQIRNMVAFRNVVNGQPFANWWDNGSNQVAFGRGNKGFIVFNNDDWDLSTTLQTGLPAGTYCDVISGDKVDGNCTGIKVYVGSDGNAYFSISNSAEDPFIAIHVESKI", "length": 534 }, "evidence": [ { "id": "45922302", "url": "http://www.informatics.jax.org/homology/45922302", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P00687-1", "protein_name": "Alpha-amylase 1", "gene_name": "Amy1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKFFLLLSLIGFCWAQYDPHTQYGRTAIVHLFEWRWVDIAKECERYLAPNGFAGVQVSPPNENIVVHSPSRPWWERYQPISYKICSRSGNEDEFRDMVNRCNNVGVRIYVDAVINHMCGVGAQAGQSSTCGSYFNPNNRDFPGVPYSGFDFNDGKCRTASGGIENYQDAAQVRDCRLSGLLDLALEKDYVRTKVADYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNTKWFSQGSRPFIFQEVIDLGGEAVSSNEYFGNGRVTEFKYGAKLGKVMRKWDGEKMSYLKNWGEGWGLMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYYWPRNFQNGKDVNDWVGPPNNNGKTKEVSINPDSTCGNDWICEHRWRQIRNMVAFRNVVNGQPFANWWDNDSNQVAFGRGNKGFIVFNNDDWALSETLQTGLPAGTYCDVISGDKVDGNCTGIKVYVGNDGKAHFSISNSAEDPFIAIHAESKI", "length": 511 }, "evidence": [ { "id": "45922302", "url": "http://www.informatics.jax.org/homology/45922302", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P00688-1", "protein_name": "Pancreatic alpha-amylase 2a5", "gene_name": "Amy2a5", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKFVLLLSLIGFCWAQYDPHTSDGRTAIVHLFEWRWVDIAKECERYLAPKGFGGVQVSPPNENVVVHNPSRPWWERYQPISYKICTRSGNEDEFRDMVTRCNNVGVRIYVDAVINHMCGAGNPAGTSSTCGSYLNPNNREFPAVPYSAWDFNDNKCNGEIDNYNDAYQVRNCRLTGLLDLALEKDYVRTKVADYMNHLIDIGVAGFRLDAAKHMWPGDIKAVLDKLHNLNTKWFSQGSRPFIFQEVIDLGGEAIKGSEYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGLVPSDRALVFVDNHDNQRGHGAGGSSILTFWDARMYKMAVGFMLAHPYGFTRVMSSYRWNRNFQNGKDQNDWIGPPNNNGVTKEVTINADTTCGNDWVCEHRWRQIRNMVAFRNVVNGQPFSNWWDNNSNQVAFSRGNRGFIVFNNDDWALSATLQTGLPAGTYCDVISGDKVDGNCTGLRVNVGSDGKAHFSISNSAEDPFIAIHADSKL", "length": 508 }, "evidence": [ { "id": "45924974", "url": "http://www.informatics.jax.org/homology/45924974", "database": "MGI" }, { "id": "45924975", "url": "http://www.informatics.jax.org/homology/45924975", "database": "MGI" }, { "id": "45924976", "url": "http://www.informatics.jax.org/homology/45924976", "database": "MGI" }, { "id": "45924977", "url": "http://www.informatics.jax.org/homology/45924977", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P00689-1", "protein_name": "Pancreatic alpha-amylase", "gene_name": "Amy2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKFVLLLSLIGFCWAQYDPHTADGRTAIVHLFEWRWADIAKECERYLAPKGFGGVQVSPPNENIIINNPSRPWWERYQPISYKICSRSGNENEFKDMVTRCNNVGVRIYVDAVINHMCGSGNSAGTHSTCGSYFNPNNREFSAVPYSAWYFNDNKCNGEINNYNDANQVRNCRLSGLLDLALDKDYVRTKVADYMNNLIDIGVAGFRLDAAKHMWPGDIKAVLDKLHNLNTKWFSQGSRPFIFQEVIDLGGEAIKGSEYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPTDRALVFVDNHDNQRGHGAGGASILTFWDARMYKMAVGFMLAHPYGFTRVMSSYRRTRNFQNGKDVNDWIGPPNNNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVAFRNVVNGQPFANWWDNGSNQVAFSRGNRGFIVFNNDDWALSSTLQTGLPAGTYCDVISGDKVNGNCTGLKVNVGSDGKAHFSISNSAEDPFIAIHADSKL", "length": 508 }, "evidence": [ { "id": "45924974", "url": "http://www.informatics.jax.org/homology/45924974", "database": "MGI" }, { "id": "45924975", "url": "http://www.informatics.jax.org/homology/45924975", "database": "MGI" }, { "id": "45924976", "url": "http://www.informatics.jax.org/homology/45924976", "database": "MGI" }, { "id": "45924977", "url": "http://www.informatics.jax.org/homology/45924977", "database": "MGI" }, { "id": "45924973", "url": "http://www.informatics.jax.org/homology/45924973", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P04746-1", "protein_name": "Pancreatic alpha-amylase", "gene_name": "AMY2A", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MKFFLLLFTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL", "length": 511 }, "evidence": [ { "id": "45924974", "url": "http://www.informatics.jax.org/homology/45924974", "database": "MGI" }, { "id": "45924975", "url": "http://www.informatics.jax.org/homology/45924975", "database": "MGI" }, { "id": "45924976", "url": "http://www.informatics.jax.org/homology/45924976", "database": "MGI" }, { "id": "45924977", "url": "http://www.informatics.jax.org/homology/45924977", "database": "MGI" }, { "id": "45924973", "url": "http://www.informatics.jax.org/homology/45924973", "database": "MGI" }, { "id": "45922302", "url": "http://www.informatics.jax.org/homology/45922302", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P19961-1", "protein_name": "Alpha-amylase 2B", "gene_name": "AMY2B", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MKFFLLLFTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMSGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLVGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL", "length": 511 }, "evidence": [ { "id": "45924974", "url": "http://www.informatics.jax.org/homology/45924974", "database": "MGI" }, { "id": "45924975", "url": "http://www.informatics.jax.org/homology/45924975", "database": "MGI" }, { "id": "45924976", "url": "http://www.informatics.jax.org/homology/45924976", "database": "MGI" }, { "id": "45924977", "url": "http://www.informatics.jax.org/homology/45924977", "database": "MGI" }, { "id": "45924973", "url": "http://www.informatics.jax.org/homology/45924973", "database": "MGI" }, { "id": "45922302", "url": "http://www.informatics.jax.org/homology/45922302", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P0DTE8", "url": "https://www.uniprot.org/uniprot/P0DTE8" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P0DTE8", "url": "https://www.uniprot.org/uniprot/P0DTE8" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "carbohydrate metabolic process", "id": "GO:0005975", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005975", "evidence": [ { "database": "UniProtKB", "id": "P0DTE8", "url": "https://www.uniprot.org/uniprot/P0DTE8" } ], "pmid": "" }, { "name": "oligosaccharide metabolic process", "id": "GO:0009311", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009311", "evidence": [ { "database": "UniProtKB", "id": "P0DTE8", "url": "https://www.uniprot.org/uniprot/P0DTE8" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "chloride ion binding", "id": "GO:0031404", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031404", "evidence": [ { "database": "UniProtKB", "id": "P0DTE8", "url": "https://www.uniprot.org/uniprot/P0DTE8" } ], "pmid": "" }, { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "P0DTE8", "url": "https://www.uniprot.org/uniprot/P0DTE8" } ], "pmid": "" }, { "name": "alpha-amylase activity", "id": "GO:0004556", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004556", "evidence": [ { "database": "UniProtKB", "id": "P0DTE8", "url": "https://www.uniprot.org/uniprot/P0DTE8" } ], "pmid": "" }, { "name": "cation binding", "id": "GO:0043169", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043169", "evidence": [ { "database": "UniProtKB", "id": "P0DTE8", "url": "https://www.uniprot.org/uniprot/P0DTE8" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 427, "end_pos": 429, "annotation": "n_glycosylation_sequon" }, { "start_pos": 476, "end_pos": 478, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-HSA-188979", "name": "Digestion of linear starch (amylose) by extracellular amylase", "equation": "", "summary": "Extracellular amylose starch, linear polymers of glucose joined by alpha-1,4 linkages, is digested by the endoglucosidase activity of alpha-amylases, yielding maltose, maltotriose, and longer maltosides. The human genome contains five functional alpha-amylase genes, encoding structurally closely related isoenzymes (Gumucio et al. 1988). Three of these genes encode proteins synthesized in the parotid glands and released into the saliva (amylase 1A, B, and C), and the other two encode proteins synthesized in the exocrine pancreas and released into the small intestine (amylase 2A and B). In the human body, starch digestion thus commences in the mouth, mediated by salivary amylases, and is continued in the small intestine, mediated by the pancreatic ones.

X-ray crystallographic studies of amylase 1A and 2A proteins show them to be monomers, complexed with single calcium and chloride ions (Ramasubbu et al. 1996; Brayer et al. 2000). Biochemical characterization of amylase 2A indicates that the enzyme efficiently cleaves poly-glucose chains so as to release maltose - a glucose disaccharide - from the reducing end of the chain (Braun et al. 1993; Brayer et al. 2000).", "cellular_location": "extracellular region", "input_participant_list": [ "R-ALL-189075" ], "output_participant_list": [], "enzyme_list": [ "P04746-1", "P19961-1", "P0DTE7-1", "P0DUB6-1", "P0DTE8-1" ], "evidence": [ { "id": "R-HSA-188979", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-188979" } ] }, { "id": "R-HSA-191114", "name": "Digestion of branched starch (amylopectin) by extracellular amylase", "equation": "", "summary": "The 1-4 linkages of extracellular amylopectin starch, a glucose polymer containing linear segments formed by alpha-1,4 linkages and a smaller number of alpha-1,6 linkages forming branch points, are digested by the endoglucosidase activity of alpha-amylases, yielding maltose, maltotriose, and longer maltosides from the alpha-1,4 linear segments and alpha-limit dextrins from the branch points. Alpha-limit dextrins are glucose (G) oligomers linked by 1-4 and 1-6 bonds. 1-6 branch points make up about 5% of all amylopectin glucose bonds - the exact fraction depends on the source of the starch. Mass spectroscopic analysis of alpha-limit dextrin shows it to be a mixture of maltosides and isomaltosides containing two to forty G residues, but the most common contain fewer than seven. Maltose (G2) is the shortest 1-4 maltoside produced by alpha-amylase. Isomaltose (G2) is the shortest 1-6 isomaltoside.

The human genome contains five functional alpha-amylase genes, encoding structurally closely related isoenzymes (Gumucio et al. 1988). Three of these genes encode proteins synthesized in the parotid glands and released into the saliva (amylase 1A, B, and C), and the other two encode proteins synthesized in the exocrine pancreas and released into the small intestine (amylase 2A and B). In the human body, starch digestion thus commences in the mouth, mediated by salivary amylases, and is continued in the small intestine, mediated by the pancreatic ones.

X-ray crystallographic studies of amylase 1A and 2A proteins show them to be monomers, complexed with single calcium and chloride ions (Ramasubbu et al. 1996; Brayer et al. 2000). Biochemical characterization of amylase 2A indicates that the enzyme efficiently cleaves poly-glucose chains so as to release maltose - a glucose disaccharide - from the reducing end of the chain (Braun et al. 1993; Brayer et al. 2000).", "cellular_location": "extracellular region", "input_participant_list": [ "R-ALL-189071" ], "output_participant_list": [], "enzyme_list": [ "P04746-1", "P19961-1", "P0DTE7-1", "P0DUB6-1", "P0DTE8-1" ], "evidence": [ { "id": "R-HSA-191114", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191114" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-189071", "participant_name": "starch (amylopectin) [extracellular region]", "crossref": [ { "id": "28057", "database": "ChEBI", "url": "" }, { "id": "28057", "database": "ChEBI", "url": "" }, { "id": "28057", "database": "ChEBI", "url": "" }, { "id": "28057", "database": "ChEBI", "url": "" }, { "id": "28057", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-189075", "participant_name": "starch (amylose) [extracellular region]", "crossref": [ { "id": "28102", "database": "ChEBI", "url": "" }, { "id": "28102", "database": "ChEBI", "url": "" }, { "id": "28102", "database": "ChEBI", "url": "" }, { "id": "28102", "database": "ChEBI", "url": "" }, { "id": "28102", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "P04746", "gene_name": "AMY2A", "activity": [ { "ec_number": "3.2.1.1", "activity": "Endohydrolysis of (1->4)-alpha-D-glucosidic linkages in polysaccharides containing three or more (1->4)-alpha-linked D-glucose units.", "evidence": [ { "id": "P04746", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04746" } ] }, { "ec_number": "3.2.1.1", "activity": "", "evidence": [ { "id": "P04746", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04746" } ] } ] }, { "uniprot_ac": "P0DTE7", "gene_name": "AMY1B", "activity": [ { "ec_number": "3.2.1.1", "activity": "Endohydrolysis of (1->4)-alpha-D-glucosidic linkages in polysaccharides containing three or more (1->4)-alpha-linked D-glucose units.", "evidence": [ { "id": "P0DTE7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DTE7" } ] }, { "ec_number": "3.2.1.1", "activity": "", "evidence": [ { "id": "P0DTE7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DTE7" } ] } ] }, { "uniprot_ac": "P0DTE8", "gene_name": "AMY1C", "activity": [ { "ec_number": "3.2.1.1", "activity": "Endohydrolysis of (1->4)-alpha-D-glucosidic linkages in polysaccharides containing three or more (1->4)-alpha-linked D-glucose units.", "evidence": [ { "id": "P0DTE8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DTE8" } ] }, { "ec_number": "3.2.1.1", "activity": "", "evidence": [ { "id": "P0DTE8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DTE8" } ] } ] }, { "uniprot_ac": "P0DUB6", "gene_name": "AMY1A", "activity": [ { "ec_number": "3.2.1.1", "activity": "Endohydrolysis of (1->4)-alpha-D-glucosidic linkages in polysaccharides containing three or more (1->4)-alpha-linked D-glucose units.", "evidence": [ { "id": "P0DUB6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DUB6" } ] }, { "ec_number": "3.2.1.1", "activity": "", "evidence": [ { "id": "P0DUB6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DUB6" } ] } ] }, { "uniprot_ac": "P19961", "gene_name": "AMY2B", "activity": [ { "ec_number": "3.2.1.1", "activity": "Endohydrolysis of (1->4)-alpha-D-glucosidic linkages in polysaccharides containing three or more (1->4)-alpha-linked D-glucose units.", "evidence": [ { "id": "P19961", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19961" } ] }, { "ec_number": "3.2.1.1", "activity": "", "evidence": [ { "id": "P19961", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19961" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 427, 476 ], "o_linked_sites": [], "snv_sites": [ 358 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 427, "end_pos": 429 }, { "start_pos": 476, "end_pos": 478 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 7 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 7 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 35 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }