{ "uniprot_canonical_ac": "P0DTE4-5", "uniprot_ac": "P0DTE4", "uniprot_id": "UD2A1_HUMAN", "mass": { "chemical_mass": 59963.0, "monoisotopic_mass": 59963.0 }, "refseq": { "ac": "NP_001239203", "name": "UDP-glucuronosyltransferase 2A1 isoform 2 precursor", "summary": "The protein encoded by this gene belongs to the UDP-glycosyltransferase family. Members of this protein family play a role in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. The encoded enzyme is expressed in the olfactory neuroepithelium, which lines the posterior nasal cavity and is exposed to a wide range of odorants and airborne toxic compounds. Hence, this protein has been suggested to be involved in clearing lipophilic odorant molecules from the sensory epithelium. This gene shares exon structure with the UDP glucuronosyltransferase 2A2 family member, which encodes N-terminally distinct isoforms. Polymorphisms in this gene may be associated with the loss of taste and smell that is reported by some individuals during SARS-CoV-2 infection. [provided by RefSeq, Jan 2022].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239203" }, "gene_names": [ { "name": "UGT2A1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P0DTE4", "id": "P0DTE4" }, { "name": "UDPGT2A1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239203", "id": "NP_001239203" }, { "name": "UGT2A1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239203", "id": "NP_001239203" } ], "protein_names": [ { "name": "UDP-glucuronosyltransferase 2A1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P0DTE4" }, { "name": "2.4.1.17", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DTE4" }, { "name": "UDP glycosyltransferase 2 family, polypeptide A1; UDP-glucuronosyltransferase 2A1; uridine diphosphate glycosyltransferase 2 family, member A1; UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239203", "id": "NP_001239203" }, { "name": "UDP-glucuronosyltransferase 2A1 isoform 2 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239203", "id": "NP_001239203" }, { "name": "UDPGT 2A1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DTE4" }, { "name": "UGT2A1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DTE4" } ], "function": [ { "annotation": "Association of SNPs of PEAR1, P2Y12, and UGT2A1 with platelet reactivity in 290 Chinese patients with acute coronary syndrome treated with aspirin and clopidogrel", "evidence": [ { "database": "RefSeq", "id": "NP_001239203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239203" }, { "database": "PubMed", "id": "29635252", "url": "https://glygen.org/publication/PubMed/29635252" } ] }, { "annotation": "Expression of novel UDP-glucuronosyltransferase 2A1 splice variant could play an important role in the detoxification of carcinogens within target tissues for tobacco carcinogenesis.", "evidence": [ { "database": "RefSeq", "id": "NP_001239203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239203" }, { "database": "PubMed", "id": "22984225", "url": "https://glygen.org/publication/PubMed/22984225" } ] }, { "annotation": "Regulation of UGT2A1 by miR-196a-5p and miR-196b-5p", "evidence": [ { "database": "RefSeq", "id": "NP_001239203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239203" }, { "database": "PubMed", "id": "30850392", "url": "https://glygen.org/publication/PubMed/30850392" } ] }, { "annotation": "Results show that UGT2A2 not only shares exons 2-6 with UGT2A1, it also shares with it a similar tissue expression pattern; both UGTs are primarily expressed in nasal epithelium. The 3rd member of UGT2A subfamily, UGT2A3 exhibited a different tissue expression pattern, found mainly in liver and small intestine.", "evidence": [ { "database": "RefSeq", "id": "NP_001239203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239203" }, { "database": "PubMed", "id": "19858781", "url": "https://glygen.org/publication/PubMed/19858781" } ] }, { "annotation": "The Km values of UGT2A1 varied between 102.2 +/- 14.3 microM and 2.4 +/- 1.2 mM.", "evidence": [ { "database": "RefSeq", "id": "NP_001239203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239203" }, { "database": "PubMed", "id": "23756265", "url": "https://glygen.org/publication/PubMed/23756265" } ] }, { "annotation": "The UGT2A1/UGT2A2 locus is associated with COVID-19-related loss of smell or taste.", "evidence": [ { "database": "RefSeq", "id": "NP_001239203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239203" }, { "database": "PubMed", "id": "35039640", "url": "https://glygen.org/publication/PubMed/35039640" } ] }, { "annotation": "The protein encoded by this gene belongs to the UDP-glycosyltransferase family. Members of this protein family play a role in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. The encoded enzyme is expressed in the olfactory neuroepithelium, which lines the posterior nasal cavity and is exposed to a wide range of odorants and airborne toxic compounds. Hence, this protein has been suggested to be involved in clearing lipophilic odorant molecules from the sensory epithelium. This gene shares exon structure with the UDP glucuronosyltransferase 2A2 family member, which encodes N-terminally distinct isoforms. Polymorphisms in this gene may be associated with the loss of taste and smell that is reported by some individuals during SARS-CoV-2 infection. [provided by RefSeq, Jan 2022].", "evidence": [ { "database": "RefSeq", "id": "NP_001239203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239203" } ] }, { "annotation": "UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:10359671, PubMed:19858781, PubMed:18719240, PubMed:19022937, PubMed:23756265, PubMed:23288867). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:10359671, PubMed:19858781, PubMed:23756265). Catalyzes the glucuronidation of endogenous steroid hormones such as androgens (testosterone and epitestosterone) and estrogens (estradiol and epiestriol) (PubMed:18719240, PubMed:19858781, PubMed:19022937, PubMed:23288867). Contributes to bile acid (BA) detoxification by catalyzing the glucuronidation of BA substrates, which are natural detergents for dietary lipids absorption (PubMed:23756265). Shows a high affinity to aliphatic odorants such as citronellol as well as olfactory tissue specificity, and therefore may be involved in olfaction (PubMed:10359671). Shows a potential role in detoxification of toxic waste compounds in the amniotic fluid before birth, and air-born chemical after birth (PubMed:19858781).", "evidence": [ { "database": "UniProtKB", "id": "P0DTE4", "url": "https://www.uniprot.org/uniprot/P0DTE4#function" }, { "database": "PubMed", "id": "10359671", "url": "https://glygen.org/publication/PubMed/10359671" }, { "database": "PubMed", "id": "19022937", "url": "https://glygen.org/publication/PubMed/19022937" }, { "database": "PubMed", "id": "19858781", "url": "https://glygen.org/publication/PubMed/19858781" }, { "database": "PubMed", "id": "23288867", "url": "https://glygen.org/publication/PubMed/23288867" }, { "database": "PubMed", "id": "18719240", "url": "https://glygen.org/publication/PubMed/18719240" }, { "database": "PubMed", "id": "23756265", "url": "https://glygen.org/publication/PubMed/23756265" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs541627076", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs541627076" }, { "id": "rs541627076", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs541627076" }, { "id": "rs541627076", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs541627076" }, { "id": "rs541627076", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs541627076#frequency_tab" }, { "id": "rs541627076", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs541627076" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 347, "end_pos": 347, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->KNT).", "chr_id": "4", "chr_pos": "69595205", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "N347", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs765655029", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765655029" }, { "id": "rs765655029", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765655029" }, { "id": "rs765655029", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs765655029#frequency_tab" }, { "id": "rs765655029", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765655029" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 349, "end_pos": 349, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->NNI).", "chr_id": "4", "chr_pos": "69595200", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T349", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1470469921", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1470469921" }, { "id": "rs1470469921", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1470469921#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 378, "end_pos": 378, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NGI->NGT).", "chr_id": "4", "chr_pos": "69594648", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I378", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs761325918", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761325918" }, { "id": "rs761325918", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761325918" }, { "id": "rs761325918", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761325918" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 402, "end_pos": 402, "sequence_org": "A", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NIA->NIS).", "chr_id": "4", "chr_pos": "69594577", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A402", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs181872950", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs181872950" }, { "id": "rs181872950", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs181872950" }, { "id": "rs181872950", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs181872950" }, { "id": "rs181872950", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs181872950#frequency_tab" }, { "id": "rs181872950", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs181872950" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 434, "end_pos": 434, "sequence_org": "P", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NEP->NET).", "chr_id": "4", "chr_pos": "69594481", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.000799", "site_lbl": "P434", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs145089093", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145089093" }, { "id": "rs145089093", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs145089093" }, { "id": "rs145089093", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145089093" }, { "id": "rs145089093", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs145089093#frequency_tab" }, { "id": "rs145089093", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs145089093" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 67, "end_pos": 67, "sequence_org": "P", "sequence_mut": "Q", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPS->NQS).", "chr_id": "4", "chr_pos": "69647445", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.000599", "site_lbl": "P67", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1400580912", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1400580912" }, { "id": "rs1400580912", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1400580912" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 67, "end_pos": 67, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPS->NSS).", "chr_id": "4", "chr_pos": "69647446", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P67", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs754218825", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754218825" }, { "id": "rs754218825", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754218825" }, { "id": "rs754218825", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754218825" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 99, "end_pos": 99, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NRP->NRS).", "chr_id": "4", "chr_pos": "69647350", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P99", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DTE4", "url": "https://www.uniprot.org/uniprot/P0DTE4" } ], "common_name": "Human" } ], "gene": [ { "name": "UGT2A1", "url": "https://www.uniprot.org/uniprot/P0DTE4", "locus": { "chromosome": "4", "start_pos": 69588417, "end_pos": 69653249, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000173610", "url": "https://www.ensembl.org/id/ENSG00000173610" } ] } } ], "crossref": [ { "id": "ENSG00000173610", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173610", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd03784", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03784", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL1743321", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1743321", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "UGT2A1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=UGT2A1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "10941", "url": "https://www.ncbi.nlm.nih.gov/gene/10941", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "12542", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=12542", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR002213", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002213", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035595", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035595", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:10941", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10941", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "604716", "url": "http://www.omim.org/entry/604716", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P0DTE4", "url": "https://www.nextprot.org/entry/NX_P0DTE4", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "WHTEASH", "url": "https://omabrowser.org/oma/group/WHTEASH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR48043", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48043", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR48043:SF140", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48043:SF140", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00201", "url": "http://pfam.xfam.org/family/PF00201", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P0DTE4", "url": "http://purl.obolibrary.org/obo/PR_P0DTE4", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001239203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239203", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "21032", "url": "https://www.rhea-db.org/rhea/21032", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "52456", "url": "https://www.rhea-db.org/rhea/52456", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "52460", "url": "https://www.rhea-db.org/rhea/52460", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "52464", "url": "https://www.rhea-db.org/rhea/52464", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "52568", "url": "https://www.rhea-db.org/rhea/52568", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "52868", "url": "https://www.rhea-db.org/rhea/52868", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "52872", "url": "https://www.rhea-db.org/rhea/52872", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "52880", "url": "https://www.rhea-db.org/rhea/52880", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "52920", "url": "https://www.rhea-db.org/rhea/52920", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "52948", "url": "https://www.rhea-db.org/rhea/52948", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "52952", "url": "https://www.rhea-db.org/rhea/52952", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "52956", "url": "https://www.rhea-db.org/rhea/52956", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "52960", "url": "https://www.rhea-db.org/rhea/52960", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "53028", "url": "https://www.rhea-db.org/rhea/53028", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "P0DTE4", "url": "https://www.uniprot.org/uniprot/P0DTE4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0DTE4-1", "url": "https://www.uniprot.org/uniprot/P0DTE4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0DTE4-4", "url": "https://www.uniprot.org/uniprot/P0DTE4-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0DTE4-5", "url": "https://www.uniprot.org/uniprot/P0DTE4-5", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLNNLLLFSLQISLIGTTLGGNVLIWPMEGSHWLNVKIIIDELIKKEHNVTVLVASGALFITPTSNPSLTFEIYKVPFGKERIEGVIKDFVLTWLENRPSPSTIWRFYQEMAKVIKDFHMVSQEICDGVLKNQQLMAKLKKSKFEVLVSDPVFPCGDIVALKLGIPFMYSLRFSPASTVEKHCGKVPYPPSYVPAVLSELTDQMSFTDRIRNFISYHLQDYMFETLWKSWDSYYSKALGGLLLCCPGWSAVADLGSLQPLLPGFKRFSRLSLHCSWDYRLPAGRPTTLCETMGKAEIWLIRTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKVLWRYKGKKPATLGNNTQLFDWIPQNDLLGHPKTKAFITHGGTNGIYEAIYHGVPMVGVPMFADQPDNIAHMKAKGAAVEVNLNTMTSVDLLSALRTVINEPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHSLDVIGFLLVCVTTAIFLVIQCCLFSCQKFGKIGKKKKRE", "length": 527, "header": "sp|P0DTE4-5|UD2A1_HUMAN Isoform 5 of UDP-glucuronosyltransferase 2A1 OS=Homo sapiens OX=9606 GN=UGT2A1 PE=1 SV=2 CANONICAL=P0DTE4-5" }, "isoforms": [ { "isoform_ac": "P0DTE4-1", "url": "", "sequence": { "sequence": "MLNNLLLFSLQISLIGTTLGGNVLIWPMEGSHWLNVKIIIDELIKKEHNVTVLVASGALFITPTSNPSLTFEIYKVPFGKERIEGVIKDFVLTWLENRPSPSTIWRFYQEMAKVIKDFHMVSQEICDGVLKNQQLMAKLKKSKFEVLVSDPVFPCGDIVALKLGIPFMYSLRFSPASTVEKHCGKVPYPPSYVPAVLSELTDQMSFTDRIRNFISYHLQDYMFETLWKSWDSYYSKALGRPTTLCETMGKAEIWLIRTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKEMEEFIQSSGKNGVVVFSLGSMVKNLTEEKANLIASALAQIPQKVLWRYKGKKPATLGNNTQLFDWIPQNDLLGHPKTKAFITHGGTNGIYEAIYHGVPMVGVPMFADQPDNIAHMKAKGAAVEVNLNTMTSVDLLSALRTVINEPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHSLDVIGFLLVCVTTAIFLVIQCCLFSCQKFGKIGKKKKRE", "length": 527, "header": "sp|P0DTE4-1|UD2A1_HUMAN Isoform 1 of UDP-glucuronosyltransferase 2A1 OS=Homo sapiens OX=9606 GN=UGT2A1 PE=1 SV=2 CANONICAL=P0DTE4-5" }, "locus": { "chromosome": "4", "start_pos": 69647644, "end_pos": 69589375, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000503640.5", "url": "https://www.ensembl.org/id/ENST00000503640.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000424478.1", "url": "https://www.ensembl.org/id/ENSP00000424478.1" } ] } }, { "isoform_ac": "P0DTE4-4", "url": "", "sequence": { "sequence": "MLNNLLLFSLQISLIGTTLGGNVLIWPMEGSHWLNVKIIIDELIKKEHNVTVLVASGALFITPTSNPSLTFEIYKVPFGKERIEGVIKDFVLTWLENRPSPSTIWRFYQEMAKVIKDFHMVSQEICDGVLKNQQLMAKLKKSKFEVLVSDPVFPCGDIVALKLGIPFMYSLRFSPASTVEKHCGKVPYPPSYVPAVLSELTDQMSFTDRIRNFISYHLQDYMFETLWKSWDSYYSKALDGSHWLNIKIILEELIQRNHNVTVLASSATLFINSNPDSPVNFEVIPVSYKKSNIDSLIEHMIMLWIDHRPTPLTIWAFYKELGKLLDTFFQINIQLCDGVLKNPKLMARLQKGGFDVLVADPVTICGDLVALKLGIPFMYTLRFSPASTVERHCGKIPAPVSYVPAALSELTDQMTFGERIKNTISYSLQDYIFQSYWGEWNSYYSKILGRPTTLCETMGKAEIWLIRTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKVLWRYKGKKPATLGNNTQLFDWIPQNDLLGHPKTKAFITHGGTNGIYEAIYHGVPMVGVPMFADQPDNIAHMKAKGAAVEVNLNTMTSVDLLSALRTVINEPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHSLDVIGFLLVCVTTAIFLVIQCCLFSCQKFGKIGKKKKRE", "length": 693, "header": "sp|P0DTE4-4|UD2A1_HUMAN Isoform 4 of UDP-glucuronosyltransferase 2A1 OS=Homo sapiens OX=9606 GN=UGT2A1 PE=1 SV=2 CANONICAL=P0DTE4-5" }, "locus": {} }, { "isoform_ac": "P0DTE4-5", "url": "", "sequence": { "sequence": "MLNNLLLFSLQISLIGTTLGGNVLIWPMEGSHWLNVKIIIDELIKKEHNVTVLVASGALFITPTSNPSLTFEIYKVPFGKERIEGVIKDFVLTWLENRPSPSTIWRFYQEMAKVIKDFHMVSQEICDGVLKNQQLMAKLKKSKFEVLVSDPVFPCGDIVALKLGIPFMYSLRFSPASTVEKHCGKVPYPPSYVPAVLSELTDQMSFTDRIRNFISYHLQDYMFETLWKSWDSYYSKALGGLLLCCPGWSAVADLGSLQPLLPGFKRFSRLSLHCSWDYRLPAGRPTTLCETMGKAEIWLIRTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKVLWRYKGKKPATLGNNTQLFDWIPQNDLLGHPKTKAFITHGGTNGIYEAIYHGVPMVGVPMFADQPDNIAHMKAKGAAVEVNLNTMTSVDLLSALRTVINEPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHSLDVIGFLLVCVTTAIFLVIQCCLFSCQKFGKIGKKKKRE", "length": 527, "header": "sp|P0DTE4-5|UD2A1_HUMAN Isoform 5 of UDP-glucuronosyltransferase 2A1 OS=Homo sapiens OX=9606 GN=UGT2A1 PE=1 SV=2 CANONICAL=P0DTE4-5" }, "locus": { "chromosome": "4", "start_pos": 69647644, "end_pos": 69589375, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000286604.9", "url": "https://www.ensembl.org/id/ENST00000286604.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000286604.4", "url": "https://www.ensembl.org/id/ENSP00000286604.4" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 347, "start_aa": "Asn", "end_pos": 347, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn347", "evidence": [ { "id": "P0DTE4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DTE4#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "P0DTE4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DTE4#ptm_processing" } ] } ], "phosphorylation": [ { "start_pos": 174, "end_pos": 174, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P0DTE4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P0DTE4" }, { "database": "PubMed", "id": "35494241", "url": "" } ], "site_lbl": "Ser174" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Drug resistance and ATP-dependent conjugate transport mediated by the apical multidrug resistance protein, MRP2, permanently expressed in human and canine cells.", "journal": "Molecular pharmacology", "date": "1999", "authors": "Cui Y, Konig J, Buchholz JK, Spring H, Leier I, Keppler D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "10220572", "url": "https://glygen.org/publication/PubMed/10220572" } ] }, { "title": "Cloning and characterization of a novel human olfactory UDP-glucuronosyltransferase.", "journal": "The Biochemical journal", "date": "1999", "authors": "Jedlitschky G, Cassidy AJ, Sales M, Pratt N, Burchell B", "evidence": [ { "database": "UniProtKB", "id": "P0DTE4", "url": "https://www.uniprot.org/uniprot/P0DTE4" } ], "reference": [ { "type": "PubMed", "id": "10359671", "url": "https://glygen.org/publication/PubMed/10359671" } ] }, { "title": "Characterization of the CoA ligases of human liver mitochondria catalyzing the activation of short- and medium-chain fatty acids and xenobiotic carboxylic acids.", "journal": "Biochimica et biophysica acta", "date": "1999", "authors": "Vessey DA, Kelley M, Warren RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "10434065", "url": "https://glygen.org/publication/PubMed/10434065" } ] }, { "title": "Isolation of a family of organic anion transporters from human liver and kidney.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Sun W, Wu RR, van Poelje PD, Erion MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "11327718", "url": "https://glygen.org/publication/PubMed/11327718" } ] }, { "title": "Characterization of drug transport by the human multidrug resistance protein 3 (ABCC3).", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Zelcer N, Saeki T, Reid G, Beijnen JH, Borst P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "11581266", "url": "https://glygen.org/publication/PubMed/11581266" } ] }, { "title": "Characterization of nicotine and cotinine N-glucuronidations in human liver microsomes.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2002", "authors": "Nakajima M, Tanaka E, Kwon JT, Yokoi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "12433823", "url": "https://glygen.org/publication/PubMed/12433823" } ] }, { "title": "Isolation, sequencing, and expression of a cDNA for the HXM-A form of xenobiotic/medium-chain fatty acid:CoA ligase from human liver mitochondria.", "journal": "Journal of biochemical and molecular toxicology", "date": "2003", "authors": "Vessey DA, Lau E, Kelley M, Warren RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "12616642", "url": "https://glygen.org/publication/PubMed/12616642" } ] }, { "title": "A novel complex locus UGT1 encodes human bilirubin, phenol, and other UDP-glucuronosyltransferase isozymes with identical carboxyl termini.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Ritter JK, Chen F, Sheen YY, Tran HM, Kimura S, Yeatman MT, Owens IS", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "1339448", "url": "https://glygen.org/publication/PubMed/1339448" } ] }, { "title": "Interaction of serum and sodium salicylate: changes during acute infection and its influence on pharmacological activity.", "journal": "Bulletin of the Johns Hopkins Hospital", "date": "1960", "authors": "REYNOLDS RC, CLUFF LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "13741103", "url": "https://glygen.org/publication/PubMed/13741103" } ] }, { "title": "N-glucuronidation of nicotine and cotinine by human liver microsomes and heterologously expressed UDP-glucuronosyltransferases.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2003", "authors": "Kuehl GE, Murphy SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "14570768", "url": "https://glygen.org/publication/PubMed/14570768" } ] }, { "title": "Quaternary ammonium-linked glucuronidation of tamoxifen by human liver microsomes and UDP-glucuronosyltransferase 1A4.", "journal": "Biochemical pharmacology", "date": "2004", "authors": "Kaku T, Ogura K, Nishiyama T, Ohnuma T, Muro K, Hiratsuka A", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "15135306", "url": "https://glygen.org/publication/PubMed/15135306" } ] }, { "title": "Glucuronidation of the aspirin metabolite salicylic acid by expressed UDP-glucuronosyltransferases and human liver microsomes.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2006", "authors": "Kuehl GE, Bigler J, Potter JD, Lampe JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "16258079", "url": "https://glygen.org/publication/PubMed/16258079" } ] }, { "title": "Substrate specificity of carboxylesterase isozymes and their contribution to hydrolase activity in human liver and small intestine.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2006", "authors": "Imai T, Taketani M, Shii M, Hosokawa M, Chiba K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "16837570", "url": "https://glygen.org/publication/PubMed/16837570" } ] }, { "title": "Human carboxylesterase isozymes: catalytic properties and rational drug design.", "journal": "Drug metabolism and pharmacokinetics", "date": "2006", "authors": "Imai T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "16858120", "url": "https://glygen.org/publication/PubMed/16858120" } ] }, { "title": "Antiplatelet agents aspirin and clopidogrel are hydrolyzed by distinct carboxylesterases, and clopidogrel is transesterificated in the presence of ethyl alcohol.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2006", "authors": "Tang M, Mukundan M, Yang J, Charpentier N, LeCluyse EL, Black C, Yang D, Shi D, Yan B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "16943252", "url": "https://glygen.org/publication/PubMed/16943252" } ] }, { "title": "Molecular mechanism of phase I and phase II drug-metabolizing enzymes: implications for detoxification.", "journal": "International review of cytology", "date": "2007", "authors": "Iyanagi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "17482904", "url": "https://glygen.org/publication/PubMed/17482904" } ] }, { "title": "Model representation of salicylate pharmacokinetics using unbound plasma salicylate concentrations and metabolite urinary excretion rates following a single oral dose.", "journal": "Journal of pharmacokinetics and biopharmaceutics", "date": "1991", "authors": "Shen J, Wanwimolruk S, Purves RD, McQueen EG, Roberts MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "1783992", "url": "https://glygen.org/publication/PubMed/1783992" } ] }, { "title": "Commentary: bioavailability of flavonoids and polyphenols: call to arms.", "journal": "Molecular pharmaceutics", "date": "2007", "authors": "Hu M", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "18052085", "url": "https://glygen.org/publication/PubMed/18052085" } ] }, { "title": "The configuration of the 17-hydroxy group variably influences the glucuronidation of beta-estradiol and epiestradiol by human UDP-glucuronosyltransferases.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2008", "authors": "Itaaho K, Mackenzie PI, Ikushiro S, Miners JO, Finel M", "evidence": [ { "database": "UniProtKB", "id": "P0DTE4", "url": "https://www.uniprot.org/uniprot/P0DTE4" } ], "reference": [ { "type": "PubMed", "id": "18719240", "url": "https://glygen.org/publication/PubMed/18719240" } ] }, { "title": "UDP-glucuronosyltransferases (UGTs) 2B7 and UGT2B17 display converse specificity in testosterone and epitestosterone glucuronidation, whereas UGT2A1 conjugates both androgens similarly.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2009-02", "authors": "Sten Taina, Bichlmaier Ingo, Kuuranne Tiia, Leinonen Antti, Yli-Kauhaluoma Jari, Finel Moshe", "evidence": [ { "database": "UniProtKB", "id": "P0DTE4", "url": "https://www.uniprot.org/uniprot/P0DTE4" } ], "reference": [ { "type": "PubMed", "id": "19022937", "url": "https://glygen.org/publication/PubMed/19022937" } ] }, { "title": "Structure and concentration changes affect characterization of UGT isoform-specific metabolism of isoflavones.", "journal": "Molecular pharmaceutics", "date": "2009", "authors": "Tang L, Singh R, Liu Z, Hu M", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "19545173", "url": "https://glygen.org/publication/PubMed/19545173" } ] }, { "title": "Reaction of human albumin with aspirin in vitro: mass spectrometric identification of acetylated lysines 199, 402, 519, and 545.", "journal": "Biochemical pharmacology", "date": "2010", "authors": "Liyasova MS, Schopfer LM, Lockridge O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "19836360", "url": "https://glygen.org/publication/PubMed/19836360" } ] }, { "title": "Human UDP-glucuronosyltransferase UGT2A2: cDNA construction, expression, and functional characterization in comparison with UGT2A1 and UGT2A3.", "journal": "Pharmacogenetics and genomics", "date": "2009", "authors": "Sneitz N, Court MH, Zhang X, Laajanen K, Yee KK, Dalton P, Ding X, Finel M", "evidence": [ { "database": "UniProtKB", "id": "P0DTE4", "url": "https://www.uniprot.org/uniprot/P0DTE4" }, { "database": "RefSeq", "id": "NP_001239203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239203" } ], "reference": [ { "type": "PubMed", "id": "19858781", "url": "https://glygen.org/publication/PubMed/19858781" } ] }, { "title": "Human alpha/beta hydrolase domain containing 10 (ABHD10) is responsible enzyme for deglucuronidation of mycophenolic acid acyl-glucuronide in liver.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Iwamura A, Fukami T, Higuchi R, Nakajima M, Yokoi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "22294686", "url": "https://glygen.org/publication/PubMed/22294686" } ] }, { "title": "Biowaiver monograph for immediate-release solid oral dosage forms: acetylsalicylic acid.", "journal": "Journal of pharmaceutical sciences", "date": "2012", "authors": "Dressman JB, Nair A, Abrahamsson B, Barends DM, Groot DW, Kopp S, Langguth P, Polli JE, Shah VP, Zimmer M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "22674043", "url": "https://glygen.org/publication/PubMed/22674043" } ] }, { "title": "Identification and functional characterization of a novel UDP-glucuronosyltransferase 2A1 splice variant: potential importance in tobacco-related cancer susceptibility.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2012", "authors": "Bushey RT, Lazarus P", "evidence": [ { "database": "RefSeq", "id": "NP_001239203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239203" } ], "reference": [ { "type": "PubMed", "id": "22984225", "url": "https://glygen.org/publication/PubMed/22984225" } ] }, { "title": "Regiospecificity and stereospecificity of human UDP-glucuronosyltransferases in the glucuronidation of estriol, 16-epiestriol, 17-epiestriol, and 13-epiestradiol.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2013", "authors": "Sneitz N, Vahermo M, Mosorin J, Laakkonen L, Poirier D, Finel M", "evidence": [ { "database": "UniProtKB", "id": "P0DTE4", "url": "https://www.uniprot.org/uniprot/P0DTE4" } ], "reference": [ { "type": "PubMed", "id": "23288867", "url": "https://glygen.org/publication/PubMed/23288867" } ] }, { "title": "The Human UDP-glucuronosyltransferase UGT2A1 and UGT2A2 enzymes are highly active in bile acid glucuronidation.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2013", "authors": "Perreault M, Gauthier-Landry L, Trottier J, Verreault M, Caron P, Finel M, Barbier O", "evidence": [ { "database": "UniProtKB", "id": "P0DTE4", "url": "https://www.uniprot.org/uniprot/P0DTE4" }, { "database": "RefSeq", "id": "NP_001239203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239203" } ], "reference": [ { "type": "PubMed", "id": "23756265", "url": "https://glygen.org/publication/PubMed/23756265" } ] }, { "title": "Aromatic hydroxylation of salicylic acid and aspirin by human cytochromes P450.", "journal": "European journal of pharmaceutical sciences : official journal of the European Federation for Pharmaceutical Sciences", "date": "2015", "authors": "Bojic M, Sedgeman CA, Nagy LD, Guengerich FP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "25840124", "url": "https://glygen.org/publication/PubMed/25840124" } ] }, { "title": "Glucuronidation of estrone and 16alpha-hydroxyestrone by human UGT enzymes: The key roles of UGT1A10 and UGT2B7.", "journal": "J. Steroid Biochem. Mol. Biol.", "date": "2015", "authors": "Kallionpaa RA, Jarvinen E, Finel M", "evidence": [ { "database": "UniProtKB", "id": "P0DTE4", "url": "https://www.uniprot.org/uniprot/P0DTE4" } ], "reference": [ { "type": "PubMed", "id": "26220143", "url": "https://glygen.org/publication/PubMed/26220143" } ] }, { "title": "Natural Polyphenols for Prevention and Treatment of Cancer.", "journal": "Nutrients", "date": "2016", "authors": "Zhou Y, Zheng J, Li Y, Xu DP, Li S, Chen YM, Li HB", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "27556486", "url": "https://glygen.org/publication/PubMed/27556486" } ] }, { "title": "Carboxylesterases in lipid metabolism: from mouse to human.", "journal": "Protein & cell", "date": "2018", "authors": "Lian J, Nelson R, Lehner R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "28677105", "url": "https://glygen.org/publication/PubMed/28677105" } ] }, { "title": "Study of the Association of PEAR1, P2Y12, and UGT2A1 Polymorphisms with Platelet Reactivity in Response to Dual Antiplatelet Therapy in Chinese Patients.", "journal": "Cardiology", "date": "2018", "authors": "Zhang S, Zhu J, Li H, Wang L, Niu J, Zhu B, He L, Shen L, Qin S, Fang S", "evidence": [ { "database": "RefSeq", "id": "NP_001239203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239203" } ], "reference": [ { "type": "PubMed", "id": "29635252", "url": "https://glygen.org/publication/PubMed/29635252" } ] }, { "title": "Microsomal UDP-glucuronyltransferase-catalyzed bilirubin diglucuronide formation in human liver.", "journal": "Journal of hepatology", "date": "1986", "authors": "Peters WH, Jansen PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "3082969", "url": "https://glygen.org/publication/PubMed/3082969" } ] }, { "title": "Regulation of UGT2A1 by miR-196a-5p and miR-196b-5p.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2019", "authors": "Sutliff AK, Watson CJW, Chen G, Lazarus P", "evidence": [ { "database": "RefSeq", "id": "NP_001239203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239203" } ], "reference": [ { "type": "PubMed", "id": "30850392", "url": "https://glygen.org/publication/PubMed/30850392" } ] }, { "title": "2,3-Dihydroxybenzoic acid is a product of human aspirin metabolism.", "journal": "Biochemical pharmacology", "date": "1988", "authors": "Grootveld M, Halliwell B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "3342084", "url": "https://glygen.org/publication/PubMed/3342084" } ] }, { "title": "The UGT2A1/UGT2A2 locus is associated with COVID-19-related loss of smell or taste.", "journal": "Nature genetics", "date": "2022", "authors": "Shelton JF, Shastri AJ, Fletez-Brant K, Aslibekyan S, Auton A", "evidence": [ { "database": "RefSeq", "id": "NP_001239203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001239203" } ], "reference": [ { "type": "PubMed", "id": "35039640", "url": "https://glygen.org/publication/PubMed/35039640" } ] }, { "title": "The metabolism of aspirin in man: a population study.", "journal": "Xenobiotica; the fate of foreign compounds in biological systems", "date": "1986", "authors": "Hutt AJ, Caldwell J, Smith RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "3705620", "url": "https://glygen.org/publication/PubMed/3705620" } ] }, { "title": "Bilirubin conjugates in bile of man and rat in the normal state and in liver disease.", "journal": "The Journal of clinical investigation", "date": "1972", "authors": "Fevery J, Van Damme B, Michiels R, De Groote J, Heirwegh KP", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "4639028", "url": "https://glygen.org/publication/PubMed/4639028" } ] }, { "title": "Absorption kinetics of aspirin in man following oral administration of an aqueous solution.", "journal": "Journal of pharmaceutical sciences", "date": "1972", "authors": "Rowland M, Riegelman S, Harris PA, Sholkoff SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "5013373", "url": "https://glygen.org/publication/PubMed/5013373" } ] }, { "title": "Structural changes in human serum albumin induced by ingestion of acetylsalicylic acid.", "journal": "The Journal of clinical investigation", "date": "1969", "authors": "Hawkins D, Pinckard RN, Crawford IP, Farr RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "5773090", "url": "https://glygen.org/publication/PubMed/5773090" } ] }, { "title": "Pharmacokinetics of salicylate elimination in man.", "journal": "Journal of pharmaceutical sciences", "date": "1965", "authors": "Levy G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "5862532", "url": "https://glygen.org/publication/PubMed/5862532" } ] }, { "title": "Difference in hepatic uptake kinetics of aspirin and salicylamide in rats.", "journal": "Biochemical pharmacology", "date": "1984", "authors": "Iwamoto K, Furune Y, Watanabe J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "6487359", "url": "https://glygen.org/publication/PubMed/6487359" } ] }, { "title": "The hepatic microsomal formation of bilirubin diglucuronide.", "journal": "The Journal of biological chemistry", "date": "1983", "authors": "Gordon ER, Sommerer U, Goresky CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "6654901", "url": "https://glygen.org/publication/PubMed/6654901" } ] }, { "title": "Plasma aspirin esterases in normal individuals, patients with alcoholic liver disease and rheumatoid arthritis: characterization and the importance of the enzymic components.", "journal": "European journal of clinical investigation", "date": "1980", "authors": "Rainsford KD, Ford NL, Brooks PM, Watson HM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "6777177", "url": "https://glygen.org/publication/PubMed/6777177" } ] }, { "title": "Bilirubin mono- and diglucuronide formation by human liver in vitro: assay by high-pressure liquid chromatography.", "journal": "Hepatology (Baltimore, Md.)", "date": "1981", "authors": "Chowdhury JR, Chowdhury NR, Wu G, Shouval R, Arias IM", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "6796486", "url": "https://glygen.org/publication/PubMed/6796486" } ] }, { "title": "Identification and partial purification of the major aspirin hydrolyzing enzyme in human blood.", "journal": "Arthritis and rheumatism", "date": "1983", "authors": "Costello PB, Green FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "6838677", "url": "https://glygen.org/publication/PubMed/6838677" } ] }, { "title": "Comparative study of human intestinal and hepatic esterases as related to enzymatic properties and hydrolizing activity for ester-type drugs.", "journal": "Japanese journal of pharmacology", "date": "1980", "authors": "Inoue M, Morikawa M, Tsuboi M, Ito Y, Sugiura M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "7206363", "url": "https://glygen.org/publication/PubMed/7206363" } ] }, { "title": "Purification to homogeneity of mitochondrial acyl coa:glycine n-acyltransferase from human liver.", "journal": "Biochemical and biophysical research communications", "date": "1994", "authors": "Mawal YR, Qureshi IA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "7802672", "url": "https://glygen.org/publication/PubMed/7802672" } ] }, { "title": "Bilirubin UDP-glucuronosyltransferase 1 is the only relevant bilirubin glucuronidating isoform in man.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Bosma PJ, Seppen J, Goldhoorn B, Bakker C, Oude Elferink RP, Chowdhury JR, Chowdhury NR, Jansen PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "8027054", "url": "https://glygen.org/publication/PubMed/8027054" } ] }, { "title": "Glucuronide conjugates of 4-aminobiphenyl and its N-hydroxy metabolites. pH stability and synthesis by human and dog liver.", "journal": "Biochemical pharmacology", "date": "1996", "authors": "Babu SR, Lakshmi VM, Huang GP, Zenser TV, Davis BB", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "8687483", "url": "https://glygen.org/publication/PubMed/8687483" } ] }, { "title": "Molecular cloning and characterization of a novel putative carboxylesterase, present in human intestine and liver.", "journal": "Biochemical and biophysical research communications", "date": "1997", "authors": "Schwer H, Langmann T, Daig R, Becker A, Aslanidis C, Schmitz G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "9144407", "url": "https://glygen.org/publication/PubMed/9144407" } ] }, { "title": "Identification of separate acyl- CoA:glycine and acyl-CoA:L-glutamine N-acyltransferase activities in mitochondrial fractions from liver of rhesus monkey and man.", "journal": "The Journal of biological chemistry", "date": "1976", "authors": "Webster LT, Siddiqui UA, Lucas SV, Strong JM, Mieyal JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "931988", "url": "https://glygen.org/publication/PubMed/931988" } ] }, { "title": "Identification of multispecific organic anion transporter 2 expressed predominantly in the liver.", "journal": "FEBS letters", "date": "1998", "authors": "Sekine T, Cha SH, Tsuda M, Apiwattanakul N, Nakajima N, Kanai Y, Endou H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "9650585", "url": "https://glygen.org/publication/PubMed/9650585" } ] }, { "title": "Protein binding of salicylate in uremic and normal plasma.", "journal": "Clinical pharmacology and therapeutics", "date": "1976", "authors": "Borga O, Cederlof IO, Ringberger VA, Norlin A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "975718", "url": "https://glygen.org/publication/PubMed/975718" } ] } ], "pathway": [ { "id": "hsa:10941", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10941", "resource": "KEGG Pathway" }, { "id": "R-HSA-156588", "name": "Glucuronidation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588", "resource": "Reactome", "description": "Glucuronidation" }, { "id": "R-HSA-9749641", "name": "Aspirin ADME", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641", "resource": "Reactome", "description": "Aspirin ADME" } ], "orthologs": [ { "uniprot_canonical_ac": "P36510-1", "protein_name": "UDP-glucuronosyltransferase 2A1", "gene_name": "Ugt2a1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MLKNILLWSLQLSLLGMSLGGNVLIWPMEGSHWLNVKIIIDELLRKEHNVTVLVASGALFITPSVSPSLTFEIYPVPFGKEKIESVIKDFVLTWLENRPSPSTIWTFYKEMAKVIEEFHLVSRGICDGVLKNEKLMTKLQRGKFEVLLSDPVFPCGDIVALKLGIPFIYSLRFSPASTVEKHCGKVPFPPSYVPAILSELTDQMSFADRVRNFISYRMQDYMFETLWKQWDSYYSKALGRPTTLCETMGKAEIWLMRTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKEMEEFVQTSGEHGVVVFSLGSMVKNLTEEKANLIASALAQIPQKVLWRYKGKIPATLGSNTRLFDWIPQNDLLGHPKTRAFITHGGTNGIYEAIYHGIPMVGVPMFADQPDNIAHMKAKGAAVEVNMNTMTSADLLSAVRAVINEPFYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLSWFQYHSLDVIGFLLACMASAILLVIKCCLFVFQKIGKTXKKNKRD", "length": 527 }, "evidence": [ { "id": "45922686", "url": "http://www.informatics.jax.org/homology/45922686", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q80X89-1", "protein_name": "UDP-glucuronosyltransferase 2A1", "gene_name": "Ugt2a1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MLKNILLCSLQISLLGMSLGGNVLIWPMEGSHWLNVKIIIDELLRKEHNVTVLVASGALFITPSSISPSLTFEIYPVPFGKEKIESVIKDFVLTWLENRPSPSTIWTFYKEMAKVIEEFHLVSRGICDGVLKNEKLMSKLQKEKFEVLLSDPVFPCGDIVALKLGIPFIYSLRFSPASTVEKHCGKVPFPPSYVPAILSELTDQMSFTDRVRNFISYRMQDYMFETLWKQWDSYYTKALGRPTTLCETMGKAEIWLMRTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKEMEEFVQTSGEHGIVVFSLGSMVKNLTDEKANLIASALAQIPQKVLWRYKGKIPDTLGSNTRLFDWIPQNDLLGHPKTRAFITHGGTNGIYEAIYHGIPMVGVPMFADQPDNIAHMKAKGAAVEVNMNTMTSSDLLNALRTVINEPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLSWFQYHSLDVIGFLLACVASAILLVAKCCLFIFQKVGKTGKKKKRD", "length": 528 }, "evidence": [ { "id": "45922686", "url": "http://www.informatics.jax.org/homology/45922686", "database": "MGI" }, { "id": "P0DTE4", "url": "https://omabrowser.org/oma/group/P0DTE4/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "cellular glucuronidation", "id": "GO:0052695", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052695", "evidence": [ { "database": "UniProtKB", "id": "P0DTE4", "url": "https://www.uniprot.org/uniprot/P0DTE4" } ], "pmid": "" }, { "name": "bile acid metabolic process", "id": "GO:0008206", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008206", "evidence": [ { "database": "UniProtKB", "id": "P0DTE4", "url": "https://www.uniprot.org/uniprot/P0DTE4" } ], "pmid": "" }, { "name": "sensory perception of smell", "id": "GO:0007608", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007608", "evidence": [ { "database": "UniProtKB", "id": "P0DTE4", "url": "https://www.uniprot.org/uniprot/P0DTE4" } ], "pmid": "" }, { "name": "response to stimulus", "id": "GO:0050896", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050896", "evidence": [ { "database": "UniProtKB", "id": "P0DTE4", "url": "https://www.uniprot.org/uniprot/P0DTE4" } ], "pmid": "" }, { "name": "sensory perception of chemical stimulus", "id": "GO:0007606", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007606", "evidence": [ { "database": "UniProtKB", "id": "P0DTE4", "url": "https://www.uniprot.org/uniprot/P0DTE4" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "P0DTE4", "url": "https://www.uniprot.org/uniprot/P0DTE4" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "glucuronosyltransferase activity", "id": "GO:0015020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015020", "evidence": [ { "database": "UniProtKB", "id": "P0DTE4", "url": "https://www.uniprot.org/uniprot/P0DTE4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 347, "end_pos": 349, "annotation": "n_glycosylation_sequon" }, { "start_pos": 49, "end_pos": 51, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "21032", "name": "", "equation": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P08541-1", "P19488-1", "Q64638-1", "Q64550-1", "P08430-1", "P20720-1", "Q62789-1", "Q64633-1", "Q64634-1", "Q64637-1", "P08542-1", "P09875-1", "P36510-1", "P36511-1", "A0A0G2K727-1", "A0A0G2JW02-1", "F1LTB8-1", "F1M3E3-1", "P54855-1", "P16662-1", "Q3SY77-1", "O75310-1", "P19224-1", "Q6NUS8-1", "Q6UWM9-1", "P36537-1", "P06133-1", "Q9BY64-1", "Q9HAW7-1", "Q9HAW9-1", "Q9HAW8-1", "P35503-1", "P35504-1", "O60656-1", "O75795-1", "P22310-1", "P22309-1", "P0DTE5-1", "P0DTE4-5", "Q8JZZ0-1", "P70691-1", "Q3UP75-1", "Q8BWQ1-1", "P17717-1", "Q62452-1", "Q63886-1", "Q8R084-1", "Q8VCN3-1", "Q8BJL9-1", "Q8K154-1", "Q6PDD0-1", "Q80X89-1", "Q3UEP4-1", "Q64435-1", "Q6ZQM8-1", "D3Z748-1", "K9J7B2-1", "B2RT14-1", "Q9VDA5-1", "Q9VGT4-1", "Q9VGT5-1", "Q9VGS7-1", "Q9VJ46-1", "Q8SYL7-1", "Q9VJ45-1", "Q9W2J3-1", "Q9VJ81-1", "Q9VGT2-1", "Q9VGT8-1", "Q9W2J4-1", "Q9V9X9-1", "Q9VJ47-1", "Q9VGT0-1" ], "evidence": [ { "id": "21032", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/21032" } ] }, { "id": "52456", "name": "", "equation": "testosterone + UDP-alpha-D-glucuronate = H(+) + testosterone 17-O-(beta-D-glucuronate) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P08542-1", "P36510-1", "O75795-1", "P0DTE4-5", "Q80X89-1", "P17717-1" ], "evidence": [ { "id": "52456", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/52456" } ] }, { "id": "52460", "name": "", "equation": "17beta-estradiol + UDP-alpha-D-glucuronate = 17beta-estradiol 3-O-(beta-D-glucuronate) + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q64550-1", "Q64634-1", "Q64637-1", "P36510-1", "Q9HAW9-1", "Q9HAW8-1", "P35503-1", "P22309-1", "P0DTE5-1", "P0DTE4-5", "Q63886-1", "Q6PDD0-1", "Q80X89-1" ], "evidence": [ { "id": "52460", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/52460" } ] }, { "id": "52464", "name": "", "equation": "17beta-estradiol + UDP-alpha-D-glucuronate = 17beta-estradiol 17-O-(beta-D-glucuronate) + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P08542-1", "P09875-1", "P36510-1", "Q62789-1", "Q64637-1", "P16662-1", "Q9HAW8-1", "P35503-1", "O75795-1", "P0DTE4-5", "Q80X89-1", "P17717-1" ], "evidence": [ { "id": "52464", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/52464" } ] }, { "id": "52568", "name": "", "equation": "epitestosterone + UDP-alpha-D-glucuronate = epitestosterone 17-O-(beta-D-glucuronate) + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q62789-1", "P36510-1", "P16662-1", "P0DTE4-5", "Q80X89-1" ], "evidence": [ { "id": "52568", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/52568" } ] }, { "id": "52868", "name": "", "equation": "17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha-estradiol 3-O-(beta-D-glucuronate) + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q64550-1", "P08542-1", "P36510-1", "Q64633-1", "Q64634-1", "Q64637-1", "P36511-1", "Q9HAW7-1", "Q9HAW9-1", "Q9HAW8-1", "P35503-1", "O75795-1", "P22309-1", "P54855-1", "P0DTE5-1", "P0DTE4-5", "Q63886-1", "Q6PDD0-1", "Q80X89-1", "P17717-1", "Q6ZQM8-1" ], "evidence": [ { "id": "52868", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/52868" } ] }, { "id": "52872", "name": "", "equation": "17alpha-estradiol + UDP-alpha-D-glucuronate = 17alpha-estradiol 17-O-(beta-D-glucuronate) + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P08542-1", "Q62789-1", "P36510-1", "P06133-1", "P16662-1", "O75795-1", "P0DTE4-5", "Q80X89-1", "P17717-1" ], "evidence": [ { "id": "52872", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/52872" } ] }, { "id": "52880", "name": "", "equation": "16beta,17beta-estriol + UDP-alpha-D-glucuronate = 16beta,17beta-estriol 16-O-(beta-D-glucuronate) + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q64550-1", "Q62789-1", "P36510-1", "P16662-1", "P22309-1", "P0DTE4-5", "Q63886-1", "Q80X89-1" ], "evidence": [ { "id": "52880", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/52880" } ] }, { "id": "52920", "name": "", "equation": "16alpha,17alpha-estriol + UDP-alpha-D-glucuronate = 16alpha,17alpha-estriol 16-O-(beta-D-glucuronate) + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q62789-1", "P36510-1", "P16662-1", "P0DTE4-5", "Q80X89-1" ], "evidence": [ { "id": "52920", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/52920" } ] }, { "id": "52948", "name": "", "equation": "deoxycholate + UDP-alpha-D-glucuronate = deoxycholoyl-24-O-(beta-D-glucuronate) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q64637-1", "P36510-1", "P35503-1", "P0DTE5-1", "P0DTE4-5", "Q6PDD0-1", "Q80X89-1" ], "evidence": [ { "id": "52948", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/52948" } ] }, { "id": "52952", "name": "", "equation": "lithocholate + UDP-alpha-D-glucuronate = lithocholoyl-24-O-(beta-D-glucuronate) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q64637-1", "P36510-1", "P35503-1", "P0DTE5-1", "P0DTE4-5", "Q6PDD0-1", "Q80X89-1" ], "evidence": [ { "id": "52952", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/52952" } ] }, { "id": "52956", "name": "", "equation": "hyodeoxycholate + UDP-alpha-D-glucuronate = hyodeoxycholoyl-24-O-(beta-D-glucuronate) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q64637-1", "P0DTE4-5", "P35503-1" ], "evidence": [ { "id": "52956", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/52956" } ] }, { "id": "52960", "name": "", "equation": "hyocholate + UDP-alpha-D-glucuronate = hyocholoyl-24-O-(beta-D-glucuronate) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q64637-1", "P36510-1", "P35503-1", "P0DTE5-1", "P0DTE4-5", "Q6PDD0-1", "Q80X89-1" ], "evidence": [ { "id": "52960", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/52960" } ] }, { "id": "53028", "name": "", "equation": "lithocholate + UDP-alpha-D-glucuronate = H(+) + lithocholoyl-3-O-(beta-D-glucuronate) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P36510-1", "P0DTE4-5", "Q80X89-1" ], "evidence": [ { "id": "53028", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/53028" } ] }, { "id": "R-HSA-174931", "name": "UGTs transfer GlcA from UDP-GlcA to O-centre substrates", "equation": "", "summary": "Typical O-centred substrates were chosen as examples for these isozymes. Many UDP-glucuronosyltransferases (UGTs) can transfer the glucuronyl moiety (GlcA) from UDP-GlcA to the O-centre functional group of many substrates, including salicylate (ST), to form 4-O-glucuronides (Casarett & Doull 1995, Babu et al. 1996; Kuehl et al, 2006).", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P16662-1", "Q3SY77-1", "Q6UWM9-1", "Q9BY64-1", "P0DTE5-1", "P06133-1", "P22310-1", "P35503-1", "Q9HAW7-1", "Q9HAW9-1", "O60656-1", "O75310-1", "O75795-1", "P19224-1", "P22309-1", "P35504-1", "P36537-1", "P54855-1", "Q6NUS8-1", "P0DTE4-5" ], "evidence": [ { "id": "R-HSA-174931", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174931" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2JW02", "gene_name": "Ugt2a3", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "A0A0G2JW02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JW02" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "A0A0G2JW02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JW02" } ] } ] }, { "uniprot_ac": "A0A0G2K727", "gene_name": "ENSRNOG00000065137", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "A0A0G2K727", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K727" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "A0A0G2K727", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K727" } ] } ] }, { "uniprot_ac": "B2RT14", "gene_name": "Ugt1a5", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "B2RT14", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RT14" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "B2RT14", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RT14" } ] } ] }, { "uniprot_ac": "D3Z748", "gene_name": "Ugt1a8", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "D3Z748", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z748" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "D3Z748", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z748" } ] } ] }, { "uniprot_ac": "F1LTB8", "gene_name": "RGD1559459", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "F1LTB8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LTB8" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "F1LTB8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LTB8" } ] } ] }, { "uniprot_ac": "F1M3E3", "gene_name": "AC114845.1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "F1M3E3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3E3" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "F1M3E3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3E3" } ] } ] }, { "uniprot_ac": "K9J7B2", "gene_name": "Ugt1a6b", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "K9J7B2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/K9J7B2" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "K9J7B2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/K9J7B2" } ] } ] }, { "uniprot_ac": "O60656", "gene_name": "UGT1A9", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "O60656", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60656" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "O60656", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60656" } ] } ] }, { "uniprot_ac": "O75310", "gene_name": "UGT2B11", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "O75310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75310" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "O75310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75310" } ] } ] }, { "uniprot_ac": "O75795", "gene_name": "UGT2B17", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "O75795", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75795" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "O75795", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75795" } ] } ] }, { "uniprot_ac": "P06133", "gene_name": "UGT2B4", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P06133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06133" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P06133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06133" } ] } ] }, { "uniprot_ac": "P08430", "gene_name": "Ugt1a6", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P08430", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08430" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P08430", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08430" } ] } ] }, { "uniprot_ac": "P08541", "gene_name": "Ugt2b", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P08541", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08541" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P08541", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08541" } ] } ] }, { "uniprot_ac": "P08542", "gene_name": "Ugt2b17", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P08542", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08542" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P08542", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08542" } ] } ] }, { "uniprot_ac": "P09875", "gene_name": "Ugt2b1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P09875", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09875" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P09875", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09875" } ] } ] }, { "uniprot_ac": "P0DTE4", "gene_name": "UGT2A1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P0DTE4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DTE4" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P0DTE4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DTE4" } ] } ] }, { "uniprot_ac": "P0DTE5", "gene_name": "UGT2A2", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P0DTE5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DTE5" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P0DTE5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DTE5" } ] } ] }, { "uniprot_ac": "P16662", "gene_name": "UGT2B7", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P16662", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16662" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P16662", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16662" } ] } ] }, { "uniprot_ac": "P17717", "gene_name": "Ugt2b17", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P17717", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17717" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P17717", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17717" } ] } ] }, { "uniprot_ac": "P19224", "gene_name": "UGT1A6", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P19224", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19224" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P19224", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19224" } ] } ] }, { "uniprot_ac": "P19488", "gene_name": "Ugt2b37", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P19488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19488" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P19488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19488" } ] } ] }, { "uniprot_ac": "P20720", "gene_name": "Ugt1a2", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P20720", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20720" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P20720", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20720" } ] } ] }, { "uniprot_ac": "P22309", "gene_name": "UGT1A1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P22309", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22309" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P22309", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22309" } ] } ] }, { "uniprot_ac": "P22310", "gene_name": "UGT1A4", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P22310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22310" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P22310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22310" } ] } ] }, { "uniprot_ac": "P35503", "gene_name": "UGT1A3", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P35503", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35503" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P35503", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35503" } ] } ] }, { "uniprot_ac": "P35504", "gene_name": "UGT1A5", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P35504", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35504" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P35504", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35504" } ] } ] }, { "uniprot_ac": "P36510", "gene_name": "Ugt2a1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P36510", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36510" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P36510", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36510" } ] } ] }, { "uniprot_ac": "P36511", "gene_name": "Ugt2b15", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P36511", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36511" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P36511", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36511" } ] } ] }, { "uniprot_ac": "P36537", "gene_name": "UGT2B10", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P36537", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36537" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P36537", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36537" } ] } ] }, { "uniprot_ac": "P54855", "gene_name": "UGT2B15", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P54855", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54855" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P54855", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54855" } ] } ] }, { "uniprot_ac": "P70691", "gene_name": "Ugt1a2", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P70691", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70691" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P70691", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70691" } ] } ] }, { "uniprot_ac": "Q3SY77", "gene_name": "UGT3A2", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q3SY77", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3SY77" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q3SY77", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3SY77" } ] } ] }, { "uniprot_ac": "Q3UEP4", "gene_name": "Ugt2b36", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q3UEP4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UEP4" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q3UEP4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UEP4" } ] } ] }, { "uniprot_ac": "Q3UP75", "gene_name": "Ugt3a1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q3UP75", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UP75" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q3UP75", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UP75" } ] } ] }, { "uniprot_ac": "Q62452", "gene_name": "Ugt1a9", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q62452", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62452" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q62452", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62452" } ] } ] }, { "uniprot_ac": "Q62789", "gene_name": "Ugt2b7", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q62789", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62789" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q62789", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62789" } ] } ] }, { "uniprot_ac": "Q63886", "gene_name": "Ugt1a1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q63886", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63886" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q63886", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63886" } ] } ] }, { "uniprot_ac": "Q64435", "gene_name": "Ugt1a6", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q64435", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64435" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q64435", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64435" } ] } ] }, { "uniprot_ac": "Q64550", "gene_name": "Ugt1a1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q64550", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64550" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q64550", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64550" } ] } ] }, { "uniprot_ac": "Q64633", "gene_name": "Ugt1a7", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q64633", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64633" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q64633", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64633" } ] } ] }, { "uniprot_ac": "Q64634", "gene_name": "Ugt1a8", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q64634", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64634" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q64634", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64634" } ] } ] }, { "uniprot_ac": "Q64637", "gene_name": "Ugt1a3", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q64637", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64637" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q64637", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64637" } ] } ] }, { "uniprot_ac": "Q64638", "gene_name": "Ugt1a5", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q64638", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64638" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q64638", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64638" } ] } ] }, { "uniprot_ac": "Q6NUS8", "gene_name": "UGT3A1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q6NUS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NUS8" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q6NUS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NUS8" } ] } ] }, { "uniprot_ac": "Q6PDD0", "gene_name": "Ugt2a2", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q6PDD0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PDD0" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q6PDD0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PDD0" } ] } ] }, { "uniprot_ac": "Q6UWM9", "gene_name": "UGT2A3", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q6UWM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6UWM9" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q6UWM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6UWM9" } ] } ] }, { "uniprot_ac": "Q6ZQM8", "gene_name": "Ugt1a7", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q6ZQM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZQM8" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q6ZQM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZQM8" } ] } ] }, { "uniprot_ac": "Q80X89", "gene_name": "Ugt2a1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q80X89", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80X89" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q80X89", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80X89" } ] } ] }, { "uniprot_ac": "Q8BJL9", "gene_name": "Ugt2b35", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q8BJL9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BJL9" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q8BJL9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BJL9" } ] } ] }, { "uniprot_ac": "Q8BWQ1", "gene_name": "Ugt2a3", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q8BWQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BWQ1" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q8BWQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BWQ1" } ] } ] }, { "uniprot_ac": "Q8JZZ0", "gene_name": "Ugt3a2", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q8JZZ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8JZZ0" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q8JZZ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8JZZ0" } ] } ] }, { "uniprot_ac": "Q8K154", "gene_name": "Ugt2b34", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q8K154", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K154" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q8K154", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K154" } ] } ] }, { "uniprot_ac": "Q8R084", "gene_name": "Ugt2b1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q8R084", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R084" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q8R084", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R084" } ] } ] }, { "uniprot_ac": "Q8SYL7", "gene_name": "Ugt50B3", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q8SYL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SYL7" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q8SYL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SYL7" } ] } ] }, { "uniprot_ac": "Q8VCN3", "gene_name": "Ugt2b37", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q8VCN3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCN3" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q8VCN3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCN3" } ] } ] }, { "uniprot_ac": "Q9BY64", "gene_name": "UGT2B28", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9BY64", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BY64" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9BY64", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BY64" } ] } ] }, { "uniprot_ac": "Q9HAW7", "gene_name": "UGT1A7", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9HAW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HAW7" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9HAW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HAW7" } ] } ] }, { "uniprot_ac": "Q9HAW8", "gene_name": "UGT1A10", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9HAW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HAW8" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9HAW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HAW8" } ] } ] }, { "uniprot_ac": "Q9HAW9", "gene_name": "UGT1A8", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9HAW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HAW9" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9HAW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HAW9" } ] } ] }, { "uniprot_ac": "Q9V9X9", "gene_name": "Ugt35D1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9V9X9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V9X9" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9V9X9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V9X9" } ] } ] }, { "uniprot_ac": "Q9VDA5", "gene_name": "Ugt49B2", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VDA5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VDA5" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VDA5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VDA5" } ] } ] }, { "uniprot_ac": "Q9VGS7", "gene_name": "Ugt303A1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VGS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGS7" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VGS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGS7" } ] } ] }, { "uniprot_ac": "Q9VGT0", "gene_name": "Ugt35B1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VGT0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT0" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VGT0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT0" } ] } ] }, { "uniprot_ac": "Q9VGT2", "gene_name": "Ugt35E1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VGT2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT2" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VGT2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT2" } ] } ] }, { "uniprot_ac": "Q9VGT4", "gene_name": "Ugt302E1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VGT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT4" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VGT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT4" } ] } ] }, { "uniprot_ac": "Q9VGT5", "gene_name": "Ugt302K1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VGT5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT5" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VGT5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT5" } ] } ] }, { "uniprot_ac": "Q9VGT8", "gene_name": "Ugt35C1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VGT8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT8" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VGT8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT8" } ] } ] }, { "uniprot_ac": "Q9VJ45", "gene_name": "Ugt36E1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VJ45", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ45" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VJ45", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ45" } ] } ] }, { "uniprot_ac": "Q9VJ46", "gene_name": "Ugt36D1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VJ46", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ46" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VJ46", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ46" } ] } ] }, { "uniprot_ac": "Q9VJ47", "gene_name": "Ugt36F1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VJ47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ47" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VJ47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ47" } ] } ] }, { "uniprot_ac": "Q9VJ81", "gene_name": "Ugt301D1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VJ81", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ81" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VJ81", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ81" } ] } ] }, { "uniprot_ac": "Q9W2J3", "gene_name": "Ugt49C1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9W2J3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W2J3" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9W2J3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W2J3" } ] } ] }, { "uniprot_ac": "Q9W2J4", "gene_name": "Ugt49B1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9W2J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W2J4" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9W2J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W2J4" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 49, 347 ], "o_linked_sites": [], "snv_sites": [ 67, 99, 347, 349, 378, 402, 434 ], "glycation_sites": [], "phosphorylation_sites": [ 174 ], "sequon_annotation_sites": [ { "start_pos": 347, "end_pos": 349 }, { "start_pos": 49, "end_pos": 51 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 55 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }