{ "uniprot_canonical_ac": "P0DSO3-1", "uniprot_ac": "P0DSO3", "uniprot_id": "GAGE4_HUMAN", "mass": { "chemical_mass": 12956.0, "monoisotopic_mass": 12956.0 }, "refseq": { "ac": "NP_001465", "name": "G antigen 4", "summary": "This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The antigenic peptide YYWPRPRRY, which is also encoded by several other family members, is recognized by autologous cytolytic T lymphocytes. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001465" }, "gene_names": [ { "name": "GAGE4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P0DSO3", "id": "P0DSO3" }, { "name": "CT4.4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001465", "id": "NP_001465" }, { "name": "GAGE4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001465", "id": "NP_001465" } ], "protein_names": [ { "name": "G antigen 4", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P0DSO3" }, { "name": "CT4.4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DSO3" }, { "name": "Cancer/testis antigen 4.4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DSO3" }, { "name": "G antigen 4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001465", "id": "NP_001465" }, { "name": "cancer/testis antigen family 4, member 4; GAGE-4; cancer/testis antigen 4.4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001465", "id": "NP_001465" } ], "function": [ { "annotation": "Antigen, recognized on melanoma by autologous cytolytic T-lymphocytes.", "evidence": [ { "database": "UniProtKB", "id": "P0DSO3", "url": "https://www.uniprot.org/uniprot/P0DSO3#function" }, { "database": "PubMed", "id": "7544395", "url": "https://glygen.org/publication/PubMed/7544395" } ] }, { "annotation": "This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The antigenic peptide YYWPRPRRY, which is also encoded by several other family members, is recognized by autologous cytolytic T lymphocytes. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001465", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001465" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DSO3", "url": "https://www.uniprot.org/uniprot/P0DSO3" } ], "common_name": "Human" } ], "gene": [ { "name": "GAGE4", "url": "https://www.uniprot.org/uniprot/P0DSO3", "locus": {} } ], "crossref": [ { "id": "GAGE4", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=GAGE4", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "2576", "url": "https://www.ncbi.nlm.nih.gov/gene/2576", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "4101", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4101", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR008625", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008625", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR031320", "url": "https://www.ebi.ac.uk/interpro/entry/IPR031320", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:2576", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2576", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NX_P0DSO3", "url": "https://www.nextprot.org/entry/NX_P0DSO3", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "4660048at2759", "url": "http://www.orthodb.org/?query=4660048at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR14047", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14047", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR14047:SF30", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14047:SF30", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF05831", "url": "http://pfam.xfam.org/family/PF05831", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P0DSO3", "url": "http://purl.obolibrary.org/obo/PR_P0DSO3", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001465", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001465", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P0DSO3", "url": "https://www.uniprot.org/uniprot/P0DSO3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0DSO3-1", "url": "https://www.uniprot.org/uniprot/P0DSO3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC", "length": 117, "header": "sp|P0DSO3-1|GAGE4_HUMAN Isoform 1 of G antigen 4 OS=Homo sapiens OX=9606 GN=GAGE4 PE=5 SV=1 CANONICAL=P0DSO3-1" }, "isoforms": [ { "isoform_ac": "P0DSO3-1", "url": "", "sequence": { "sequence": "MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC", "length": 117, "header": "sp|P0DSO3-1|GAGE4_HUMAN Isoform 1 of G antigen 4 OS=Homo sapiens OX=9606 GN=GAGE4 PE=5 SV=1 CANONICAL=P0DSO3-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 40, "end_pos": 40, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P0DSO3", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P0DSO3" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Thr40" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Characterization of the GAGE genes that are expressed in various human cancers and in normal testis.", "journal": "Cancer Res.", "date": "1999", "authors": "De Backer O, Arden KC, Boretti M, Vantomme V, De Smet C, Czekay S, Viars CS, De Plaen E, Brasseur F, Chomez P, Van den Eynde B, Boon T, van der Bruggen P", "evidence": [ { "database": "UniProtKB", "id": "P0DSO3", "url": "https://www.uniprot.org/uniprot/P0DSO3" } ], "reference": [ { "type": "PubMed", "id": "10397259", "url": "https://glygen.org/publication/PubMed/10397259" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "P0DSO3", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P0DSO3" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "A new family of genes coding for an antigen recognized by autologous cytolytic T lymphocytes on a human melanoma.", "journal": "The Journal of experimental medicine", "date": "1995-09-01", "authors": "Van den Eynde B, Peeters O, De Backer O, Gaugler B, Lucas S, Boon T", "evidence": [ { "database": "UniProtKB", "id": "P0DSO3", "url": "https://www.uniprot.org/uniprot/P0DSO3" } ], "reference": [ { "type": "PubMed", "id": "7544395", "url": "https://glygen.org/publication/PubMed/7544395" } ] } ], "pathway": [ { "id": "hsa:2576", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2576", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 40 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }