{ "uniprot_canonical_ac": "P0DPK5-1", "uniprot_ac": "P0DPK5", "uniprot_id": "H3Y2_HUMAN", "mass": { "chemical_mass": 16466.0, "monoisotopic_mass": 16466.0 }, "refseq": {}, "gene_names": [ { "name": "H3Y2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P0DPK5", "id": "P0DPK5" } ], "protein_names": [ { "name": "Histone H3.X", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P0DPK5" }, { "name": "Histone H3.Y2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DPK5" } ], "function": [ { "annotation": "Primate-specific variant histone H3, which constitutes a core component of nucleosomes (PubMed:20819935). Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling (Probable).", "evidence": [ { "database": "UniProtKB", "id": "P0DPK5", "url": "https://www.uniprot.org/uniprot/P0DPK5#function" }, { "database": "PubMed", "id": "20819935", "url": "https://glygen.org/publication/PubMed/20819935" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DPK5", "url": "https://www.uniprot.org/uniprot/P0DPK5" } ], "common_name": "Human" } ], "gene": [ { "name": "H3Y2", "url": "https://www.uniprot.org/uniprot/P0DPK5", "locus": { "chromosome": "5", "start_pos": 17490967, "end_pos": 17492076, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000268799", "url": "https://www.ensembl.org/id/ENSG00000268799" } ] } } ], "crossref": [ { "id": "ENSG00000268799", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000268799", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "H3Y2", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=H3Y2", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "43734", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=43734", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR000164", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000164", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007125", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007125", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009072", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009072", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "NX_P0DPK5", "url": "https://www.nextprot.org/entry/NX_P0DPK5", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "GDMQLAR", "url": "https://omabrowser.org/oma/group/GDMQLAR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4734275at2759", "url": "http://www.orthodb.org/?query=4734275at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11426", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11426", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11426:SF262", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11426:SF262", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "7ZDD", "url": "https://www.rcsb.org/structure/7ZDD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00125", "url": "http://pfam.xfam.org/family/PF00125", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P0DPK5", "url": "https://www.uniprot.org/uniprot/P0DPK5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0DPK5-1", "url": "https://www.uniprot.org/uniprot/P0DPK5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MARTKQTARKATAWQAPRKPLATKAARKRASPTGGIKKPHRYKPGTLALREIRKYQKSTQLLLRKLPFQRLVREIAQAISPDLRFQSAAIGALQEASEAYLVQLFEDTNLCAIHARRVTIMPRDMQLARRLRGEGAGEPTLLGNLAL", "length": 147, "header": "sp|P0DPK5-1|H3Y2_HUMAN Isoform 1 of Histone H3.X OS=Homo sapiens OX=9606 GN=H3Y2 PE=5 SV=1 CANONICAL=P0DPK5-1" }, "isoforms": [ { "isoform_ac": "P0DPK5-1", "url": "", "sequence": { "sequence": "MARTKQTARKATAWQAPRKPLATKAARKRASPTGGIKKPHRYKPGTLALREIRKYQKSTQLLLRKLPFQRLVREIAQAISPDLRFQSAAIGALQEASEAYLVQLFEDTNLCAIHARRVTIMPRDMQLARRLRGEGAGEPTLLGNLAL", "length": 147, "header": "sp|P0DPK5-1|H3Y2_HUMAN Isoform 1 of Histone H3.X OS=Homo sapiens OX=9606 GN=H3Y2 PE=5 SV=1 CANONICAL=P0DPK5-1" }, "locus": { "chromosome": "5", "start_pos": 17491768, "end_pos": 17491328, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000600799.3", "url": "https://www.ensembl.org/id/ENST00000600799.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000497053.1", "url": "https://www.ensembl.org/id/ENSP00000497053.1" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 108, "end_pos": 108, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P0DPK5", "url": "https://www.uniprot.org/uniprot/P0DPK5" } ], "site_lbl": "Thr108" }, { "start_pos": 12, "end_pos": 12, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P0DPK5", "url": "https://www.uniprot.org/uniprot/P0DPK5" } ], "site_lbl": "Thr12" }, { "start_pos": 42, "end_pos": 42, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P0DPK5", "url": "https://www.uniprot.org/uniprot/P0DPK5" } ], "site_lbl": "Tyr42" }, { "start_pos": 4, "end_pos": 4, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P0DPK5", "url": "https://www.uniprot.org/uniprot/P0DPK5" } ], "site_lbl": "Thr4" }, { "start_pos": 58, "end_pos": 58, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P0DPK5", "url": "https://www.uniprot.org/uniprot/P0DPK5" } ], "site_lbl": "Ser58" }, { "start_pos": 7, "end_pos": 7, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P0DPK5", "url": "https://www.uniprot.org/uniprot/P0DPK5" } ], "site_lbl": "Thr7" }, { "start_pos": 87, "end_pos": 87, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P0DPK5", "url": "https://www.uniprot.org/uniprot/P0DPK5" } ], "site_lbl": "Ser87" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Identification and characterization of two novel primate-specific histone H3 variants, H3.X and H3.Y.", "journal": "The Journal of cell biology", "date": "2010-09-06", "authors": "Wiedemann Sonja M, Mildner Silke N, B\u00f6nisch Clemens, Israel Lars, Maiser Andreas, Matheisl Sarah, Straub Tobias, Merkl Rainer, Leonhardt Heinrich, Kremmer Elisabeth, Schermelleh Lothar, Hake Sandra B", "evidence": [ { "database": "UniProtKB", "id": "P0DPK5", "url": "https://www.uniprot.org/uniprot/P0DPK5" } ], "reference": [ { "type": "PubMed", "id": "20819935", "url": "https://glygen.org/publication/PubMed/20819935" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "P0DPK5", "url": "https://www.uniprot.org/uniprot/P0DPK5" } ], "pmid": "" }, { "name": "protein heterodimerization activity", "id": "GO:0046982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046982", "evidence": [ { "database": "UniProtKB", "id": "P0DPK5", "url": "https://www.uniprot.org/uniprot/P0DPK5" } ], "pmid": "" }, { "name": "structural constituent of chromatin", "id": "GO:0030527", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030527", "evidence": [ { "database": "UniProtKB", "id": "P0DPK5", "url": "https://www.uniprot.org/uniprot/P0DPK5" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P0DPK5", "url": "https://www.uniprot.org/uniprot/P0DPK5" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P0DPK5", "url": "https://www.uniprot.org/uniprot/P0DPK5" } ], "pmid": "" }, { "name": "nucleosome", "id": "GO:0000786", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000786", "evidence": [ { "database": "UniProtKB", "id": "P0DPK5", "url": "https://www.uniprot.org/uniprot/P0DPK5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 4, 7, 12, 42, 58, 87, 108 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }