{ "uniprot_canonical_ac": "P0DPB6-1", "uniprot_ac": "P0DPB6", "uniprot_id": "RPAC2_HUMAN", "mass": { "chemical_mass": 15237.0, "monoisotopic_mass": 15237.0 }, "refseq": { "ac": "NP_057056", "name": "DNA-directed RNA polymerases I and III subunit RPAC2 isoform 1", "summary": "The protein encoded by this gene is a component of the RNA polymerase I and RNA polymerase III complexes, which function in the synthesis of ribosomal RNA precursors and small RNAs, respectively. Mutations in this gene are a cause of Treacher Collins syndrome (TCS), a craniofacial development disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2011].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_057056" }, "gene_names": [ { "name": "POLR1D", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P0DPB6", "id": "P0DPB6" }, { "name": "AC19; POLR1C; RPA16; RPA9; RPAC2; RPC16; RPO1-3; TCS2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_057056", "id": "NP_057056" }, { "name": "POLR1D", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_057056", "id": "NP_057056" }, { "name": "hCG_2020048", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P0DPB6", "id": "P0DPB6" } ], "protein_names": [ { "name": "DNA-directed RNA polymerases I and III subunit RPAC2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P0DPB6" }, { "name": "AC19", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DPB6" }, { "name": "DNA-directed RNA polymerase I subunit D", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DPB6" }, { "name": "DNA-directed RNA polymerases I and III subunit RPAC2 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_057056", "id": "NP_057056" }, { "name": "DNA-directed RNA polymerases I and III subunit RPAC2; RNA polymerase I subunit D; RNA polymerases I and III subunit AC2; polymerase (RNA) I polypeptide D, 16kDa; DNA-directed RNA polymerase I subunit D; polymerase (RNA) I subunit D; Protein POLR1D", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_057056", "id": "NP_057056" }, { "name": "RNA polymerase I 16 kDa subunit", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DPB6" }, { "name": "RNA polymerases I and III subunit AC2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DPB6" }, { "name": "RPA16", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DPB6" }, { "name": "RPC16", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DPB6" }, { "name": "hRPA19", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DPB6" } ], "function": [ { "annotation": "A clinically-relevant residue of POLR1D is required for Drosophila development.", "evidence": [ { "database": "RefSeq", "id": "NP_057056", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_057056" }, { "database": "PubMed", "id": "35656583", "url": "https://glygen.org/publication/PubMed/35656583" } ] }, { "annotation": "Analyzed the kinetics of assembly and elongation of the RNA polymerase I complex on endogenous ribosomal genes in the nuclei of living cells with the use of in vivo microscopy", "evidence": [ { "database": "RefSeq", "id": "NP_057056", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_057056" }, { "database": "PubMed", "id": "12446911", "url": "https://glygen.org/publication/PubMed/12446911" } ] }, { "annotation": "Characterization of the homologous mouse protein.", "evidence": [ { "database": "RefSeq", "id": "NP_057056", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_057056" }, { "database": "PubMed", "id": "8955128", "url": "https://glygen.org/publication/PubMed/8955128" } ] }, { "annotation": "DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively.", "evidence": [ { "database": "UniProtKB", "id": "A0A0R4J2F3", "url": "https://www.uniprot.org/uniprot/A0A0R4J2F3#function" }, { "database": "UniProtKB", "id": "ARBA00025447", "url": "https://www.uniprot.org/uniprot/ARBA00025447#function" }, { "database": "UniProtKB", "id": "P0DPB6", "url": "https://www.uniprot.org/uniprot/P0DPB6#function" }, { "database": "PubMed", "id": "35637192", "url": "https://glygen.org/publication/PubMed/35637192" }, { "database": "PubMed", "id": "20413673", "url": "https://glygen.org/publication/PubMed/20413673" }, { "database": "UniProtKB", "id": "P28000", "url": "https://www.uniprot.org/uniprot/P28000#function" } ] }, { "annotation": "Heterozygous mutations of POLR1D in 252 individuals with Treacher Collins syndrome", "evidence": [ { "database": "RefSeq", "id": "NP_057056", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_057056" }, { "database": "PubMed", "id": "21131976", "url": "https://glygen.org/publication/PubMed/21131976" } ] }, { "annotation": "The protein encoded by this gene is a component of the RNA polymerase I and RNA polymerase III complexes, which function in the synthesis of ribosomal RNA precursors and small RNAs, respectively. Mutations in this gene are a cause of Treacher Collins syndrome (TCS), a craniofacial development disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2011].", "evidence": [ { "database": "RefSeq", "id": "NP_057056", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_057056" } ] } ], "disease": [ { "disease_id": "DOID:0080790", "recommended_name": { "id": "DOID:0080790", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080790", "name": "Treacher Collins syndrome 2", "description": "A Treacher Collins syndrome that has_material_basis_in heterozygous mutation in the POLR1D gene on chromosome 13q12." }, "synonyms": [ { "id": "MONDO:0013385", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013385", "name": "Treacher Collins syndrome 2", "description": "Any Treacher-Collins syndrome in which the cause of the disease is a mutation in the POLR1D gene." }, { "id": "MONDO:0013385", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013385", "name": "POLR1D Treacher-Collins syndrome", "description": "" }, { "id": "MONDO:0013385", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013385", "name": "Treacher Collins syndrome 2", "description": "" }, { "id": "MONDO:0013385", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013385", "name": "Treacher Collins syndrome type 2", "description": "" }, { "id": "MONDO:0013385", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013385", "name": "Treacher-Collins syndrome caused by mutation in POLR1D", "description": "" }, { "id": "MONDO:0013385", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013385", "name": "TCS2", "description": "" }, { "id": "MONDO:0013385", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013385", "name": "TREACHER COLLINS syndrome 2", "description": "" }, { "id": "MIM:613717", "resource": "MIM", "url": "https://www.omim.org/entry/613717", "name": "Treacher Collins syndrome 2", "description": "Treacher Collins syndrome 2" } ], "evidence": [ { "id": "613717", "database": "MIM", "url": "https://www.omim.org/entry/613717" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "94.63", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000186184", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186184" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "96.49", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000186184", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186184" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "96.95", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000186184", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186184" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "89.92", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000186184", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186184" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "98.02", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000186184", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186184" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "97.41", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000186184", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186184" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "96.98", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000186184", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186184" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "98.09", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000186184", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186184" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "96.41", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000186184", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186184" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "92.98", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000186184", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186184" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "93.91", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000186184", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186184" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "98.08", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000186184", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186184" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "97.01", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000186184", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186184" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P0DPB6", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DPB6" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P0DPB6", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DPB6" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P0DPB6", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DPB6" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P0DPB6", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DPB6" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P0DPB6", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DPB6" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P0DPB6", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DPB6" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P0DPB6", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DPB6" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P0DPB6", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DPB6" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P0DPB6", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DPB6" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P0DPB6", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DPB6" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P0DPB6", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DPB6" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P0DPB6", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DPB6" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DPB6", "url": "https://www.uniprot.org/uniprot/P0DPB6" } ], "common_name": "Human" } ], "gene": [ { "name": "POLR1D", "url": "https://www.uniprot.org/uniprot/P0DPB6", "locus": { "chromosome": "13", "start_pos": 27744237, "end_pos": 27620742, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000186184", "url": "https://www.ensembl.org/id/ENSG00000186184" } ] } } ], "crossref": [ { "id": "ENSG00000186184", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186184", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd07029", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07029", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "POLR1D", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=POLR1D", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "51082", "url": "https://www.ncbi.nlm.nih.gov/gene/51082", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "20422", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=20422", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P0DPB5", "url": "https://www.ebi.ac.uk/intact/interactors/id:P0DPB5*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "P0DPB6", "url": "https://www.ebi.ac.uk/intact/interactors/id:P0DPB6*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR008193", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008193", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009025", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009025", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR022905", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022905", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033898", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033898", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036603", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036603", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038948", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038948", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:51082", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:51082", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "613715", "url": "http://www.omim.org/entry/613715", "database": "MIM", "categories": [ "Other" ] }, { "id": "613717", "url": "http://www.omim.org/entry/613717", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P0DPB5", "url": "https://www.nextprot.org/entry/NX_P0DPB5", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "NX_P0DPB6", "url": "https://www.nextprot.org/entry/NX_P0DPB6", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P0DPB6", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P0DPB6", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "MRIQMYD", "url": "https://omabrowser.org/oma/group/MRIQMYD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5484605at2759", "url": "http://www.orthodb.org/?query=5484605at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13946", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13946", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13946:SF28", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13946:SF28", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR34769", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR34769", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR34769:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR34769:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "7A6H", "url": "https://www.rcsb.org/structure/7A6H", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7AE1", "url": "https://www.rcsb.org/structure/7AE1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7AE3", "url": "https://www.rcsb.org/structure/7AE3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7AEA", "url": "https://www.rcsb.org/structure/7AEA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7AST", "url": "https://www.rcsb.org/structure/7AST", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7D58", "url": "https://www.rcsb.org/structure/7D58", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7D59", "url": "https://www.rcsb.org/structure/7D59", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7DN3", "url": "https://www.rcsb.org/structure/7DN3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7DU2", "url": "https://www.rcsb.org/structure/7DU2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FJI", "url": "https://www.rcsb.org/structure/7FJI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FJJ", "url": "https://www.rcsb.org/structure/7FJJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7OB9", "url": "https://www.rcsb.org/structure/7OB9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7OBA", "url": "https://www.rcsb.org/structure/7OBA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7OBB", "url": "https://www.rcsb.org/structure/7OBB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7VBA", "url": "https://www.rcsb.org/structure/7VBA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7VBB", "url": "https://www.rcsb.org/structure/7VBB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7VBC", "url": "https://www.rcsb.org/structure/7VBC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8A43", "url": "https://www.rcsb.org/structure/8A43", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8ITY", "url": "https://www.rcsb.org/structure/8ITY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8IUE", "url": "https://www.rcsb.org/structure/8IUE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8IUH", "url": "https://www.rcsb.org/structure/8IUH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF13656", "url": "http://pfam.xfam.org/family/PF13656", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P0DPB5", "url": "https://pharos.nih.gov/targets/P0DPB5", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "P0DPB6", "url": "https://pharos.nih.gov/targets/P0DPB6", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "R-HSA-1834949", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1834949", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-427413", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427413", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5250924", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-73762", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73762", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-73772", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73772", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-73780", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73780", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-73863", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73863", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-73980", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73980", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-749476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-749476", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-76061", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-76061", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-76066", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-76066", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-76071", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-76071", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_057056", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_057056", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A087WTY1", "url": "https://www.uniprot.org/uniprot/A0A087WTY1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WTY1-1", "url": "https://www.uniprot.org/uniprot/A0A087WTY1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087X0U2", "url": "https://www.uniprot.org/uniprot/A0A087X0U2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087X0U2-1", "url": "https://www.uniprot.org/uniprot/A0A087X0U2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0R4J2F3", "url": "https://www.uniprot.org/uniprot/A0A0R4J2F3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0R4J2F3-1", "url": "https://www.uniprot.org/uniprot/A0A0R4J2F3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GUZ5", "url": "https://www.uniprot.org/uniprot/A0A1B0GUZ5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GUZ5-1", "url": "https://www.uniprot.org/uniprot/A0A1B0GUZ5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5KX40", "url": "https://www.uniprot.org/uniprot/A0A8I5KX40", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5KX40-1", "url": "https://www.uniprot.org/uniprot/A0A8I5KX40-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5QL02", "url": "https://www.uniprot.org/uniprot/A0A8I5QL02", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5QL02-1", "url": "https://www.uniprot.org/uniprot/A0A8I5QL02-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0DPB5", "url": "https://www.uniprot.org/uniprot/P0DPB5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0DPB5-1", "url": "https://www.uniprot.org/uniprot/P0DPB5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0DPB6", "url": "https://www.uniprot.org/uniprot/P0DPB6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0DPB6-1", "url": "https://www.uniprot.org/uniprot/P0DPB6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q7Z776", "url": "https://www.uniprot.org/uniprot/Q7Z776", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q7Z776-1", "url": "https://www.uniprot.org/uniprot/Q7Z776-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF", "length": 133, "header": "sp|P0DPB6-1|RPAC2_HUMAN Isoform 1 of DNA-directed RNA polymerases I and III subunit RPAC2 OS=Homo sapiens OX=9606 GN=POLR1D PE=1 SV=1 CANONICAL=P0DPB6-1" }, "isoforms": [ { "isoform_ac": "A0A087WTY1-1", "url": "", "sequence": { "sequence": "MGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRR", "length": 94, "header": "tr|A0A087WTY1-1|RPAC2_HUMAN Computationally mapped isoform of DNA-directed RNA polymerases I and III subunit RPAC2 OS=Homo sapiens OX=9606 GN=POLR1D PE=1 SV=1 CANONICAL=P0DPB6-1" }, "locus": { "chromosome": "13", "start_pos": 27665950, "end_pos": 27648437, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000637180.1", "url": "https://www.ensembl.org/id/ENST00000637180.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000490619.1", "url": "https://www.ensembl.org/id/ENSP00000490619.1" } ] } }, { "isoform_ac": "A0A087X0U2-1", "url": "", "sequence": { "sequence": "MEEDQELERKAIEELLKEAKRGKTRAETMGPMGCLLQGQDTN", "length": 42, "header": "tr|A0A087X0U2-1|RPAC2_HUMAN Computationally mapped isoform of DNA-directed RNA polymerases I and III subunit RPAC2 OS=Homo sapiens OX=9606 GN=POLR1D PE=1 SV=1 CANONICAL=P0DPB6-1" }, "locus": { "chromosome": "13", "start_pos": 27650066, "end_pos": 27621984, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000465887.2", "url": "https://www.ensembl.org/id/ENST00000465887.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000487057.1", "url": "https://www.ensembl.org/id/ENSP00000487057.1" } ] } }, { "isoform_ac": "A0A0R4J2F3-1", "url": "", "sequence": { "sequence": "MAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF", "length": 116, "header": "tr|A0A0R4J2F3-1|RPAC2_HUMAN Computationally mapped isoform of DNA-directed RNA polymerases I and III subunit RPAC2 OS=Homo sapiens OX=9606 GN=POLR1D PE=1 SV=1 CANONICAL=P0DPB6-1" }, "locus": { "chromosome": "13", "start_pos": 27623247, "end_pos": 27622900, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000399696.3", "url": "https://www.ensembl.org/id/ENST00000399696.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000382603.2", "url": "https://www.ensembl.org/id/ENSP00000382603.2" } ] } }, { "isoform_ac": "A0A1B0GUZ5-1", "url": "", "sequence": { "sequence": "MEEDQELERKAIEELLKEAKRGKTRAETMGPMGCLFNMKMMRMRTL", "length": 46, "header": "tr|A0A1B0GUZ5-1|RPAC2_HUMAN Computationally mapped isoform of DNA-directed RNA polymerases I and III subunit RPAC2 OS=Homo sapiens OX=9606 GN=POLR1D PE=1 SV=1 CANONICAL=P0DPB6-1" }, "locus": { "chromosome": "13", "start_pos": 27738743, "end_pos": 27621984, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000636817.1", "url": "https://www.ensembl.org/id/ENST00000636817.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000490310.1", "url": "https://www.ensembl.org/id/ENSP00000490310.1" } ] } }, { "isoform_ac": "A0A8I5KX40-1", "url": "", "sequence": { "sequence": "MEEDQELERKAIEELLKEAKRGKTRAETMGPMGW", "length": 34, "header": "tr|A0A8I5KX40-1|RPAC2_HUMAN Computationally mapped isoform of DNA-directed RNA polymerases I and III subunit RPAC2 OS=Homo sapiens OX=9606 GN=POLR1D PE=1 SV=1 CANONICAL=P0DPB6-1" }, "locus": { "chromosome": "13", "start_pos": 27648454, "end_pos": 27621984, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000685267.1", "url": "https://www.ensembl.org/id/ENST00000685267.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000508576.1", "url": "https://www.ensembl.org/id/ENSP00000508576.1" } ] } }, { "isoform_ac": "A0A8I5QL02-1", "url": "", "sequence": { "sequence": "MEEDQELERMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRR", "length": 97, "header": "tr|A0A8I5QL02-1|RPAC2_HUMAN Computationally mapped isoform of DNA-directed RNA polymerases I and III subunit RPAC2 OS=Homo sapiens OX=9606 GN=POLR1D PE=1 SV=1 CANONICAL=P0DPB6-1" }, "locus": { "chromosome": "13", "start_pos": 27665950, "end_pos": 27621984, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000692944.1", "url": "https://www.ensembl.org/id/ENST00000692944.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000510286.1", "url": "https://www.ensembl.org/id/ENSP00000510286.1" } ] } }, { "isoform_ac": "P0DPB5-1", "url": "", "sequence": { "sequence": "MEEDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRR", "length": 122, "header": "sp|P0DPB5-1|RPAC2_HUMAN Computationally mapped isoform of DNA-directed RNA polymerases I and III subunit RPAC2 OS=Homo sapiens OX=9606 GN=POLR1D PE=1 SV=1 CANONICAL=P0DPB6-1" }, "locus": { "chromosome": "13", "start_pos": 27665950, "end_pos": 27621984, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000399697.7", "url": "https://www.ensembl.org/id/ENST00000399697.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000382604.3", "url": "https://www.ensembl.org/id/ENSP00000382604.3" } ] } }, { "isoform_ac": "P0DPB6-1", "url": "", "sequence": { "sequence": "MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF", "length": 133, "header": "sp|P0DPB6-1|RPAC2_HUMAN Isoform 1 of DNA-directed RNA polymerases I and III subunit RPAC2 OS=Homo sapiens OX=9606 GN=POLR1D PE=1 SV=1 CANONICAL=P0DPB6-1" }, "locus": { "chromosome": "13", "start_pos": 27623247, "end_pos": 27621984, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000302979.5", "url": "https://www.ensembl.org/id/ENST00000302979.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000302478.4", "url": "https://www.ensembl.org/id/ENSP00000302478.4" } ] } }, { "isoform_ac": "Q7Z776-1", "url": "", "sequence": { "sequence": "MEEDQELERKAIEELLKEAKRGKTRAETMGPMG", "length": 33, "header": "tr|Q7Z776-1|RPAC2_HUMAN Computationally mapped isoform of DNA-directed RNA polymerases I and III subunit RPAC2 OS=Homo sapiens OX=9606 GN=POLR1D PE=1 SV=1 CANONICAL=P0DPB6-1" }, "locus": { "chromosome": "13", "start_pos": 27665687, "end_pos": 27621984, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000630983.1", "url": "https://www.ensembl.org/id/ENST00000630983.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000486928.1", "url": "https://www.ensembl.org/id/ENSP00000486928.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P0DPB6", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P0DPB6" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" } ] } ], "phosphorylation": [ { "start_pos": 25, "end_pos": 25, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P0DPB6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P0DPB6" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr25" }, { "start_pos": 35, "end_pos": 35, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P0DPB6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P0DPB6" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr35" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Recruitment of TATA-binding protein-TAFI complex SL1 to the human ribosomal DNA promoter is mediated by the carboxy-terminal activation domain of upstream binding factor (UBF) and is regulated by UBF phosphorylation.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Tuan JC, Zhai W, Comai L", "evidence": [ { "database": "Reactome", "id": "R-HSA-73762", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73762" } ], "reference": [ { "type": "PubMed", "id": "10082553", "url": "https://glygen.org/publication/PubMed/10082553" } ] }, { "title": "SNAP(c): a core promoter factor with a built-in DNA-binding damper that is deactivated by the Oct-1 POU domain.", "journal": "Genes & development", "date": "1999", "authors": "Mittal V, Ma B, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-76071", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-76071" } ], "reference": [ { "type": "PubMed", "id": "10421633", "url": "https://glygen.org/publication/PubMed/10421633" } ] }, { "title": "MBD2 is a transcriptional repressor belonging to the MeCP1 histone deacetylase complex.", "journal": "Nature genetics", "date": "1999", "authors": "Ng HH, Zhang Y, Hendrich B, Johnson CA, Turner BM, Erdjument-Bromage H, Tempst P, Reinberg D, Bird A", "evidence": [ { "database": "Reactome", "id": "R-HSA-427413", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427413" } ], "reference": [ { "type": "PubMed", "id": "10471499", "url": "https://glygen.org/publication/PubMed/10471499" } ] }, { "title": "Repression of RNA polymerase I transcription by the tumor suppressor p53.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Zhai W, Comai L", "evidence": [ { "database": "Reactome", "id": "R-HSA-73762", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73762" } ], "reference": [ { "type": "PubMed", "id": "10913176", "url": "https://glygen.org/publication/PubMed/10913176" } ] }, { "title": "A map of protein-protein contacts within the small nuclear RNA-activating protein complex SNAPc.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Ma B, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-76071", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-76071" } ], "reference": [ { "type": "PubMed", "id": "11056176", "url": "https://glygen.org/publication/PubMed/11056176" } ] }, { "title": "Nuclear factor 1 (NF1) affects accurate termination and multiple-round transcription by human RNA polymerase III.", "journal": "The EMBO journal", "date": "2000", "authors": "Wang Z, Bai L, Hsieh YJ, Roeder RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-73980", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73980" } ], "reference": [ { "type": "PubMed", "id": "11118217", "url": "https://glygen.org/publication/PubMed/11118217" } ] }, { "title": "Acetylation of TAF(I)68, a subunit of TIF-IB/SL1, activates RNA polymerase I transcription.", "journal": "The EMBO journal", "date": "2001", "authors": "Muth V, Nadaud S, Grummt I, Voit R", "evidence": [ { "database": "Reactome", "id": "R-HSA-73762", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73762" } ], "reference": [ { "type": "PubMed", "id": "11250901", "url": "https://glygen.org/publication/PubMed/11250901" } ] }, { "title": "The RNA polymerase III transcription apparatus.", "journal": "Journal of molecular biology", "date": "2001", "authors": "Geiduschek EP, Kassavetis GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-76066", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-76066" } ], "reference": [ { "type": "PubMed", "id": "11419933", "url": "https://glygen.org/publication/PubMed/11419933" } ] }, { "title": "A positioned nucleosome on the human U6 promoter allows recruitment of SNAPc by the Oct-1 POU domain.", "journal": "Molecular cell", "date": "2001", "authors": "Zhao X, Pendergrast PS, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-76071", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-76071" } ], "reference": [ { "type": "PubMed", "id": "11463379", "url": "https://glygen.org/publication/PubMed/11463379" } ] }, { "title": "Recruitment of RNA polymerase III to its target promoters.", "journal": "Genes & development", "date": "2002", "authors": "Schramm L, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-76066", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-76066" } ], "reference": [ { "type": "PubMed", "id": "12381659", "url": "https://glygen.org/publication/PubMed/12381659" } ] }, { "title": "Characterization of human RNA polymerase III identifies orthologues for Saccharomyces cerevisiae RNA polymerase III subunits.", "journal": "Mol. Cell. Biol.", "date": "2002", "authors": "Hu P, Wu S, Sun Y, Yuan CC, Kobayashi R, Myers MP, Hernandez N", "evidence": [ { "database": "UniProtKB", "id": "P0DPB6", "url": "https://www.uniprot.org/uniprot/P0DPB6" } ], "reference": [ { "type": "PubMed", "id": "12391170", "url": "https://glygen.org/publication/PubMed/12391170" } ] }, { "title": "Multiple interactions between RNA polymerase I, TIF-IA and TAF(I) subunits regulate preinitiation complex assembly at the ribosomal gene promoter.", "journal": "EMBO reports", "date": "2002", "authors": "Yuan X, Zhao J, Zentgraf H, Hoffmann-Rohrer U, Grummt I", "evidence": [ { "database": "Reactome", "id": "R-HSA-73762", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73762" } ], "reference": [ { "type": "PubMed", "id": "12393749", "url": "https://glygen.org/publication/PubMed/12393749" } ] }, { "title": "A kinetic framework for a mammalian RNA polymerase in vivo.", "journal": "Science (New York, N.Y.)", "date": "2002", "authors": "Dundr M, Hoffmann-Rohrer U, Hu Q, Grummt I, Rothblum LI, Phair RD, Misteli T", "evidence": [ { "database": "RefSeq", "id": "NP_057056", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_057056" } ], "reference": [ { "type": "PubMed", "id": "12446911", "url": "https://glygen.org/publication/PubMed/12446911" } ] }, { "title": "Rrn3 becomes inactivated in the process of ribosomal DNA transcription.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Hirschler-Laszkiewicz I, Cavanaugh AH, Mirza A, Lun M, Hu Q, Smink T, Rothblum LI", "evidence": [ { "database": "Reactome", "id": "R-HSA-73772", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73772" } ], "reference": [ { "type": "PubMed", "id": "12646563", "url": "https://glygen.org/publication/PubMed/12646563" } ] }, { "title": "Role of human ribosomal RNA (rRNA) promoter methylation and of methyl-CpG-binding protein MBD2 in the suppression of rRNA gene expression.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Ghoshal K, Majumder S, Datta J, Motiwala T, Bai S, Sharma SM, Frankel W, Jacob ST", "evidence": [ { "database": "Reactome", "id": "R-HSA-427413", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427413" } ], "reference": [ { "type": "PubMed", "id": "14610093", "url": "https://glygen.org/publication/PubMed/14610093" } ] }, { "title": "Mechanism of RNA polymerase I transcription.", "journal": "Advances in protein chemistry", "date": "2004", "authors": "Comai L", "evidence": [ { "database": "Reactome", "id": "R-HSA-73772", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73772" } ], "reference": [ { "type": "PubMed", "id": "14969726", "url": "https://glygen.org/publication/PubMed/14969726" } ] }, { "title": "The TATA-binding protein and associated factors are integral components of the RNA polymerase I transcription factor, SL1.", "journal": "Cell", "date": "1992", "authors": "Comai L, Tanese N, Tjian R", "evidence": [ { "database": "Reactome", "id": "R-HSA-73762", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73762" } ], "reference": [ { "type": "PubMed", "id": "1547496", "url": "https://glygen.org/publication/PubMed/1547496" } ] }, { "title": "Nuclear actin and myosin I are required for RNA polymerase I transcription.", "journal": "Nature cell biology", "date": "2004", "authors": "Philimonenko VV, Zhao J, Iben S, Dingova H, Kysela K, Kahle M, Zentgraf H, Hofmann WA, de Lanerolle P, Hozak P, Grummt I", "evidence": [ { "database": "Reactome", "id": "R-HSA-5250924", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924" } ], "reference": [ { "type": "PubMed", "id": "15558034", "url": "https://glygen.org/publication/PubMed/15558034" } ] }, { "title": "The chromatin remodelling complex WSTF-SNF2h interacts with nuclear myosin 1 and has a role in RNA polymerase I transcription.", "journal": "EMBO reports", "date": "2006", "authors": "Percipalle P, Fomproix N, Cavellan E, Voit R, Reimer G, Kruger T, Thyberg J, Scheer U, Grummt I, Farrants AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5250924", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924" } ], "reference": [ { "type": "PubMed", "id": "16514417", "url": "https://glygen.org/publication/PubMed/16514417" } ] }, { "title": "The WSTF-SNF2h chromatin remodeling complex interacts with several nuclear proteins in transcription.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Cavellan E, Asp P, Percipalle P, Farrants AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5250924", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924" } ], "reference": [ { "type": "PubMed", "id": "16603771", "url": "https://glygen.org/publication/PubMed/16603771" } ] }, { "title": "Role of DNA methyltransferases in regulation of human ribosomal RNA gene transcription.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Majumder S, Ghoshal K, Datta J, Smith DS, Bai S, Jacob ST", "evidence": [ { "database": "Reactome", "id": "R-HSA-427413", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427413" } ], "reference": [ { "type": "PubMed", "id": "16735507", "url": "https://glygen.org/publication/PubMed/16735507" } ] }, { "title": "A novel TBP-associated factor of SL1 functions in RNA polymerase I transcription.", "journal": "The EMBO journal", "date": "2007", "authors": "Gorski JJ, Pathak S, Panov K, Kasciukovic T, Panova T, Russell J, Zomerdijk JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-73762", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73762" } ], "reference": [ { "type": "PubMed", "id": "17318177", "url": "https://glygen.org/publication/PubMed/17318177" } ] }, { "title": "Epigenetic disruption of ribosomal RNA genes and nucleolar architecture in DNA methyltransferase 1 (Dnmt1) deficient cells.", "journal": "Nucleic acids research", "date": "2007", "authors": "Espada J, Ballestar E, Santoro R, Fraga MF, Villar-Garea A, Nemeth A, Lopez-Serra L, Ropero S, Aranda A, Orozco H, Moreno V, Juarranz A, Stockert JC, Langst G, Grummt I, Bickmore W, Esteller M", "evidence": [ { "database": "Reactome", "id": "R-HSA-427413", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427413" } ], "reference": [ { "type": "PubMed", "id": "17355984", "url": "https://glygen.org/publication/PubMed/17355984" } ] }, { "title": "AIM2 recognizes cytosolic dsDNA and forms a caspase-1-activating inflammasome with ASC.", "journal": "Nature", "date": "2009", "authors": "Hornung V, Ablasser A, Charrel-Dennis M, Bauernfeind F, Horvath G, Caffrey DR, Latz E, Fitzgerald KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1834949", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1834949" } ], "reference": [ { "type": "PubMed", "id": "19158675", "url": "https://glygen.org/publication/PubMed/19158675" } ] }, { "title": "AIM2 activates the inflammasome and cell death in response to cytoplasmic DNA.", "journal": "Nature", "date": "2009", "authors": "Fernandes-Alnemri T, Yu JW, Datta P, Wu J, Alnemri ES", "evidence": [ { "database": "Reactome", "id": "R-HSA-1834949", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1834949" } ], "reference": [ { "type": "PubMed", "id": "19158676", "url": "https://glygen.org/publication/PubMed/19158676" } ] }, { "title": "An orthogonal proteomic-genomic screen identifies AIM2 as a cytoplasmic DNA sensor for the inflammasome.", "journal": "Nature immunology", "date": "2009", "authors": "Burckstummer T, Baumann C, Bluml S, Dixit E, Durnberger G, Jahn H, Planyavsky M, Bilban M, Colinge J, Bennett KL, Superti-Furga G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1834949", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1834949" } ], "reference": [ { "type": "PubMed", "id": "19158679", "url": "https://glygen.org/publication/PubMed/19158679" } ] }, { "title": "The small subunit of transcription factor IIF recruits RNA polymerase II into the preinitiation complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Flores O, Lu H, Killeen M, Greenblatt J, Burton ZF, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-76061", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-76061" } ], "reference": [ { "type": "PubMed", "id": "1946469", "url": "https://glygen.org/publication/PubMed/1946469" } ] }, { "title": "RIG-I-dependent sensing of poly(dA:dT) through the induction of an RNA polymerase III-transcribed RNA intermediate.", "journal": "Nature immunology", "date": "2009", "authors": "Ablasser A, Bauernfeind F, Hartmann G, Latz E, Fitzgerald KA, Hornung V", "evidence": [ { "database": "Reactome", "id": "R-HSA-1834949", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1834949" } ], "reference": [ { "type": "PubMed", "id": "19609254", "url": "https://glygen.org/publication/PubMed/19609254" } ] }, { "title": "RNA polymerase III detects cytosolic DNA and induces type I interferons through the RIG-I pathway.", "journal": "Cell", "date": "2009", "authors": "Chiu YH, Macmillan JB, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1834949", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1834949" } ], "reference": [ { "type": "PubMed", "id": "19631370", "url": "https://glygen.org/publication/PubMed/19631370" } ] }, { "title": "An intergenic non-coding rRNA correlated with expression of the rRNA and frequency of an rRNA single nucleotide polymorphism in lung cancer cells.", "journal": "PloS one", "date": "2009", "authors": "Shiao YH, Lupascu ST, Gu YD, Kasprzak W, Hwang CJ, Fields JR, Leighty RM, Quinones O, Shapiro BA, Alvord WG, Anderson LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-427413", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427413" } ], "reference": [ { "type": "PubMed", "id": "19838300", "url": "https://glygen.org/publication/PubMed/19838300" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P0DPB6-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P0DPB6-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Defining the RNA polymerase III transcriptome: Genome-wide localization of the RNA polymerase III transcription machinery in human cells.", "journal": "Genome research", "date": "2010-06", "authors": "Canella Donatella, Praz Viviane, Reina Jaime H, Cousin Pascal, Hernandez Nouria", "evidence": [ { "database": "UniProtKB", "id": "P0DPB6", "url": "https://www.uniprot.org/uniprot/P0DPB6" } ], "reference": [ { "type": "PubMed", "id": "20413673", "url": "https://glygen.org/publication/PubMed/20413673" } ] }, { "title": "Mutations in genes encoding subunits of RNA polymerases I and III cause Treacher Collins syndrome.", "journal": "Nature genetics", "date": "2011", "authors": "Dauwerse JG, Dixon J, Seland S, Ruivenkamp CA, van Haeringen A, Hoefsloot LH, Peters DJ, Boers AC, Daumer-Haas C, Maiwald R, Zweier C, Kerr B, Cobo AM, Toral JF, Hoogeboom AJ, Lohmann DR, Hehr U, Dixon MJ, Breuning MH, Wieczorek D", "evidence": [ { "database": "UniProtKB", "id": "P0DPB6", "url": "https://www.uniprot.org/uniprot/P0DPB6" }, { "database": "RefSeq", "id": "NP_057056", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_057056" } ], "reference": [ { "type": "PubMed", "id": "21131976", "url": "https://glygen.org/publication/PubMed/21131976" } ] }, { "title": "Cutting edge: Ku70 is a novel cytosolic DNA sensor that induces type III rather than type I IFN.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2011", "authors": "Zhang X, Brann TW, Zhou M, Yang J, Oguariri RM, Lidie KB, Imamichi H, Huang DW, Lempicki RA, Baseler MW, Veenstra TD, Young HA, Lane HC, Imamichi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1834949", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1834949" } ], "reference": [ { "type": "PubMed", "id": "21398614", "url": "https://glygen.org/publication/PubMed/21398614" } ] }, { "title": "The chromatin remodelling complex B-WICH changes the chromatin structure and recruits histone acetyl-transferases to active rRNA genes.", "journal": "PloS one", "date": "2011", "authors": "Vintermist A, Bohm S, Sadeghifar F, Louvet E, Mansen A, Percipalle P, Ostlund Farrants AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5250924", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924" } ], "reference": [ { "type": "PubMed", "id": "21559432", "url": "https://glygen.org/publication/PubMed/21559432" } ] }, { "title": "Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-alpha-acetylation features.", "journal": "Molecular & cellular proteomics : MCP", "date": "2012", "authors": "Bienvenut WV, Sumpton D, Martinez A, Lilla S, Espagne C, Meinnel T, Giglione C", "evidence": [ { "database": "UniProtKB", "id": "P0DPB6", "url": "https://www.uniprot.org/uniprot/P0DPB6" } ], "reference": [ { "type": "PubMed", "id": "22223895", "url": "https://glygen.org/publication/PubMed/22223895" } ] }, { "title": "The Reb1-homologue Ydr026c/Nsi1 is required for efficient RNA polymerase I termination in yeast.", "journal": "The EMBO journal", "date": "2012", "authors": "Reiter A, Hamperl S, Seitz H, Merkl P, Perez-Fernandez J, Williams L, Gerber J, Nemeth A, Leger I, Gadal O, Milkereit P, Griesenbeck J, Tschochner H", "evidence": [ { "database": "Reactome", "id": "R-HSA-73863", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73863" } ], "reference": [ { "type": "PubMed", "id": "22805593", "url": "https://glygen.org/publication/PubMed/22805593" } ] }, { "title": "DNA-PK is a DNA sensor for IRF-3-dependent innate immunity.", "journal": "eLife", "date": "2012", "authors": "Ferguson BJ, Mansur DS, Peters NE, Ren H, Smith GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1834949", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1834949" } ], "reference": [ { "type": "PubMed", "id": "23251783", "url": "https://glygen.org/publication/PubMed/23251783" } ] }, { "title": "DNA damage sensor MRE11 recognizes cytosolic double-stranded DNA and induces type I interferon by regulating STING trafficking.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Kondo T, Kobayashi J, Saitoh T, Maruyama K, Ishii KJ, Barber GN, Komatsu K, Akira S, Kawai T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1834949", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1834949" } ], "reference": [ { "type": "PubMed", "id": "23388631", "url": "https://glygen.org/publication/PubMed/23388631" } ] }, { "title": "Nuclear myosin 1c facilitates the chromatin modifications required to activate rRNA gene transcription and cell cycle progression.", "journal": "PLoS genetics", "date": "2013", "authors": "Sarshad A, Sadeghifar F, Louvet E, Mori R, Bohm S, Al-Muzzaini B, Vintermist A, Fomproix N, Ostlund AK, Percipalle P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5250924", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924" } ], "reference": [ { "type": "PubMed", "id": "23555303", "url": "https://glygen.org/publication/PubMed/23555303" } ] }, { "title": "The chromatin remodeling factor CSB recruits histone acetyltransferase PCAF to rRNA gene promoters in active state for transcription initiation.", "journal": "PloS one", "date": "2013", "authors": "Shen M, Zhou T, Xie W, Ling T, Zhu Q, Zong L, Lyu G, Gao Q, Zhang F, Tao W", "evidence": [ { "database": "Reactome", "id": "R-HSA-5250924", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924" } ], "reference": [ { "type": "PubMed", "id": "23667505", "url": "https://glygen.org/publication/PubMed/23667505" } ] }, { "title": "S. cerevisiae TFIIIB is the transcription initiation factor proper of RNA polymerase III, while TFIIIA and TFIIIC are assembly factors.", "journal": "Cell", "date": "1990", "authors": "Kassavetis GA, Braun BR, Nguyen LH, Geiduschek EP", "evidence": [ { "database": "Reactome", "id": "R-HSA-76061", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-76061" } ], "reference": [ { "type": "PubMed", "id": "2404611", "url": "https://glygen.org/publication/PubMed/2404611" } ] }, { "title": "Glycogen synthase kinase (GSK) 3beta phosphorylates and protects nuclear myosin 1c from proteasome-mediated degradation to activate rDNA transcription in early G1 cells.", "journal": "PLoS genetics", "date": "2014", "authors": "Sarshad AA, Corcoran M, Al-Muzzaini B, Borgonovo-Brandter L, Von Euler A, Lamont D, Visa N, Percipalle P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5250924", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924" } ], "reference": [ { "type": "PubMed", "id": "24901984", "url": "https://glygen.org/publication/PubMed/24901984" } ] }, { "title": "New insight into role of myosin motors for activation of RNA polymerases.", "journal": "International review of cell and molecular biology", "date": "2014", "authors": "Sarshad AA, Percipalle P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5250924", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924" } ], "reference": [ { "type": "PubMed", "id": "24952918", "url": "https://glygen.org/publication/PubMed/24952918" } ] }, { "title": "A novel RNA binding surface of the TAM domain of TIP5/BAZ2A mediates epigenetic regulation of rRNA genes.", "journal": "Nucleic acids research", "date": "2015", "authors": "Anosova I, Melnik S, Tripsianes K, Kateb F, Grummt I, Sattler M", "evidence": [ { "database": "Reactome", "id": "R-HSA-427413", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427413" } ], "reference": [ { "type": "PubMed", "id": "25916849", "url": "https://glygen.org/publication/PubMed/25916849" } ] }, { "title": "Structure of the initiation-competent RNA polymerase I and its implication for transcription.", "journal": "Nature communications", "date": "2016", "authors": "Pilsl M, Crucifix C, Papai G, Krupp F, Steinbauer R, Griesenbeck J, Milkereit P, Tschochner H, Schultz P", "evidence": [ { "database": "Reactome", "id": "R-HSA-73762", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73762" } ], "reference": [ { "type": "PubMed", "id": "27418187", "url": "https://glygen.org/publication/PubMed/27418187" } ] }, { "title": "RNA polymerase I-Rrn3 complex at 4.8 A resolution.", "journal": "Nature communications", "date": "2016", "authors": "Engel C, Plitzko J, Cramer P", "evidence": [ { "database": "Reactome", "id": "R-HSA-73762", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73762" } ], "reference": [ { "type": "PubMed", "id": "27418309", "url": "https://glygen.org/publication/PubMed/27418309" } ] }, { "title": "Molecular mechanisms governing species-specific transcription of ribosomal RNA.", "journal": "Cell", "date": "1989", "authors": "Bell SP, Pikaard CS, Reeder RH, Tjian R", "evidence": [ { "database": "Reactome", "id": "R-HSA-73762", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73762" } ], "reference": [ { "type": "PubMed", "id": "2805069", "url": "https://glygen.org/publication/PubMed/2805069" } ] }, { "title": "Synthesis of a Highly Azide-Reactive and Thermosensitive Biofunctional Reagent for Efficient Enrichment and Large-Scale Identification of O-GlcNAc Proteins by Mass Spectrometry.", "journal": "Analytical chemistry", "date": "2017", "authors": "Zhang W, Liu T, Dong H, Bai H, Tian F, Shi Z, Chen M, Wang J, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P0DPB6", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P0DPB6" } ], "reference": [ { "type": "PubMed", "id": "28510447", "url": "https://glygen.org/publication/PubMed/28510447" } ] }, { "title": "Structure of human RNA polymerase III.", "journal": "Nat. Commun.", "date": "2020", "authors": "Ramsay Ewan Phillip, Abascal-Palacios Guillermo, Dai\u00df Julia L, King Helen, Gouge Jerome, Pilsl Michael, Beuron Fabienne, Morris Edward, Gunkel Philip, Engel Christoph, Vannini Alessandro", "evidence": [ { "database": "UniProtKB", "id": "P0DPB6", "url": "https://www.uniprot.org/uniprot/P0DPB6" } ], "reference": [ { "type": "PubMed", "id": "33335104", "url": "https://glygen.org/publication/PubMed/33335104" } ] }, { "title": "Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.", "journal": "Nat. Struct. Mol. Biol.", "date": "2021", "authors": "Girbig M, Misiaszek AD, Vorlander MK, Lafita A, Grotsch H, Baudin F, Bateman A, Muller CW", "evidence": [ { "database": "UniProtKB", "id": "P0DPB6", "url": "https://www.uniprot.org/uniprot/P0DPB6" } ], "reference": [ { "type": "PubMed", "id": "33558764", "url": "https://glygen.org/publication/PubMed/33558764" } ] }, { "title": "Structural insights into transcriptional regulation of human RNA polymerase III.", "journal": "Nat. Struct. Mol. Biol.", "date": "2021", "authors": "Wang Q, Li S, Wan F, Xu Y, Wu Z, Cao M, Lan P, Lei M, Wu J", "evidence": [ { "database": "UniProtKB", "id": "P0DPB6", "url": "https://www.uniprot.org/uniprot/P0DPB6" } ], "reference": [ { "type": "PubMed", "id": "33558766", "url": "https://glygen.org/publication/PubMed/33558766" } ] }, { "title": "Structure of human RNA polymerase III elongation complex.", "journal": "Cell Res.", "date": "2021", "authors": "Li Liang, Yu Zishuo, Zhao Dan, Ren Yulei, Hou Haifeng, Xu Yanhui", "evidence": [ { "database": "UniProtKB", "id": "P0DPB6", "url": "https://www.uniprot.org/uniprot/P0DPB6" } ], "reference": [ { "type": "PubMed", "id": "33674783", "url": "https://glygen.org/publication/PubMed/33674783" } ] }, { "title": "Structural insights into RNA polymerase III-mediated transcription termination through trapping poly-deoxythymidine.", "journal": "Nat. Commun.", "date": "2021", "authors": "Hou Haifeng, Li Yan, Wang Mo, Liu Aijun, Yu Zishuo, Chen Ke, Zhao Dan, Xu Yanhui", "evidence": [ { "database": "UniProtKB", "id": "P0DPB6", "url": "https://www.uniprot.org/uniprot/P0DPB6" } ], "reference": [ { "type": "PubMed", "id": "34675218", "url": "https://glygen.org/publication/PubMed/34675218" } ] }, { "title": "A cancer-associated RNA polymerase III identity drives robust transcription and expression of snaR-A noncoding RNA.", "journal": "Nature communications", "date": "2022", "authors": "Van Bortle K, Marciano DP, Liu Q, Chou T, Lipchik AM, Gollapudi S, Geller BS, Monte E, Kamakaka RT, Snyder MP", "evidence": [ { "database": "UniProtKB", "id": "P0DPB6", "url": "https://www.uniprot.org/uniprot/P0DPB6" } ], "reference": [ { "type": "PubMed", "id": "35637192", "url": "https://glygen.org/publication/PubMed/35637192" } ] }, { "title": "A clinically-relevant residue of POLR1D is required for Drosophila development.", "journal": "Developmental dynamics : an official publication of the American Association of Anatomists", "date": "2022-11", "authors": "Palumbo Ryan J, Belkevich Alana E, Pascual Haleigh G, Knutson Bruce A", "evidence": [ { "database": "RefSeq", "id": "NP_057056", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_057056" } ], "reference": [ { "type": "PubMed", "id": "35656583", "url": "https://glygen.org/publication/PubMed/35656583" } ] }, { "title": "Coactivator and promoter-selective properties of RNA polymerase I TAFs.", "journal": "Science (New York, N.Y.)", "date": "1995", "authors": "Beckmann H, Chen JL, O'Brien T, Tjian R", "evidence": [ { "database": "Reactome", "id": "R-HSA-73762", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73762" } ], "reference": [ { "type": "PubMed", "id": "7491500", "url": "https://glygen.org/publication/PubMed/7491500" } ] }, { "title": "Cloning, expression, and function of TFC5, the gene encoding the B` component of the Saccharomyces cerevisiae RNA polymerase III transcription factor TFIIIB.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Kassavetis GA, Nguyen ST, Kobayashi R, Kumar A, Geiduschek EP, Pisano M", "evidence": [ { "database": "Reactome", "id": "R-HSA-76061", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-76061" } ], "reference": [ { "type": "PubMed", "id": "7568218", "url": "https://glygen.org/publication/PubMed/7568218" } ] }, { "title": "Molecular coevolution of mammalian ribosomal gene terminator sequences and the transcription termination factor TTF-I.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Evers R, Grummt I", "evidence": [ { "database": "Reactome", "id": "R-HSA-427413", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427413" } ], "reference": [ { "type": "PubMed", "id": "7597036", "url": "https://glygen.org/publication/PubMed/7597036" } ] }, { "title": "Reconstitution of transcription factor SL1: exclusive binding of TBP by SL1 or TFIID subunits.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Comai L, Zomerdijk JC, Beckmann H, Zhou S, Admon A, Tjian R", "evidence": [ { "database": "Reactome", "id": "R-HSA-73762", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73762" } ], "reference": [ { "type": "PubMed", "id": "7801123", "url": "https://glygen.org/publication/PubMed/7801123" } ] }, { "title": "Proximal sequence element-binding transcription factor (PTF) is a multisubunit complex required for transcription of both RNA polymerase II- and RNA polymerase III-dependent small nuclear RNA genes.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "Yoon JB, Murphy S, Bai L, Wang Z, Roeder RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-76071", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-76071" } ], "reference": [ { "type": "PubMed", "id": "7891697", "url": "https://glygen.org/publication/PubMed/7891697" } ] }, { "title": "Conserved functional domains of the RNA polymerase III general transcription factor BRF.", "journal": "Genes & development", "date": "1994", "authors": "Khoo B, Brophy B, Jackson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-76061", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-76061" } ], "reference": [ { "type": "PubMed", "id": "7995525", "url": "https://glygen.org/publication/PubMed/7995525" } ] }, { "title": "La proteins from Drosophila melanogaster and Saccharomyces cerevisiae: a yeast homolog of the La autoantigen is dispensable for growth.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Yoo CJ, Wolin SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-73980", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73980" } ], "reference": [ { "type": "PubMed", "id": "8035818", "url": "https://glygen.org/publication/PubMed/8035818" } ] }, { "title": "Analysis of RNA chain elongation and termination by Saccharomyces cerevisiae RNA polymerase III.", "journal": "Journal of molecular biology", "date": "1994", "authors": "Matsuzaki H, Kassavetis GA, Geiduschek EP", "evidence": [ { "database": "Reactome", "id": "R-HSA-73980", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73980" } ], "reference": [ { "type": "PubMed", "id": "8308883", "url": "https://glygen.org/publication/PubMed/8308883" } ] }, { "title": "Interaction between a complex of RNA polymerase III subunits and the 70-kDa component of transcription factor IIIB.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Werner M, Chaussivert N, Willis IM, Sentenac A", "evidence": [ { "database": "Reactome", "id": "R-HSA-76061", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-76061" } ], "reference": [ { "type": "PubMed", "id": "8407894", "url": "https://glygen.org/publication/PubMed/8407894" } ] }, { "title": "Orientation and topography of RNA polymerase III in transcription complexes.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Bartholomew B, Durkovich D, Kassavetis GA, Geiduschek EP", "evidence": [ { "database": "Reactome", "id": "R-HSA-76061", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-76061" } ], "reference": [ { "type": "PubMed", "id": "8423814", "url": "https://glygen.org/publication/PubMed/8423814" } ] }, { "title": "Mouse RNA polymerase I 16-kDa subunit able to associate with 40-kDa subunit is a homolog of yeast AC19 subunit of RNA polymerases I and III.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Yao Y, Yamamoto K, Nishi Y, Nogi Y, Muramatsu M", "evidence": [ { "database": "RefSeq", "id": "NP_057056", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_057056" } ], "reference": [ { "type": "PubMed", "id": "8955128", "url": "https://glygen.org/publication/PubMed/8955128" } ] }, { "title": "Cloning and characterization of SNAP50, a subunit of the snRNA-activating protein complex SNAPc.", "journal": "The EMBO journal", "date": "1996", "authors": "Henry RW, Ma B, Sadowski CL, Kobayashi R, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-76071", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-76071" } ], "reference": [ { "type": "PubMed", "id": "9003788", "url": "https://glygen.org/publication/PubMed/9003788" } ] }, { "title": "Three human RNA polymerase III-specific subunits form a subcomplex with a selective function in specific transcription initiation.", "journal": "Genes & development", "date": "1997", "authors": "Wang Z, Roeder RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-76061", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-76061" } ], "reference": [ { "type": "PubMed", "id": "9171375", "url": "https://glygen.org/publication/PubMed/9171375" } ] }, { "title": "A nucleosome positioned in the distal promoter region activates transcription of the human U6 gene.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Stunkel W, Kober I, Seifart KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-76071", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-76071" } ], "reference": [ { "type": "PubMed", "id": "9234698", "url": "https://glygen.org/publication/PubMed/9234698" } ] }, { "title": "Dual role of the C34 subunit of RNA polymerase III in transcription initiation.", "journal": "The EMBO journal", "date": "1997", "authors": "Brun I, Sentenac A, Werner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-76061", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-76061" } ], "reference": [ { "type": "PubMed", "id": "9312031", "url": "https://glygen.org/publication/PubMed/9312031" } ] }, { "title": "The large subunit of basal transcription factor SNAPc is a Myb domain protein that interacts with Oct-1.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Wong MW, Henry RW, Ma B, Kobayashi R, Klages N, Matthias P, Strubin M, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-76071", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-76071" } ], "reference": [ { "type": "PubMed", "id": "9418884", "url": "https://glygen.org/publication/PubMed/9418884" } ] }, { "title": "Cloning and functional characterization of PTRF, a novel protein which induces dissociation of paused ternary transcription complexes.", "journal": "The EMBO journal", "date": "1998", "authors": "Jansa P, Mason SW, Hoffmann-Rohrer U, Grummt I", "evidence": [ { "database": "Reactome", "id": "R-HSA-73863", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73863" } ], "reference": [ { "type": "PubMed", "id": "9582279", "url": "https://glygen.org/publication/PubMed/9582279" } ] }, { "title": "DNA topoisomerase I and PC4 can interact with human TFIIIC to promote both accurate termination and transcription reinitiation by RNA polymerase III.", "journal": "Molecular cell", "date": "1998", "authors": "Wang Z, Roeder RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-73980", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73980" } ], "reference": [ { "type": "PubMed", "id": "9660958", "url": "https://glygen.org/publication/PubMed/9660958" } ] } ], "pathway": [ { "id": "hsa:51082", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:51082", "resource": "KEGG Pathway" }, { "id": "R-HSA-1834949", "name": "Cytosolic sensors of pathogen-associated DNA", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1834949", "resource": "Reactome", "description": "Cytosolic sensors of pathogen-associated DNA" }, { "id": "R-HSA-427413", "name": "NoRC negatively regulates rRNA expression", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-427413", "resource": "Reactome", "description": "NoRC negatively regulates rRNA expression" }, { "id": "R-HSA-5250924", "name": "B-WICH complex positively regulates rRNA expression", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5250924", "resource": "Reactome", "description": "B-WICH complex positively regulates rRNA expression" }, { "id": "R-HSA-73762", "name": "RNA Polymerase I Transcription Initiation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73762", "resource": "Reactome", "description": "RNA Polymerase I Transcription Initiation" }, { "id": "R-HSA-73772", "name": "RNA Polymerase I Promoter Escape", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73772", "resource": "Reactome", "description": "RNA Polymerase I Promoter Escape" }, { "id": "R-HSA-73780", "name": "RNA Polymerase III Chain Elongation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73780", "resource": "Reactome", "description": "RNA Polymerase III Chain Elongation" }, { "id": "R-HSA-73863", "name": "RNA Polymerase I Transcription Termination", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73863", "resource": "Reactome", "description": "RNA Polymerase I Transcription Termination" }, { "id": "R-HSA-73980", "name": "RNA Polymerase III Transcription Termination", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73980", "resource": "Reactome", "description": "RNA Polymerase III Transcription Termination" }, { "id": "R-HSA-749476", "name": "RNA Polymerase III Abortive And Retractive Initiation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-749476", "resource": "Reactome", "description": "RNA Polymerase III Abortive And Retractive Initiation" }, { "id": "R-HSA-76061", "name": "RNA Polymerase III Transcription Initiation From Type 1 Promoter", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-76061", "resource": "Reactome", "description": "RNA Polymerase III Transcription Initiation From Type 1 Promoter" }, { "id": "R-HSA-76066", "name": "RNA Polymerase III Transcription Initiation From Type 2 Promoter", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-76066", "resource": "Reactome", "description": "RNA Polymerase III Transcription Initiation From Type 2 Promoter" }, { "id": "R-HSA-76071", "name": "RNA Polymerase III Transcription Initiation From Type 3 Promoter", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-76071", "resource": "Reactome", "description": "RNA Polymerase III Transcription Initiation From Type 3 Promoter" } ], "orthologs": [ { "uniprot_canonical_ac": "P97304-1", "protein_name": "DNA-directed RNA polymerases I and III subunit RPAC2", "gene_name": "Polr1d", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MEDDQELERKISGLKTSMAEGERKTALEMVQAAGTDRQCVTFVLHEEDHTLGNCLRYIIMKNPEVEFCGYTTTHPSESKINLRIQTRGALPAVEPFQKGLNELLNVCQHVLVKFEASIKDYKAKKASKKEPTF", "length": 133 }, "evidence": [ { "id": "45930776", "url": "http://www.informatics.jax.org/homology/45930776", "database": "MGI" }, { "id": "P0DPB6", "url": "https://omabrowser.org/oma/group/P0DPB6/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P0DPB6", "url": "https://www.uniprot.org/uniprot/P0DPB6" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P0DPB6", "url": "https://www.uniprot.org/uniprot/P0DPB6" } ], "pmid": "" }, { "name": "RNA polymerase I complex", "id": "GO:0005736", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005736", "evidence": [ { "database": "UniProtKB", "id": "P0DPB6", "url": "https://www.uniprot.org/uniprot/P0DPB6" } ], "pmid": "" }, { "name": "RNA polymerase III complex", "id": "GO:0005666", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005666", "evidence": [ { "database": "UniProtKB", "id": "P0DPB6", "url": "https://www.uniprot.org/uniprot/P0DPB6" } ], "pmid": "" }, { "name": "DNA-directed RNA polymerase complex", "id": "GO:0000428", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000428", "evidence": [ { "database": "UniProtKB", "id": "P0DPB6", "url": "https://www.uniprot.org/uniprot/P0DPB6" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "transcription by RNA polymerase I", "id": "GO:0006360", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006360", "evidence": [ { "database": "UniProtKB", "id": "P0DPB6", "url": "https://www.uniprot.org/uniprot/P0DPB6" } ], "pmid": "" }, { "name": "transcription by RNA polymerase III", "id": "GO:0006383", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006383", "evidence": [ { "database": "UniProtKB", "id": "P0DPB6", "url": "https://www.uniprot.org/uniprot/P0DPB6" } ], "pmid": "" }, { "name": "DNA-templated transcription", "id": "GO:0006351", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006351", "evidence": [ { "database": "UniProtKB", "id": "P0DPB6", "url": "https://www.uniprot.org/uniprot/P0DPB6" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "P0DPB6", "url": "https://www.uniprot.org/uniprot/P0DPB6" } ], "pmid": "" }, { "name": "protein dimerization activity", "id": "GO:0046983", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046983", "evidence": [ { "database": "UniProtKB", "id": "P0DPB6", "url": "https://www.uniprot.org/uniprot/P0DPB6" } ], "pmid": "" }, { "name": "DNA-directed 5'-3' RNA polymerase activity", "id": "GO:0003899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003899", "evidence": [ { "database": "UniProtKB", "id": "P0DPB6", "url": "https://www.uniprot.org/uniprot/P0DPB6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 129, "end_pos": 131, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 25, 35 ], "sequon_annotation_sites": [ { "start_pos": 129, "end_pos": 131 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }