{
    "uniprot_canonical_ac": "P0DP74-1",
    "uniprot_ac": "P0DP74",
    "uniprot_id": "D130A_HUMAN",
    "mass": {
        "chemical_mass": 8736.0,
        "monoisotopic_mass": 8736.0
    },
    "refseq": {
        "ac": "NP_001032893",
        "name": "beta-defensin 130A precursor",
        "summary": "Defensins are cysteine-rich cationic polypeptides that are important in the immunologic response to invading microorganisms. The antimicrobial protein encoded by this gene is secreted and is a member of the beta defensin protein family. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 8p23. [provided by RefSeq, Nov 2014].",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032893"
    },
    "gene_names": [
        {
            "name": "DEFB130A",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/P0DP74",
            "id": "P0DP74"
        },
        {
            "name": "DEFB-30; DEFB130; DEFB130L; DEFB30",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032893",
            "id": "NP_001032893"
        },
        {
            "name": "DEFB130A",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032893",
            "id": "NP_001032893"
        },
        {
            "name": "DEFB130",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/P0DP74",
            "id": "P0DP74"
        },
        {
            "name": "DEFB30",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/P0DP74",
            "id": "P0DP74"
        }
    ],
    "protein_names": [
        {
            "name": "Beta-defensin 130A",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "P0DP74"
        },
        {
            "name": "Beta-defensin 130",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P0DP74"
        },
        {
            "name": "Beta-defensin 30",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P0DP74"
        },
        {
            "name": "DEFB-30",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P0DP74"
        },
        {
            "name": "Defensin, beta 130",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P0DP74"
        },
        {
            "name": "beta-defensin 130A precursor",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032893",
            "id": "NP_001032893"
        },
        {
            "name": "defensin, beta 30; beta-defensin 130; beta-defensin 30; defensin beta 130; beta-defensin 130A",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032893",
            "id": "NP_001032893"
        }
    ],
    "function": [
        {
            "annotation": "Antimicrobial host-defense peptide. Has an antiplasmodial activity.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P0DP74",
                    "url": "https://www.uniprot.org/uniprot/P0DP74#function"
                },
                {
                    "database": "PubMed",
                    "id": "28181499",
                    "url": "https://glygen.org/publication/PubMed/28181499"
                }
            ]
        },
        {
            "annotation": "Defensins are cysteine-rich cationic polypeptides that are important in the immunologic response to invading microorganisms. The antimicrobial protein encoded by this gene is secreted and is a member of the beta defensin protein family. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 8p23. [provided by RefSeq, Nov 2014].",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001032893",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032893"
                }
            ]
        },
        {
            "annotation": "The protein encoded by this gene is thought to display antimicrobial activity.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001032893",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032893"
                },
                {
                    "database": "PubMed",
                    "id": "16033865",
                    "url": "https://glygen.org/publication/PubMed/16033865"
                }
            ]
        },
        {
            "annotation": "These results suggest that DEFB130 might be one of the macrophage effector molecules for eliminating malarial parasites. Our data broaden our knowledge of the immunological response of macrophages to iRBCs and shed light on a new target for therapeutic intervention. Publication Status: Online-Only",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001032893",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032893"
                },
                {
                    "database": "PubMed",
                    "id": "28181499",
                    "url": "https://glygen.org/publication/PubMed/28181499"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Homo sapiens",
            "taxid": 9606,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P0DP74",
                    "url": "https://www.uniprot.org/uniprot/P0DP74"
                }
            ],
            "common_name": "Human"
        }
    ],
    "gene": [
        {
            "name": "DEFB130A",
            "url": "https://www.uniprot.org/uniprot/P0DP74",
            "locus": {
                "chromosome": "8",
                "start_pos": 12310962,
                "end_pos": 12318316,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSG00000232948",
                        "url": "https://www.ensembl.org/id/ENSG00000232948"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSG00000232948",
            "url": "https://bgee.org/?page=gene&gene_id=ENSG00000232948",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "DEFB130A",
            "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=DEFB130A",
            "database": "GeneCards",
            "categories": [
                "Gene Annotation",
                "Organism-specific"
            ]
        },
        {
            "id": "100133267",
            "url": "https://www.ncbi.nlm.nih.gov/gene/100133267",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "245940",
            "url": "https://www.ncbi.nlm.nih.gov/gene/245940",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "18107",
            "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=18107",
            "database": "HGNC",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "IPR001855",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001855",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "hsa:100133267",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:100133267",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "hsa:245940",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:245940",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "NX_P0DP74",
            "url": "https://www.nextprot.org/entry/NX_P0DP74",
            "database": "neXtProt",
            "categories": [
                "Protein",
                "Organism-specific"
            ]
        },
        {
            "id": "KCCRIWW",
            "url": "https://omabrowser.org/oma/group/KCCRIWW/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "4640037at2759",
            "url": "http://www.orthodb.org/?query=4640037at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR20515",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR20515",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR20515:SF1",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR20515:SF1",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF00711",
            "url": "http://pfam.xfam.org/family/PF00711",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "P0DP74",
            "url": "https://pharos.nih.gov/targets/P0DP74",
            "database": "PHAROS",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "PR_P0DP74",
            "url": "http://purl.obolibrary.org/obo/PR_P0DP74",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "R-HSA-1461957",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-1461973",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461973",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_001032893",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032893",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P0DP74",
            "url": "https://www.uniprot.org/uniprot/P0DP74",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P0DP74-1",
            "url": "https://www.uniprot.org/uniprot/P0DP74-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MKLHSLISVLLLFVTLIPKGKTGVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP",
        "length": 79,
        "header": "sp|P0DP74-1|D130A_HUMAN Isoform 1 of Beta-defensin 130A  OS=Homo sapiens OX=9606 GN=DEFB130A PE=2 SV=1 CANONICAL=P0DP74-1"
    },
    "isoforms": [
        {
            "isoform_ac": "P0DP74-1",
            "url": "",
            "sequence": {
                "sequence": "MKLHSLISVLLLFVTLIPKGKTGVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP",
                "length": 79,
                "header": "sp|P0DP74-1|D130A_HUMAN Isoform 1 of Beta-defensin 130A  OS=Homo sapiens OX=9606 GN=DEFB130A PE=2 SV=1 CANONICAL=P0DP74-1"
            },
            "locus": {
                "chromosome": "HG76_PATCH",
                "start_pos": 1277536,
                "end_pos": 1270186,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000646760.1",
                        "url": "https://www.ensembl.org/id/ENST00000646760.1"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000495606.1",
                        "url": "https://www.ensembl.org/id/ENSP00000495606.1"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Beta-defensins: linking innate and adaptive immunity through dendritic and T cell CCR6.",
            "journal": "Science (New York, N.Y.)",
            "date": "1999",
            "authors": "Yang D, Chertov O, Bykovskaia SN, Chen Q, Buffo MJ, Shogan J, Anderson M, Schroder JM, Wang JM, Howard OM, Oppenheim JJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1461957",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10521347",
                    "url": "https://glygen.org/publication/PubMed/10521347"
                }
            ]
        },
        {
            "title": "Human neutrophil defensins selectively chemoattract naive T and immature dendritic cells.",
            "journal": "Journal of leukocyte biology",
            "date": "2000",
            "authors": "Yang D, Chen Q, Chertov O, Oppenheim JJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1461957",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10914484",
                    "url": "https://glygen.org/publication/PubMed/10914484"
                }
            ]
        },
        {
            "title": "Isolation and characterization of human beta -defensin-3, a novel human inducible peptide antibiotic.",
            "journal": "The Journal of biological chemistry",
            "date": "2001",
            "authors": "Harder J, Bartels J, Christophers E, Schroder JM",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1461957",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11085990",
                    "url": "https://glygen.org/publication/PubMed/11085990"
                }
            ]
        },
        {
            "title": "Identification of a novel, multifunctional beta-defensin (human beta-defensin 3) with specific antimicrobial activity. Its interaction with plasma membranes of Xenopus oocytes and the induction of macrophage chemoattraction.",
            "journal": "Cell and tissue research",
            "date": "2001",
            "authors": "Garcia JR, Jaumann F, Schulz S, Krause A, Rodriguez-Jimenez J, Forssmann U, Adermann K, Kluver E, Vogelmeier C, Becker D, Hedrich R, Forssmann WG, Bals R",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1461957",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11702237",
                    "url": "https://glygen.org/publication/PubMed/11702237"
                }
            ]
        },
        {
            "title": "Epithelial cell-derived human beta-defensin-2 acts as a chemotaxin for mast cells through a pertussis toxin-sensitive and phospholipase C-dependent pathway.",
            "journal": "International immunology",
            "date": "2002",
            "authors": "Niyonsaba F, Iwabuchi K, Matsuda H, Ogawa H, Nagaoka I",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1461957",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11934878",
                    "url": "https://glygen.org/publication/PubMed/11934878"
                }
            ]
        },
        {
            "title": "Defensins: antimicrobial peptides of innate immunity.",
            "journal": "Nature reviews. Immunology",
            "date": "2003",
            "authors": "Ganz T",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1461973",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461973"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12949495",
                    "url": "https://glygen.org/publication/PubMed/12949495"
                }
            ]
        },
        {
            "title": "Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.",
            "journal": "Physiol. Genomics",
            "date": "2005",
            "authors": "Patil AA, Cai Y, Sang Y, Blecha F, Zhang G",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P0DP74",
                    "url": "https://www.uniprot.org/uniprot/P0DP74"
                },
                {
                    "database": "RefSeq",
                    "id": "NP_001032893",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032893"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16033865",
                    "url": "https://glygen.org/publication/PubMed/16033865"
                }
            ]
        },
        {
            "title": "Human -defensin-3 activates professional antigen-presenting cells via Toll-like receptors 1 and 2.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "2007",
            "authors": "Funderburg N, Lederman MM, Feng Z, Drage MG, Jadlowsky J, Harding CV, Weinberg A, Sieg SF",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1461957",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18006661",
                    "url": "https://glygen.org/publication/PubMed/18006661"
                }
            ]
        },
        {
            "title": "Functional interaction of human neutrophil peptide-1 with the cell wall precursor lipid II.",
            "journal": "FEBS letters",
            "date": "2010",
            "authors": "de Leeuw E, Li C, Zeng P, Li C, Diepeveen-de Buin M, Lu WY, Breukink E, Lu W",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1461973",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461973"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20214904",
                    "url": "https://glygen.org/publication/PubMed/20214904"
                }
            ]
        },
        {
            "title": "Human beta-defensin 3 inhibits cell wall biosynthesis in Staphylococci.",
            "journal": "Infection and immunity",
            "date": "2010",
            "authors": "Sass V, Schneider T, Wilmes M, Korner C, Tossi A, Novikova N, Shamova O, Sahl HG",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1461973",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461973"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20385753",
                    "url": "https://glygen.org/publication/PubMed/20385753"
                }
            ]
        },
        {
            "title": "Human beta-defensin 2 and 3 and their mouse orthologs induce chemotaxis through interaction with CCR2.",
            "journal": "Journal of immunology (Baltimore, Md. : 1950)",
            "date": "2010",
            "authors": "Rohrl J, Yang D, Oppenheim JJ, Hehlgans T",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1461957",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20483750",
                    "url": "https://glygen.org/publication/PubMed/20483750"
                }
            ]
        },
        {
            "title": "Tissue-specific human beta-defensins (HBD)1, HBD2, and HBD3 secretion from human extra-placental membranes stimulated with Escherichia coli.",
            "journal": "Reproductive biology and endocrinology : RB&E",
            "date": "2010",
            "authors": "Garcia-Lopez G, Flores-Espinosa P, Zaga-Clavellina V",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1461957",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21122132",
                    "url": "https://glygen.org/publication/PubMed/21122132"
                }
            ]
        },
        {
            "title": "Involvement of beta-defensin 130 (DEFB130) in the macrophage microbicidal mechanisms for killing Plasmodium falciparum.",
            "journal": "Scientific reports",
            "date": "2017",
            "authors": "Terkawi MA, Takano R, Furukawa A, Murakoshi F, Kato K",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P0DP74",
                    "url": "https://www.uniprot.org/uniprot/P0DP74"
                },
                {
                    "database": "RefSeq",
                    "id": "NP_001032893",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032893"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "28181499",
                    "url": "https://glygen.org/publication/PubMed/28181499"
                }
            ]
        },
        {
            "title": "Human beta-defensin-1: an antimicrobial peptide of urogenital tissues.",
            "journal": "The Journal of clinical investigation",
            "date": "1998",
            "authors": "Valore EV, Park CH, Quayle AJ, Wiles KR, McCray PB Jr, Ganz T",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1461957",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9541493",
                    "url": "https://glygen.org/publication/PubMed/9541493"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "hsa:100133267",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:100133267",
            "resource": "KEGG Pathway"
        },
        {
            "id": "hsa:245940",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:245940",
            "resource": "KEGG Pathway"
        },
        {
            "id": "R-HSA-1461957",
            "name": "Beta defensins",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957",
            "resource": "Reactome",
            "description": "Beta defensins"
        },
        {
            "id": "R-HSA-1461973",
            "name": "Defensins",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461973",
            "resource": "Reactome",
            "description": "Defensins"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "Q30KN1-1",
            "protein_name": "Defensin beta 47",
            "gene_name": "Defb47",
            "tax_id": 10090,
            "organism": "Mus musculus",
            "sequence": {
                "sequence": "MRSRSFLPVLFLFVMMMLRGKAGLVPGEKQCISLKGICKDLACTSSDDTIGVCNDVKKCCRKWWVFEPYPTPVPKGKSP",
                "length": 79
            },
            "evidence": [
                {
                    "id": "45933572",
                    "url": "http://www.informatics.jax.org/homology/45933572",
                    "database": "MGI"
                }
            ],
            "common_name": "Mouse"
        },
        {
            "uniprot_canonical_ac": "Q32ZF5-1",
            "protein_name": "Defensin beta 41",
            "gene_name": "Defb41",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MRSHSFLSALFLLVMMMPRGKAGVVPGEKQCILLKGVCKDVSCTSTDDTIGVCNDEKKCCRRWWVFDPYPTPVPKGKSP",
                "length": 79
            },
            "evidence": [
                {
                    "id": "45933572",
                    "url": "http://www.informatics.jax.org/homology/45933572",
                    "database": "MGI"
                }
            ],
            "common_name": "Rat"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 1,
                "go_terms": [
                    {
                        "name": "extracellular space",
                        "id": "GO:0005615",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P0DP74",
                                "url": "https://www.uniprot.org/uniprot/P0DP74"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 2,
                "go_terms": [
                    {
                        "name": "chemoattractant activity",
                        "id": "GO:0042056",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042056",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P0DP74",
                                "url": "https://www.uniprot.org/uniprot/P0DP74"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "CCR6 chemokine receptor binding",
                        "id": "GO:0031731",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031731",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P0DP74",
                                "url": "https://www.uniprot.org/uniprot/P0DP74"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 2,
                "go_terms": [
                    {
                        "name": "cell chemotaxis",
                        "id": "GO:0060326",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060326",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P0DP74",
                                "url": "https://www.uniprot.org/uniprot/P0DP74"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "defense response to bacterium",
                        "id": "GO:0042742",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042742",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P0DP74",
                                "url": "https://www.uniprot.org/uniprot/P0DP74"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        }
    ],
    "sequence_features": {
        "n_linked_sites": [],
        "o_linked_sites": [],
        "snv_sites": [],
        "glycation_sites": [],
        "phosphorylation_sites": [],
        "sequon_annotation_sites": []
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 14
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}