{ "uniprot_canonical_ac": "P0DP73-1", "uniprot_ac": "P0DP73", "uniprot_id": "D130B_HUMAN", "mass": { "chemical_mass": 8736.0, "monoisotopic_mass": 8736.0 }, "refseq": { "ac": "NP_001032893", "name": "beta-defensin 130A precursor", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032893" }, "gene_names": [ { "name": "DEFB130B", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P0DP73", "id": "P0DP73" } ], "protein_names": [ { "name": "Beta-defensin 130B", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P0DP73" }, { "name": "beta-defensin 130A precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032893", "id": "NP_001032893" }, { "name": "defensin, beta 30; beta-defensin 130; beta-defensin 30; defensin beta 130; beta-defensin 130A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032893", "id": "NP_001032893" } ], "function": [ { "annotation": "Antimicrobial host-defense peptide. Has an antiplasmodial activity.", "evidence": [ { "database": "UniProtKB", "id": "P0DP73", "url": "https://www.uniprot.org/uniprot/P0DP73#function" }, { "database": "PubMed", "id": "28181499", "url": "https://glygen.org/publication/PubMed/28181499" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DP73", "url": "https://www.uniprot.org/uniprot/P0DP73" } ], "common_name": "Human" } ], "gene": [ { "name": "DEFB130B", "url": "https://www.uniprot.org/uniprot/P0DP73", "locus": { "chromosome": "8", "start_pos": 12064389, "end_pos": 12071747, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000233050", "url": "https://www.ensembl.org/id/ENSG00000233050" } ] } } ], "crossref": [ { "id": "ENSG00000233050", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000233050", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "DEFB130B", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=DEFB130B", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "100133267", "url": "https://www.ncbi.nlm.nih.gov/gene/100133267", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "245940", "url": "https://www.ncbi.nlm.nih.gov/gene/245940", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "39814", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=39814", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR001855", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001855", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:100133267", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:100133267", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "hsa:245940", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:245940", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NX_P0DP73", "url": "https://www.nextprot.org/entry/NX_P0DP73", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P0DP73", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P0DP73", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "TIGVCND", "url": "https://omabrowser.org/oma/group/TIGVCND/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4640037at2759", "url": "http://www.orthodb.org/?query=4640037at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR20515", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR20515", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR20515:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR20515:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00711", "url": "http://pfam.xfam.org/family/PF00711", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P0DP73", "url": "https://pharos.nih.gov/targets/P0DP73", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P0DP73", "url": "http://purl.obolibrary.org/obo/PR_P0DP73", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1461957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1461973", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461973", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001032893", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032893", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P0DP73", "url": "https://www.uniprot.org/uniprot/P0DP73", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0DP73-1", "url": "https://www.uniprot.org/uniprot/P0DP73-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKLHSLISVLLLFVTLIPKGKTGVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP", "length": 79, "header": "sp|P0DP73-1|D130B_HUMAN Isoform 1 of Beta-defensin 130B OS=Homo sapiens OX=9606 GN=DEFB130B PE=2 SV=1 CANONICAL=P0DP73-1" }, "isoforms": [ { "isoform_ac": "P0DP73-1", "url": "", "sequence": { "sequence": "MKLHSLISVLLLFVTLIPKGKTGVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP", "length": 79, "header": "sp|P0DP73-1|D130B_HUMAN Isoform 1 of Beta-defensin 130B OS=Homo sapiens OX=9606 GN=DEFB130B PE=2 SV=1 CANONICAL=P0DP73-1" }, "locus": { "chromosome": "8", "start_pos": 12071747, "end_pos": 12064392, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000437818.1", "url": "https://www.ensembl.org/id/ENST00000437818.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000392568.1", "url": "https://www.ensembl.org/id/ENSP00000392568.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P0DP73", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P0DP73" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Beta-defensins: linking innate and adaptive immunity through dendritic and T cell CCR6.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Yang D, Chertov O, Bykovskaia SN, Chen Q, Buffo MJ, Shogan J, Anderson M, Schroder JM, Wang JM, Howard OM, Oppenheim JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1461957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957" } ], "reference": [ { "type": "PubMed", "id": "10521347", "url": "https://glygen.org/publication/PubMed/10521347" } ] }, { "title": "Human neutrophil defensins selectively chemoattract naive T and immature dendritic cells.", "journal": "Journal of leukocyte biology", "date": "2000", "authors": "Yang D, Chen Q, Chertov O, Oppenheim JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1461957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957" } ], "reference": [ { "type": "PubMed", "id": "10914484", "url": "https://glygen.org/publication/PubMed/10914484" } ] }, { "title": "Isolation and characterization of human beta -defensin-3, a novel human inducible peptide antibiotic.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Harder J, Bartels J, Christophers E, Schroder JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1461957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957" } ], "reference": [ { "type": "PubMed", "id": "11085990", "url": "https://glygen.org/publication/PubMed/11085990" } ] }, { "title": "Identification of a novel, multifunctional beta-defensin (human beta-defensin 3) with specific antimicrobial activity. Its interaction with plasma membranes of Xenopus oocytes and the induction of macrophage chemoattraction.", "journal": "Cell and tissue research", "date": "2001", "authors": "Garcia JR, Jaumann F, Schulz S, Krause A, Rodriguez-Jimenez J, Forssmann U, Adermann K, Kluver E, Vogelmeier C, Becker D, Hedrich R, Forssmann WG, Bals R", "evidence": [ { "database": "Reactome", "id": "R-HSA-1461957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957" } ], "reference": [ { "type": "PubMed", "id": "11702237", "url": "https://glygen.org/publication/PubMed/11702237" } ] }, { "title": "Epithelial cell-derived human beta-defensin-2 acts as a chemotaxin for mast cells through a pertussis toxin-sensitive and phospholipase C-dependent pathway.", "journal": "International immunology", "date": "2002", "authors": "Niyonsaba F, Iwabuchi K, Matsuda H, Ogawa H, Nagaoka I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1461957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957" } ], "reference": [ { "type": "PubMed", "id": "11934878", "url": "https://glygen.org/publication/PubMed/11934878" } ] }, { "title": "Defensins: antimicrobial peptides of innate immunity.", "journal": "Nature reviews. Immunology", "date": "2003", "authors": "Ganz T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1461973", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461973" } ], "reference": [ { "type": "PubMed", "id": "12949495", "url": "https://glygen.org/publication/PubMed/12949495" } ] }, { "title": "Human -defensin-3 activates professional antigen-presenting cells via Toll-like receptors 1 and 2.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Funderburg N, Lederman MM, Feng Z, Drage MG, Jadlowsky J, Harding CV, Weinberg A, Sieg SF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1461957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957" } ], "reference": [ { "type": "PubMed", "id": "18006661", "url": "https://glygen.org/publication/PubMed/18006661" } ] }, { "title": "Functional interaction of human neutrophil peptide-1 with the cell wall precursor lipid II.", "journal": "FEBS letters", "date": "2010", "authors": "de Leeuw E, Li C, Zeng P, Li C, Diepeveen-de Buin M, Lu WY, Breukink E, Lu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-1461973", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461973" } ], "reference": [ { "type": "PubMed", "id": "20214904", "url": "https://glygen.org/publication/PubMed/20214904" } ] }, { "title": "Human beta-defensin 3 inhibits cell wall biosynthesis in Staphylococci.", "journal": "Infection and immunity", "date": "2010", "authors": "Sass V, Schneider T, Wilmes M, Korner C, Tossi A, Novikova N, Shamova O, Sahl HG", "evidence": [ { "database": "Reactome", "id": "R-HSA-1461973", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461973" } ], "reference": [ { "type": "PubMed", "id": "20385753", "url": "https://glygen.org/publication/PubMed/20385753" } ] }, { "title": "Human beta-defensin 2 and 3 and their mouse orthologs induce chemotaxis through interaction with CCR2.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2010", "authors": "Rohrl J, Yang D, Oppenheim JJ, Hehlgans T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1461957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957" } ], "reference": [ { "type": "PubMed", "id": "20483750", "url": "https://glygen.org/publication/PubMed/20483750" } ] }, { "title": "Tissue-specific human beta-defensins (HBD)1, HBD2, and HBD3 secretion from human extra-placental membranes stimulated with Escherichia coli.", "journal": "Reproductive biology and endocrinology : RB&E", "date": "2010", "authors": "Garcia-Lopez G, Flores-Espinosa P, Zaga-Clavellina V", "evidence": [ { "database": "Reactome", "id": "R-HSA-1461957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957" } ], "reference": [ { "type": "PubMed", "id": "21122132", "url": "https://glygen.org/publication/PubMed/21122132" } ] }, { "title": "Involvement of beta-defensin 130 (DEFB130) in the macrophage microbicidal mechanisms for killing Plasmodium falciparum.", "journal": "Scientific reports", "date": "2017", "authors": "Terkawi MA, Takano R, Furukawa A, Murakoshi F, Kato K", "evidence": [ { "database": "UniProtKB", "id": "P0DP73", "url": "https://www.uniprot.org/uniprot/P0DP73" } ], "reference": [ { "type": "PubMed", "id": "28181499", "url": "https://glygen.org/publication/PubMed/28181499" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "P0DP73", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P0DP73" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "Human beta-defensin-1: an antimicrobial peptide of urogenital tissues.", "journal": "The Journal of clinical investigation", "date": "1998", "authors": "Valore EV, Park CH, Quayle AJ, Wiles KR, McCray PB Jr, Ganz T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1461957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957" } ], "reference": [ { "type": "PubMed", "id": "9541493", "url": "https://glygen.org/publication/PubMed/9541493" } ] } ], "pathway": [ { "id": "hsa:100133267", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:100133267", "resource": "KEGG Pathway" }, { "id": "hsa:245940", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:245940", "resource": "KEGG Pathway" }, { "id": "R-HSA-1461957", "name": "Beta defensins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461957", "resource": "Reactome", "description": "Beta defensins" }, { "id": "R-HSA-1461973", "name": "Defensins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1461973", "resource": "Reactome", "description": "Defensins" } ], "orthologs": [ { "uniprot_canonical_ac": "Q30KN1-1", "protein_name": "Defensin beta 47", "gene_name": "Defb47", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRSRSFLPVLFLFVMMMLRGKAGLVPGEKQCISLKGICKDLACTSSDDTIGVCNDVKKCCRKWWVFEPYPTPVPKGKSP", "length": 79 }, "evidence": [ { "id": "P0DP73", "url": "https://omabrowser.org/oma/group/P0DP73/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q32ZF5-1", "protein_name": "Defensin beta 41", "gene_name": "Defb41", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MRSHSFLSALFLLVMMMPRGKAGVVPGEKQCILLKGVCKDVSCTSTDDTIGVCNDEKKCCRRWWVFDPYPTPVPKGKSP", "length": 79 }, "evidence": [ { "id": "P0DP73", "url": "https://omabrowser.org/oma/group/P0DP73/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P0DP73", "url": "https://www.uniprot.org/uniprot/P0DP73" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "chemoattractant activity", "id": "GO:0042056", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042056", "evidence": [ { "database": "UniProtKB", "id": "P0DP73", "url": "https://www.uniprot.org/uniprot/P0DP73" } ], "pmid": "" }, { "name": "CCR6 chemokine receptor binding", "id": "GO:0031731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031731", "evidence": [ { "database": "UniProtKB", "id": "P0DP73", "url": "https://www.uniprot.org/uniprot/P0DP73" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "cell chemotaxis", "id": "GO:0060326", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060326", "evidence": [ { "database": "UniProtKB", "id": "P0DP73", "url": "https://www.uniprot.org/uniprot/P0DP73" } ], "pmid": "" }, { "name": "defense response to bacterium", "id": "GO:0042742", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042742", "evidence": [ { "database": "UniProtKB", "id": "P0DP73", "url": "https://www.uniprot.org/uniprot/P0DP73" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }