{ "uniprot_canonical_ac": "P0DP57-1", "uniprot_ac": "P0DP57", "uniprot_id": "SLUR2_HUMAN", "mass": { "chemical_mass": 10160.0, "monoisotopic_mass": 10160.0 }, "refseq": { "ac": "NP_803253", "name": "secreted Ly-6/uPAR domain-containing protein 2 isoform 1 precursor", "summary": "This gene encodes a novel, secreted member of the Ly6/uPAR (LU) superfamily of proteins containing the unique three-finger LU domain. This gene is mainly expressed in epithelial cells, including skin and keratinocytes, and is up-regulated in psoriatic skin lesions, suggesting its involvement in the pathophysiology of psoriasis. Alternatively spliced transcript variants have been found for this gene. Read-through transcription from the neighboring upstream gene (LYNX1) generates naturally-occurring transcripts (LYNX1-SLURP2) that encode a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq, Sep 2017].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_803253" }, "gene_names": [ { "name": "SLURP2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P0DP57", "id": "P0DP57" }, { "name": "SLURP-2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_803253", "id": "NP_803253" }, { "name": "SLURP2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_803253", "id": "NP_803253" } ], "protein_names": [ { "name": "Secreted Ly-6/uPAR domain-containing protein 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P0DP57" }, { "name": "SLURP-2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DP57" }, { "name": "Secreted LY6/PLAUR domain-containing protein 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DP57" }, { "name": "Secreted Ly-6/uPAR-related protein 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DP57" }, { "name": "secreted Ly-6/uPAR domain-containing protein 2 isoform 1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_803253", "id": "NP_803253" }, { "name": "secreted Ly6/uPAR related protein 2; secreted Ly-6/uPAR-related protein 2; secreted LY6/PLAUR domain-containing protein 2; secreted Ly-6/uPAR domain-containing protein 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_803253", "id": "NP_803253" } ], "function": [ { "annotation": "Binds and may modulate the functional properties of nicotinic and muscarinic acetylcholine receptors. May regulate keratinocytes proliferation, differentiation and apoptosis. In vitro moderately inhibits ACh-evoked currents of alpha-3:beta-2-containing nAChRs and strongly these of alpha-4:beta-2-containing nAChRs, modulates alpha-7-containing nAChRs, and inhibits nicotine-induced signaling probably implicating alpha-3:beta-4-containing nAChRs. Proposed to act on alpha-3:beta-2 and alpha-7 nAChRs in an orthosteric, and on mAChRs, such as CHRM1 and CHRM3, in an allosteric manner.", "evidence": [ { "database": "UniProtKB", "id": "P0DP57", "url": "https://www.uniprot.org/uniprot/P0DP57#function" }, { "database": "PubMed", "id": "16575903", "url": "https://glygen.org/publication/PubMed/16575903" }, { "database": "PubMed", "id": "27485575", "url": "https://glygen.org/publication/PubMed/27485575" } ] }, { "annotation": "Computer modeling revealed possible SLURP-2 binding to the 'classical' orthosteric agonist/antagonist binding sites at alpha7 and alpha3beta2-nAChRs. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_803253", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_803253" }, { "database": "PubMed", "id": "27485575", "url": "https://glygen.org/publication/PubMed/27485575" } ] }, { "annotation": "SLURPs inhibit growth of epithelial cancer cells in vitro and merit further investigation as potential agents for anticancer therapy", "evidence": [ { "database": "RefSeq", "id": "NP_803253", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_803253" }, { "database": "PubMed", "id": "29505672", "url": "https://glygen.org/publication/PubMed/29505672" } ] }, { "annotation": "This gene encodes a novel, secreted member of the Ly6/uPAR (LU) superfamily of proteins containing the unique three-finger LU domain. This gene is mainly expressed in epithelial cells, including skin and keratinocytes, and is up-regulated in psoriatic skin lesions, suggesting its involvement in the pathophysiology of psoriasis. Alternatively spliced transcript variants have been found for this gene. Read-through transcription from the neighboring upstream gene (LYNX1) generates naturally-occurring transcripts (LYNX1-SLURP2) that encode a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq, Sep 2017].", "evidence": [ { "database": "RefSeq", "id": "NP_803253", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_803253" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DP57", "url": "https://www.uniprot.org/uniprot/P0DP57" } ], "common_name": "Human" } ], "gene": [ { "name": "SLURP2", "url": "https://www.uniprot.org/uniprot/P0DP57", "locus": { "chromosome": "8", "start_pos": 142764338, "end_pos": 142769828, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000283992", "url": "https://www.ensembl.org/id/ENSG00000283992" } ] } } ], "crossref": [ { "id": "ENSG00000283992", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000283992", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00117", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00117", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "SLURP2", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=SLURP2", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "432355", "url": "https://www.ncbi.nlm.nih.gov/gene/432355", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "25549", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=25549", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P0DP57", "url": "https://www.ebi.ac.uk/intact/interactors/id:P0DP57*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR016054", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016054", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045860", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045860", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:432355", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:432355", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "606110", "url": "http://www.omim.org/entry/606110", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P0DP57", "url": "https://www.nextprot.org/entry/NX_P0DP57", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "CHQCQGF", "url": "https://omabrowser.org/oma/group/CHQCQGF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4629495at2759", "url": "http://www.orthodb.org/?query=4629495at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR16983", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16983", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR16983:SF14", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16983:SF14", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2N99", "url": "https://www.rcsb.org/structure/2N99", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00021", "url": "http://pfam.xfam.org/family/PF00021", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P0DP57", "url": "https://pharos.nih.gov/targets/P0DP57", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P0DP57", "url": "http://purl.obolibrary.org/obo/PR_P0DP57", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_803253", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_803253", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "H0YB12", "url": "https://www.uniprot.org/uniprot/H0YB12", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YB12-1", "url": "https://www.uniprot.org/uniprot/H0YB12-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0DP57", "url": "https://www.uniprot.org/uniprot/P0DP57", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0DP57-1", "url": "https://www.uniprot.org/uniprot/P0DP57-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MQLGTGLLLAAVLSLQLAAAEAIWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD", "length": 97, "header": "sp|P0DP57-1|SLUR2_HUMAN Isoform 1 of Secreted Ly-6/uPAR domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SLURP2 PE=1 SV=1 CANONICAL=P0DP57-1" }, "isoforms": [ { "isoform_ac": "H0YB12-1", "url": "", "sequence": { "sequence": "LLAAVLSLQLAAAEAIWCHQCTGFGGCSHGSRCLRDSTHCVTTATRPRTLSPHSPHSLAPGLTAAPPSRLASPPLPASAATVQHRLS", "length": 87, "header": "tr|H0YB12-1|SLUR2_HUMAN Computationally mapped isoform of Secreted Ly-6/uPAR domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SLURP2 PE=1 SV=1 CANONICAL=P0DP57-1" }, "locus": { "chromosome": "8", "start_pos": 142769785, "end_pos": 142764463, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000521396.1", "url": "https://www.ensembl.org/id/ENST00000521396.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000428465.1", "url": "https://www.ensembl.org/id/ENSP00000428465.1" } ] } }, { "isoform_ac": "P0DP57-1", "url": "", "sequence": { "sequence": "MQLGTGLLLAAVLSLQLAAAEAIWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD", "length": 97, "header": "sp|P0DP57-1|SLUR2_HUMAN Isoform 1 of Secreted Ly-6/uPAR domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SLURP2 PE=1 SV=1 CANONICAL=P0DP57-1" }, "locus": { "chromosome": "8", "start_pos": 142769806, "end_pos": 142764608, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000317543.12", "url": "https://www.ensembl.org/id/ENST00000317543.12" }, { "database": "Ensembl Peptide", "id": "ENSP00000319846.7", "url": "https://www.ensembl.org/id/ENSP00000319846.7" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "SLURP-2, a novel member of the human Ly-6 superfamily that is up-regulated in psoriasis vulgaris.", "journal": "Genomics", "date": "2003", "authors": "Tsuji H, Okamoto K, Matsuzaka Y, Iizuka H, Tamiya G, Inoko H", "evidence": [ { "database": "UniProtKB", "id": "P0DP57", "url": "https://www.uniprot.org/uniprot/P0DP57" } ], "reference": [ { "type": "PubMed", "id": "12573258", "url": "https://glygen.org/publication/PubMed/12573258" } ] }, { "title": "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.", "journal": "Genome Res.", "date": "2003", "authors": "Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A", "evidence": [ { "database": "UniProtKB", "id": "P0DP57", "url": "https://www.uniprot.org/uniprot/P0DP57" } ], "reference": [ { "type": "PubMed", "id": "12975309", "url": "https://glygen.org/publication/PubMed/12975309" } ] }, { "title": "SLURP-2: A novel cholinergic signaling peptide in human mucocutaneous epithelium.", "journal": "Journal of cellular physiology", "date": "2006-07", "authors": "Arredondo Juan, Chernyavsky Alexander I, Jolkovsky David L, Webber Robert J, Grando Sergei A", "evidence": [ { "database": "UniProtKB", "id": "P0DP57", "url": "https://www.uniprot.org/uniprot/P0DP57" } ], "reference": [ { "type": "PubMed", "id": "16575903", "url": "https://glygen.org/publication/PubMed/16575903" } ] }, { "title": "Transcriptional regulation of SLURP2, a psoriasis-associated gene, is under control of IL-22 in the skin: A special reference to the nested gene LYNX1.", "journal": "Int. Immunopharmacol.", "date": "2015", "authors": "Moriwaki Y, Takada K, Tsuji S, Kawashima K, Misawa H", "evidence": [ { "database": "UniProtKB", "id": "P0DP57", "url": "https://www.uniprot.org/uniprot/P0DP57" } ], "reference": [ { "type": "PubMed", "id": "26033490", "url": "https://glygen.org/publication/PubMed/26033490" } ] }, { "title": "Secreted Isoform of Human Lynx1 (SLURP-2): Spatial Structure and Pharmacology of Interactions with Different Types of Acetylcholine Receptors.", "journal": "Scientific reports", "date": "2016", "authors": "Lyukmanova EN, Shulepko MA, Shenkarev ZO, Bychkov ML, Paramonov AS, Chugunov AO, Kulbatskii DS, Arvaniti M, Dolejsi E, Schaer T, Arseniev AS, Efremov RG, Thomsen MS, Dolezal V, Bertrand D, Dolgikh DA, Kirpichnikov MP", "evidence": [ { "database": "UniProtKB", "id": "P0DP57", "url": "https://www.uniprot.org/uniprot/P0DP57" }, { "database": "RefSeq", "id": "NP_803253", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_803253" } ], "reference": [ { "type": "PubMed", "id": "27485575", "url": "https://glygen.org/publication/PubMed/27485575" } ] }, { "title": "Human secreted proteins SLURP-1 and SLURP-2 control the growth of epithelial cancer cells via interactions with nicotinic acetylcholine receptors.", "journal": "British journal of pharmacology", "date": "2018", "authors": "Lyukmanova EN, Bychkov ML, Sharonov GV, Efremenko AV, Shulepko MA, Kulbatskii DS, Shenkarev ZO, Feofanov AV, Dolgikh DA, Kirpichnikov MP", "evidence": [ { "database": "RefSeq", "id": "NP_803253", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_803253" } ], "reference": [ { "type": "PubMed", "id": "29505672", "url": "https://glygen.org/publication/PubMed/29505672" } ] } ], "pathway": [ { "id": "hsa:432355", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:432355", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZUR5-1", "protein_name": "Secreted LY6/PLAUR domain containing 2", "gene_name": "Slurp2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MRLLFWFLLAVVLSMELAVTQGMFCHLCKGFGGCSHPFRCPGNTTHCVIIATRSPISFTDLPLVTKMCYNTCPDVPSLGLGPHVSIVCCQSNLCNRD", "length": 97 }, "evidence": [ { "id": "45936251", "url": "http://www.informatics.jax.org/homology/45936251", "database": "MGI" }, { "id": "P0DP57", "url": "https://omabrowser.org/oma/group/P0DP57/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P0DP59-1", "protein_name": "Secreted Ly-6/uPAR domain-containing protein 2", "gene_name": "Slurp2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRLPFWFLLAVVLSMELAVTQGLQCHLCKGFGGCSRPSSCPWSSTHCVIIATRSPISFTDLPLVTKMCYSGCPDVSSLGLGPHVSIACCQSNLCNRD", "length": 97 }, "evidence": [ { "id": "45936251", "url": "http://www.informatics.jax.org/homology/45936251", "database": "MGI" }, { "id": "P0DP57", "url": "https://omabrowser.org/oma/group/P0DP57/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "acetylcholine receptor regulator activity", "id": "GO:0030548", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030548", "evidence": [ { "database": "UniProtKB", "id": "P0DP57", "url": "https://www.uniprot.org/uniprot/P0DP57" } ], "pmid": "" }, { "name": "acetylcholine receptor binding", "id": "GO:0033130", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033130", "evidence": [ { "database": "UniProtKB", "id": "P0DP57", "url": "https://www.uniprot.org/uniprot/P0DP57" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P0DP57", "url": "https://www.uniprot.org/uniprot/P0DP57" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P0DP57", "url": "https://www.uniprot.org/uniprot/P0DP57" } ], "pmid": "" }, { "name": "synapse", "id": "GO:0045202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045202", "evidence": [ { "database": "UniProtKB", "id": "P0DP57", "url": "https://www.uniprot.org/uniprot/P0DP57" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "acetylcholine receptor signaling pathway", "id": "GO:0095500", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0095500", "evidence": [ { "database": "UniProtKB", "id": "P0DP57", "url": "https://www.uniprot.org/uniprot/P0DP57" } ], "pmid": "" }, { "name": "regulation of neurotransmitter receptor activity", "id": "GO:0099601", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099601", "evidence": [ { "database": "UniProtKB", "id": "P0DP57", "url": "https://www.uniprot.org/uniprot/P0DP57" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }