{ "uniprot_canonical_ac": "P0DN86-1", "uniprot_ac": "P0DN86", "uniprot_id": "CGB3_HUMAN", "mass": { "chemical_mass": 17739.0, "monoisotopic_mass": 17739.0 }, "refseq": { "ac": "NP_000728", "name": "choriogonadotropin subunit beta 3 precursor", "summary": "This gene is a member of the glycoprotein hormone beta chain family and encodes the beta 3 subunit of chorionic gonadotropin (CG). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. CG is produced by the trophoblastic cells of the placenta and stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. The beta subunit of CG is encoded by 6 genes which are arranged in tandem and inverted pairs on chromosome 19q13.3 and contiguous with the luteinizing hormone beta subunit gene. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000728" }, "gene_names": [ { "name": "CGB3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P0DN86", "id": "P0DN86" }, { "name": "CGB5", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P0DN86", "id": "P0DN86" }, { "name": "CGB8", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P0DN86", "id": "P0DN86" }, { "name": "CGB3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000728", "id": "NP_000728" }, { "name": "CGB; CGB5; CGB7; CGB8; hCGB; LHB", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000728", "id": "NP_000728" }, { "name": "CGB", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P0DN86", "id": "P0DN86" } ], "protein_names": [ { "name": "Choriogonadotropin subunit beta 3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P0DN86" }, { "name": "CG-beta", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DN86" }, { "name": "Choriogonadotropin subunit beta", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DN86" }, { "name": "Chorionic gonadotropin chain beta", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DN86" }, { "name": "choriogonadotropin subunit beta 3 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000728", "id": "NP_000728" }, { "name": "chorionic gonadotropin beta chain; chorionic gonadotropin beta 3 subunit; CG-beta; chorionic gonadotrophin chain beta; chorionic gonadotropin, beta polypeptide; chorionic gonadotropin chain beta; choriogonadotropin subunit beta 3; chorionic gonadotropin beta subunit 3; luteinizing hormone beta subunit", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000728", "id": "NP_000728" } ], "function": [ { "annotation": "A prospective cohort study on association of first-trimester serum biomarkers and risk of isolated foetal congenital heart defects.", "evidence": [ { "database": "RefSeq", "id": "NP_000728", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000728" }, { "database": "PubMed", "id": "34645361", "url": "https://glygen.org/publication/PubMed/34645361" } ] }, { "annotation": "Beta subunit of the human chorionic gonadotropin (hCG). hCG is a complex glycoprotein composed of two glycosylated subunits alpha and beta which are non-covalently associated. The alpha subunit is identical to those in the pituitary gonadotropin hormones (LH, FSH and TSH). The beta subunits are distinct in each of the hormones and confer receptor and biological specificity. Has an essential role in pregnancy and maternal adaptation. Stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy.", "evidence": [ { "database": "UniProtKB", "id": "P0DN86", "url": "https://www.uniprot.org/uniprot/P0DN86#function" } ] }, { "annotation": "In this study, we observed that abnormal levels of serum hCG titers and the local presentation of lesions with varying intervals after antecedent term pregnancy were the most common presenting features of extrauterine ETT [Epithelioid trophoblastic tumor].", "evidence": [ { "database": "RefSeq", "id": "NP_000728", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000728" }, { "database": "PubMed", "id": "31312959", "url": "https://glygen.org/publication/PubMed/31312959" } ] }, { "annotation": "The presence of hCGbeta positive tumor cells appears to potentially reflect the aggressive behavior of mucoepidermoid carcinoma and adenoid cystic carcinoma", "evidence": [ { "database": "RefSeq", "id": "NP_000728", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000728" }, { "database": "PubMed", "id": "30197330", "url": "https://glygen.org/publication/PubMed/30197330" } ] }, { "annotation": "This gene is a member of the glycoprotein hormone beta chain family and encodes the beta 3 subunit of chorionic gonadotropin (CG). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. CG is produced by the trophoblastic cells of the placenta and stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. The beta subunit of CG is encoded by 6 genes which are arranged in tandem and inverted pairs on chromosome 19q13.3 and contiguous with the luteinizing hormone beta subunit gene. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_000728", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000728" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs758844705", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758844705" }, { "id": "rs758844705", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758844705" }, { "id": "rs758844705", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758844705" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 137, "end_pos": 137, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DSS->NSS).", "chr_id": "19", "chr_pos": "49045205", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D137", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1214273774", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1214273774" }, { "id": "rs1214273774", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1214273774#frequency_tab" }, { "id": "rs1214273774", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1214273774" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 138, "end_pos": 138, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "19", "chr_pos": "49047740", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S138", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs772432114", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772432114" }, { "id": "rs772432114", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772432114" }, { "id": "rs1207963415", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1207963415" }, { "id": "rs1207963415", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1207963415" }, { "id": "rs1207963415", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1207963415#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 141, "end_pos": 141, "sequence_org": "S", "sequence_mut": "*", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->*).", "chr_id": "19", "chr_pos": "49047731", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S141", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs771000041", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771000041" }, { "id": "rs771000041", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771000041" }, { "id": "rs771000041", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs771000041#frequency_tab" }, { "id": "rs771000041", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771000041" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 147, "end_pos": 147, "sequence_org": "S", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->I).", "chr_id": "19", "chr_pos": "49022944", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S147", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs771000041", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771000041" }, { "id": "rs771000041", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771000041" }, { "id": "rs771000041", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs771000041#frequency_tab" }, { "id": "rs771000041", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771000041" }, { "id": "rs771144380", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771144380" }, { "id": "rs771144380", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771144380" }, { "id": "rs771144380", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs771144380#frequency_tab" }, { "id": "rs771144380", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771144380" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 147, "end_pos": 147, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->N).", "chr_id": "19", "chr_pos": "49022944", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S147", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs780808906", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780808906" }, { "id": "rs780808906", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780808906" }, { "id": "rs780808906", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs780808906#frequency_tab" }, { "id": "rs780808906", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780808906" }, { "id": "rs1397097432", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1397097432" }, { "id": "rs1397097432", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1397097432#frequency_tab" }, { "id": "rs1397097432", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1397097432" }, { "id": "rs745637893", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745637893" }, { "id": "rs745637893", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745637893" }, { "id": "rs745637893", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs745637893#frequency_tab" }, { "id": "rs745637893", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745637893" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 147, "end_pos": 147, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "19", "chr_pos": "49022943", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S147", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs773152610", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773152610" }, { "id": "rs773152610", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773152610" }, { "id": "rs773152610", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773152610" }, { "id": "rs1460346174", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1460346174" }, { "id": "rs1460346174", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1460346174" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 152, "end_pos": 152, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "19", "chr_pos": "49045251", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S152", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs755712807", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755712807" }, { "id": "rs755712807", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755712807" }, { "id": "rs755712807", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755712807#frequency_tab" }, { "id": "rs755712807", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755712807" }, { "id": "rs1265993895", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1265993895" }, { "id": "rs1265993895", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1265993895#frequency_tab" }, { "id": "rs1265993895", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1265993895" }, { "id": "rs142522943", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142522943" }, { "id": "rs142522943", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142522943" }, { "id": "rs142522943", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs142522943#frequency_tab" }, { "id": "rs142522943", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs142522943" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 158, "end_pos": 158, "sequence_org": "S", "sequence_mut": "*", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->*).", "chr_id": "19", "chr_pos": "49045269", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S158", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs755712807", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755712807" }, { "id": "rs755712807", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755712807" }, { "id": "rs755712807", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755712807#frequency_tab" }, { "id": "rs755712807", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755712807" }, { "id": "rs142522943", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142522943" }, { "id": "rs142522943", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142522943" }, { "id": "rs142522943", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs142522943#frequency_tab" }, { "id": "rs142522943", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs142522943" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 158, "end_pos": 158, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->L).", "chr_id": "19", "chr_pos": "49047680", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S158", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1229560933", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1229560933" }, { "id": "rs1229560933", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1229560933" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 158, "end_pos": 158, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "19", "chr_pos": "49022912", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S158", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs755712807", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755712807" }, { "id": "rs755712807", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755712807" }, { "id": "rs755712807", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755712807#frequency_tab" }, { "id": "rs755712807", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755712807" }, { "id": "rs142522943", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142522943" }, { "id": "rs142522943", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142522943" }, { "id": "rs142522943", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs142522943#frequency_tab" }, { "id": "rs142522943", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs142522943" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 158, "end_pos": 158, "sequence_org": "S", "sequence_mut": "W", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->W).", "chr_id": "19", "chr_pos": "49045269", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S158", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1433511248", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1433511248" }, { "id": "rs1433511248", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1433511248#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 33, "end_pos": 33, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->HAT).", "chr_id": "19", "chr_pos": "49044658", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N33", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1326860146", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1326860146" }, { "id": "rs1326860146", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1326860146#frequency_tab" }, { "id": "rs1326860146", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1326860146" }, { "id": "rs1298558119", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1298558119" }, { "id": "rs1298558119", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1298558119" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 33, "end_pos": 33, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "19", "chr_pos": "49023521", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N33", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs201642487", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201642487" }, { "id": "rs201642487", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs201642487#frequency_tab" }, { "id": "rs199824672", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199824672" }, { "id": "rs199824672", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs199824672#frequency_tab" }, { "id": "rs199824672", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs199824672" }, { "id": "rs201780746", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201780746" }, { "id": "rs201780746", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs201780746#frequency_tab" }, { "id": "rs201780746", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201780746" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 35, "end_pos": 35, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->NAI).", "chr_id": "19", "chr_pos": "49048284", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T35", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1600211921", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1600211921" }, { "id": "rs1600211921", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1600211921" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 35, "end_pos": 35, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->NAP).", "chr_id": "19", "chr_pos": "49023516", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T35", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1292238096", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1292238096" }, { "id": "rs1292238096", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1292238096" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 50, "end_pos": 50, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "19", "chr_pos": "49044710", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N50", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1409994674", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1409994674" }, { "id": "rs1409994674", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1409994674#frequency_tab" }, { "id": "rs1409994674", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1409994674" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 52, "end_pos": 52, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->NTI).", "chr_id": "19", "chr_pos": "49048233", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T52", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "18.51", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000104827", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104827" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "16.41", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000104827", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104827" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "17.43", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000104827", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104827" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "31.37", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000104827", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104827" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "24.62", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000104827", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104827" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "25.34", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000104827", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104827" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "16.88", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000104827", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104827" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "28.37", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000104827", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104827" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "39.72", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000104827", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104827" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P0DN86", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DN86" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P0DN86", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DN86" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P0DN86", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DN86" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P0DN86", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DN86" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P0DN86", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DN86" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P0DN86", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DN86" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P0DN86", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DN86" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P0DN86", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DN86" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P0DN86", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DN86" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P0DN86", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DN86" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DN86", "url": "https://www.uniprot.org/uniprot/P0DN86" } ], "common_name": "Human" } ], "gene": [ { "name": "CGB3", "url": "https://www.uniprot.org/uniprot/P0DN86", "locus": { "chromosome": "19", "start_pos": 49022869, "end_pos": 49024333, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000104827", "url": "https://www.ensembl.org/id/ENSG00000104827" } ] } } ], "crossref": [ { "id": "ENSG00000104827", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104827", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00069", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00069", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CGB3", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CGB3", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "CGB5", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CGB5", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "CGB8", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CGB8", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "1082", "url": "https://www.ncbi.nlm.nih.gov/gene/1082", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "93659", "url": "https://www.ncbi.nlm.nih.gov/gene/93659", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "94115", "url": "https://www.ncbi.nlm.nih.gov/gene/94115", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "88", "url": "https://glyconnect.expasy.org/browser/proteins/88", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "91", "url": "https://glyconnect.expasy.org/browser/proteins/91", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "16452", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=16452", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "16453", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=16453", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "1886", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=1886", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P0DN86", "url": "https://www.ebi.ac.uk/intact/interactors/id:P0DN86*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001545", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001545", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006208", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006208", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018245", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018245", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029034", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029034", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:1082", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1082", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "hsa:93659", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:93659", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "hsa:94115", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:94115", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "118860", "url": "http://www.omim.org/entry/118860", "database": "MIM", "categories": [ "Other" ] }, { "id": "608825", "url": "http://www.omim.org/entry/608825", "database": "MIM", "categories": [ "Other" ] }, { "id": "608827", "url": "http://www.omim.org/entry/608827", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P0DN86", "url": "https://www.nextprot.org/entry/NX_P0DN86", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "FCRPINA", "url": "https://omabrowser.org/oma/group/FCRPINA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2945053at2759", "url": "http://www.orthodb.org/?query=2945053at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11515", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11515", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11515:SF25", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11515:SF25", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1HCN", "url": "https://www.rcsb.org/structure/1HCN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1HRP", "url": "https://www.rcsb.org/structure/1HRP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1QFW", "url": "https://www.rcsb.org/structure/1QFW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FIG", "url": "https://www.rcsb.org/structure/7FIG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FIH", "url": "https://www.rcsb.org/structure/7FIH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FII", "url": "https://www.rcsb.org/structure/7FII", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00007", "url": "http://pfam.xfam.org/family/PF00007", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P0DN86", "url": "https://pharos.nih.gov/targets/P0DN86", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000054695", "url": "https://proconsortium.org/app/entry/PR:000054695", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054696", "url": "https://proconsortium.org/app/entry/PR:000054696", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054697", "url": "https://proconsortium.org/app/entry/PR:000054697", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054698", "url": "https://proconsortium.org/app/entry/PR:000054698", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054699", "url": "https://proconsortium.org/app/entry/PR:000054699", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054700", "url": "https://proconsortium.org/app/entry/PR:000054700", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054701", "url": "https://proconsortium.org/app/entry/PR:000054701", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054702", "url": "https://proconsortium.org/app/entry/PR:000054702", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054703", "url": "https://proconsortium.org/app/entry/PR:000054703", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054704", "url": "https://proconsortium.org/app/entry/PR:000054704", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054705", "url": "https://proconsortium.org/app/entry/PR:000054705", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054706", "url": "https://proconsortium.org/app/entry/PR:000054706", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054707", "url": "https://proconsortium.org/app/entry/PR:000054707", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054708", "url": "https://proconsortium.org/app/entry/PR:000054708", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054709", "url": "https://proconsortium.org/app/entry/PR:000054709", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054710", "url": "https://proconsortium.org/app/entry/PR:000054710", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054711", "url": "https://proconsortium.org/app/entry/PR:000054711", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054712", "url": "https://proconsortium.org/app/entry/PR:000054712", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054713", "url": "https://proconsortium.org/app/entry/PR:000054713", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054714", "url": "https://proconsortium.org/app/entry/PR:000054714", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054715", "url": "https://proconsortium.org/app/entry/PR:000054715", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054716", "url": "https://proconsortium.org/app/entry/PR:000054716", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054717", "url": "https://proconsortium.org/app/entry/PR:000054717", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054718", "url": "https://proconsortium.org/app/entry/PR:000054718", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054719", "url": "https://proconsortium.org/app/entry/PR:000054719", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054720", "url": "https://proconsortium.org/app/entry/PR:000054720", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054721", "url": "https://proconsortium.org/app/entry/PR:000054721", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054722", "url": "https://proconsortium.org/app/entry/PR:000054722", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054723", "url": "https://proconsortium.org/app/entry/PR:000054723", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054724", "url": "https://proconsortium.org/app/entry/PR:000054724", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054725", "url": "https://proconsortium.org/app/entry/PR:000054725", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054726", "url": "https://proconsortium.org/app/entry/PR:000054726", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054727", "url": "https://proconsortium.org/app/entry/PR:000054727", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054728", "url": "https://proconsortium.org/app/entry/PR:000054728", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054729", "url": "https://proconsortium.org/app/entry/PR:000054729", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054730", "url": "https://proconsortium.org/app/entry/PR:000054730", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054731", "url": "https://proconsortium.org/app/entry/PR:000054731", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054732", "url": "https://proconsortium.org/app/entry/PR:000054732", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054733", "url": "https://proconsortium.org/app/entry/PR:000054733", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054734", "url": "https://proconsortium.org/app/entry/PR:000054734", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054735", "url": "https://proconsortium.org/app/entry/PR:000054735", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P0DN86", "url": "http://purl.obolibrary.org/obo/PR_P0DN86", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-209822", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-209822", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000728", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000728", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P0DN86", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "P0DN86", "url": "https://www.uniprot.org/uniprot/P0DN86", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0DN86-1", "url": "https://www.uniprot.org/uniprot/P0DN86-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0DN86-2", "url": "https://www.uniprot.org/uniprot/P0DN86-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ", "length": 165, "header": "sp|P0DN86-1|CGB3_HUMAN Isoform 1 of Choriogonadotropin subunit beta 3 OS=Homo sapiens OX=9606 GN=CGB3 PE=1 SV=1 CANONICAL=P0DN86-1" }, "isoforms": [ { "isoform_ac": "P0DN86-1", "url": "", "sequence": { "sequence": "MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ", "length": 165, "header": "sp|P0DN86-1|CGB3_HUMAN Isoform 1 of Choriogonadotropin subunit beta 3 OS=Homo sapiens OX=9606 GN=CGB3 PE=1 SV=1 CANONICAL=P0DN86-1" }, "locus": { "chromosome": "19", "start_pos": 49023971, "end_pos": 49022889, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000357383.4", "url": "https://www.ensembl.org/id/ENST00000357383.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000349954.2", "url": "https://www.ensembl.org/id/ENSP00000349954.2" } ] } }, { "isoform_ac": "P0DN86-2", "url": "", "sequence": { "sequence": "MGRPGLGAAVSDPGEAVSLSQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ", "length": 181, "header": "sp|P0DN86-2|CGB3_HUMAN Isoform 2 of Choriogonadotropin subunit beta 3 OS=Homo sapiens OX=9606 GN=CGB3 PE=1 SV=1 CANONICAL=P0DN86-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "automatic_literature_mining", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 138, "start_aa": "Ser", "end_pos": 138, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser138", "evidence": [ { "id": "16880503", "database": "Automatic Literature Mining", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/16880503" }, { "id": "16880503", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16880503" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 141, "start_aa": "Ser", "end_pos": 141, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser141", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 141, "start_aa": "Ser", "end_pos": 141, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser141", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "glytoucan_ac": "G07677VL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 141, "start_aa": "Ser", "end_pos": 141, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser141", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "glytoucan_ac": "G60890ZT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 141, "start_aa": "Ser", "end_pos": 141, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser141", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 141, "start_aa": "Ser", "end_pos": 141, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser141", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" } ] }, { "glytoucan_ac": "G97345NY", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 141, "start_aa": "Ser", "end_pos": 141, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser141", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine O-GalNAcylation", "start_pos": 141, "start_aa": "Ser", "end_pos": 141, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser141", "evidence": [ { "id": "P0DN86", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DN86#ptm_processing" }, { "id": "1150658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1150658" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 147, "start_aa": "Ser", "end_pos": 147, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser147", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" } ] }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 147, "start_aa": "Ser", "end_pos": 147, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser147", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" } ] }, { "glytoucan_ac": "G07677VL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 147, "start_aa": "Ser", "end_pos": 147, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser147", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" } ] }, { "glytoucan_ac": "G60890ZT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 147, "start_aa": "Ser", "end_pos": 147, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser147", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 147, "start_aa": "Ser", "end_pos": 147, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser147", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" } ] }, { "glytoucan_ac": "G97345NY", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 147, "start_aa": "Ser", "end_pos": 147, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser147", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine O-GalNAcylation", "start_pos": 147, "start_aa": "Ser", "end_pos": 147, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser147", "evidence": [ { "id": "P0DN86", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DN86#ptm_processing" }, { "id": "1150658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1150658" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 152, "start_aa": "Ser", "end_pos": 152, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser152", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" } ] }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 152, "start_aa": "Ser", "end_pos": 152, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser152", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" } ] }, { "glytoucan_ac": "G07677VL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 152, "start_aa": "Ser", "end_pos": 152, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser152", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" } ] }, { "glytoucan_ac": "G60890ZT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 152, "start_aa": "Ser", "end_pos": 152, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser152", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 152, "start_aa": "Ser", "end_pos": 152, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser152", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine O-GalNAcylation", "start_pos": 152, "start_aa": "Ser", "end_pos": 152, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser152", "evidence": [ { "id": "P0DN86", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DN86#ptm_processing" }, { "id": "1150658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1150658" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 158, "start_aa": "Ser", "end_pos": 158, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser158", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" } ] }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 158, "start_aa": "Ser", "end_pos": 158, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser158", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" } ] }, { "glytoucan_ac": "G07677VL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 158, "start_aa": "Ser", "end_pos": 158, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser158", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" } ] }, { "glytoucan_ac": "G60890ZT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 158, "start_aa": "Ser", "end_pos": 158, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser158", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 158, "start_aa": "Ser", "end_pos": 158, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser158", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" } ] }, { "glytoucan_ac": "G97345NY", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 158, "start_aa": "Ser", "end_pos": 158, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser158", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine O-GalNAcylation", "start_pos": 158, "start_aa": "Ser", "end_pos": 158, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser158", "evidence": [ { "id": "P0DN86", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DN86#ptm_processing" }, { "id": "1150658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1150658" } ] }, { "glytoucan_ac": "G14996IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" } ] }, { "glytoucan_ac": "G17689DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "glytoucan_ac": "G29857RC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "glytoucan_ac": "G36191CD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" } ] }, { "glytoucan_ac": "G43664YB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "glytoucan_ac": "G69411IG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "glytoucan_ac": "G77252PU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "glytoucan_ac": "G86357DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "P0DN86", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DN86#ptm_processing" }, { "id": "1HRP", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1HRP" } ] }, { "glytoucan_ac": "G14996IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" } ] }, { "glytoucan_ac": "G17689DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "glytoucan_ac": "G29857RC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" } ] }, { "glytoucan_ac": "G36191CD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "glytoucan_ac": "G43664YB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" } ] }, { "glytoucan_ac": "G69411IG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "glytoucan_ac": "G77252PU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" } ] }, { "glytoucan_ac": "G86357DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-33, N-50, S-141, S-147, S-152, S-158", "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "P0DN86", "database": "UniCarbKB", "url": "" }, { "id": "1820200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1820200" }, { "id": "P0DN86", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DN86#ptm_processing" }, { "id": "1HRP", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1HRP" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "automatic_literature_mining", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 78, "start_aa": "Asn", "end_pos": 78, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn78", "evidence": [ { "id": "8898911", "database": "Automatic Literature Mining", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/8898911" }, { "id": "8898911", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8898911" }, { "id": "2647161", "database": "Automatic Literature Mining", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/2647161" }, { "id": "2647161", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2647161" }, { "id": "2536708", "database": "Automatic Literature Mining", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/2536708" }, { "id": "2536708", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2536708" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "3335536", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3335536" }, { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" } ] }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "3335536", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3335536" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" } ] }, { "glytoucan_ac": "G07677VL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" } ] }, { "glytoucan_ac": "G11457RF", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "3335536", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3335536" } ] }, { "glytoucan_ac": "G12398HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" }, { "id": "6643471", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" }, { "id": "6643471", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "glytoucan_ac": "G23453IV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" }, { "id": "6643471", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" }, { "id": "6643471", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "glytoucan_ac": "G25520XG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" } ] }, { "glytoucan_ac": "G29857RC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" }, { "id": "6643471", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" }, { "id": "6643471", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "3335536", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3335536" }, { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" } ] }, { "glytoucan_ac": "G36191CD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" }, { "id": "6643471", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "glytoucan_ac": "G43664YB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" }, { "id": "6643471", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "glytoucan_ac": "G46748BU", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "3335536", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3335536" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" }, { "id": "6643471", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "glytoucan_ac": "G52428MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" }, { "id": "6643471", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "glytoucan_ac": "G52934AK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" } ] }, { "glytoucan_ac": "G56682BC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "3335536", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3335536" } ] }, { "glytoucan_ac": "G59970QL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "3335536", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3335536" } ] }, { "glytoucan_ac": "G60890ZT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "3335536", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3335536" } ] }, { "glytoucan_ac": "G63628AV", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "3335536", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3335536" }, { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "3335536", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3335536" }, { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" } ] }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "3335536", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3335536" } ] }, { "glytoucan_ac": "G69411IG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" }, { "id": "6643471", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "glytoucan_ac": "G70375MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" }, { "id": "6643471", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "glytoucan_ac": "G74645FT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" } ] }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "3335536", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3335536" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" }, { "id": "6643471", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "glytoucan_ac": "G78790NZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" } ] }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" } ] }, { "glytoucan_ac": "G81006GJ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" }, { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "3335536", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3335536" }, { "id": "468798", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/468798" } ] }, { "glytoucan_ac": "G86357DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" }, { "id": "9449027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9449027" }, { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "1967025", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1967025" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" }, { "id": "6643471", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" } ] }, { "glytoucan_ac": "G95898GD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "88", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/88" }, { "id": "15316280", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15316280" } ] }, { "glytoucan_ac": "G97345NY", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "91", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/91" }, { "id": "1374031", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1374031" } ] } ], "phosphorylation": [ { "start_pos": 116, "end_pos": 116, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P0DN86", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P0DN86" }, { "database": "PubMed", "id": "6196363", "url": "https://glygen.org/publication/PubMed/6196363" } ], "site_lbl": "Ser116" }, { "start_pos": 117, "end_pos": 117, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P0DN86", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P0DN86" }, { "database": "PubMed", "id": "6196363", "url": "https://glygen.org/publication/PubMed/6196363" } ], "site_lbl": "Thr117" }, { "start_pos": 117, "end_pos": 117, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P0DN86", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P0DN86" }, { "database": "PubMed", "id": "6196363", "url": "https://glygen.org/publication/PubMed/6196363" } ], "site_lbl": "Thr117" }, { "start_pos": 86, "end_pos": 86, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P0DN86", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P0DN86" }, { "database": "PubMed", "id": "6196363", "url": "https://glygen.org/publication/PubMed/6196363" } ], "site_lbl": "Ser86" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "AP2alpha and AP2gamma: a comparison of binding site specificity and trans-activation of the estrogen receptor promoter and single site promoter constructs.", "journal": "Nucleic acids research", "date": "1999", "authors": "McPherson LA, Weigel RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "10497269", "url": "https://glygen.org/publication/PubMed/10497269" } ] }, { "title": "AP-2 family members regulate basal and cAMP-induced expression of human chorionic gonadotropin.", "journal": "Nucleic acids research", "date": "2000", "authors": "LiCalsi C, Christophe S, Steger DJ, Buescher M, Fischer W, Mellon PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "10648798", "url": "https://glygen.org/publication/PubMed/10648798" } ] }, { "title": "The amino acid sequence of human chorionic gonadotropin. The alpha subunit and beta subunit.", "journal": "The Journal of biological chemistry", "date": "1975", "authors": "Morgan FJ, Birken S, Canfield RE", "evidence": [ { "database": "UniProtKB", "id": "P0DN86", "url": "https://www.uniprot.org/uniprot/P0DN86#ptm_processing" }, { "database": "UniProtKB", "id": "P0DN86", "url": "https://www.uniprot.org/uniprot/P0DN86" } ], "reference": [ { "type": "PubMed", "id": "1150658", "url": "https://glygen.org/publication/PubMed/1150658" } ] }, { "title": "Chorionic gonadotropin has a recent origin within primates and an evolutionary history of selection.", "journal": "Molecular biology and evolution", "date": "2002", "authors": "Maston GA, Ruvolo M", "evidence": [ { "database": "UniProtKB", "id": "P0DN86", "url": "https://www.uniprot.org/uniprot/P0DN86" } ], "reference": [ { "type": "PubMed", "id": "11861891", "url": "https://glygen.org/publication/PubMed/11861891" } ] }, { "title": "Human pituitary lutropin. Isolation, properties, and the complete amino acid sequence of the beta-subunit.", "journal": "Biochimica et biophysica acta", "date": "1975", "authors": "Sairam MR, Li CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-209822", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-209822" } ], "reference": [ { "type": "PubMed", "id": "1191677", "url": "https://glygen.org/publication/PubMed/1191677" } ] }, { "title": "The carbohydrate chains of the beta subunit of human chorionic gonadotropin produced by the choriocarcinoma cell line BeWo. Novel O-linked and novel bisecting-GlcNAc-containing N-linked carbohydrates.", "journal": "European journal of biochemistry", "date": "1992", "authors": "Hard K, Damm JB, Spruijt MP, Bergwerff AA, Kamerling JP, Van Dedem GW, Vliegenthart JF", "evidence": [ { "database": "UniCarbKB", "id": "P0DN86", "url": "" }, { "database": "GlyConnect", "id": "91", "url": "https://glyconnect.expasy.org/browser/proteins/91" } ], "reference": [ { "type": "PubMed", "id": "1374031", "url": "https://glygen.org/publication/PubMed/1374031" } ] }, { "title": "Activator protein 2alpha inhibits tumorigenicity and represses vascular endothelial growth factor transcription in prostate cancer cells.", "journal": "Cancer research", "date": "2004", "authors": "Ruiz M, Pettaway C, Song R, Stoeltzing O, Ellis L, Bar-Eli M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "14744778", "url": "https://glygen.org/publication/PubMed/14744778" } ] }, { "title": "Abnormal biantennary sugar chains are expressed in human chorionic gonadotropin produced in the choriocarcinoma cell line, JEG-3.", "journal": "Glycoconjugate journal", "date": "2004", "authors": "Takamatsu S, Katsumata T, Inoue N, Watanabe T, Fujibayashi Y, Takeuchi M", "evidence": [ { "database": "GlyConnect", "id": "88", "url": "https://glyconnect.expasy.org/browser/proteins/88" } ], "reference": [ { "type": "PubMed", "id": "15316280", "url": "https://glygen.org/publication/PubMed/15316280" } ] }, { "title": "Yin Yang 1 cooperates with activator protein 2 to stimulate ERBB2 gene expression in mammary cancer cells.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Begon DY, Delacroix L, Vernimmen D, Jackers P, Winkler R", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "15870067", "url": "https://glygen.org/publication/PubMed/15870067" } ] }, { "title": "Expression of beta-subunit of HCG genes during normal and failed pregnancy.", "journal": "Hum. Reprod.", "date": "2005", "authors": "Rull K, Laan M", "evidence": [ { "database": "UniProtKB", "id": "P0DN86", "url": "https://www.uniprot.org/uniprot/P0DN86" }, { "database": "Reactome", "id": "R-HSA-209822", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-209822" } ], "reference": [ { "type": "PubMed", "id": "16123088", "url": "https://glygen.org/publication/PubMed/16123088" } ] }, { "title": "The role of O-linked and N-linked oligosaccharides on the structure-function of glycoprotein hormones: development of agonists and antagonists.", "journal": "Biochimica et biophysica acta", "date": "2006", "authors": "Fares F", "evidence": [ { "database": "Reactome", "id": "R-HSA-209822", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-209822" } ], "reference": [ { "type": "PubMed", "id": "16527410", "url": "https://glygen.org/publication/PubMed/16527410" } ] }, { "title": "Site-specific glycan analysis of human chorionic gonadotropin beta-subunit from malignancies and pregnancy by liquid chromatography--electrospray mass spectrometry.", "journal": "Glycobiology", "date": "2006", "authors": "Valmu L, Alfthan H, Hotakainen K, Birken S, Stenman UH", "evidence": [ { "database": "Automatic Literature Mining", "id": "16880503", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/16880503" } ], "reference": [ { "type": "PubMed", "id": "16880503", "url": "https://glygen.org/publication/PubMed/16880503" } ] }, { "title": "Role of disulfide bond formation in the folding of human chorionic gonadotropin beta subunit into an alpha beta dimer assembly-competent form.", "journal": "J. Biol. Chem.", "date": "1990", "authors": "Beebe JS, Mountjoy K, Krzesicki RF, Perini F, Ruddon RW", "evidence": [ { "database": "UniProtKB", "id": "P0DN86", "url": "https://www.uniprot.org/uniprot/P0DN86" }, { "database": "Reactome", "id": "R-HSA-209822", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-209822" } ], "reference": [ { "type": "PubMed", "id": "1688430", "url": "https://glygen.org/publication/PubMed/1688430" } ] }, { "title": "ANCCA, an estrogen-regulated AAA+ ATPase coactivator for ERalpha, is required for coregulator occupancy and chromatin modification.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Zou JX, Revenko AS, Li LB, Gemo AT, Chen HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "17998543", "url": "https://glygen.org/publication/PubMed/17998543" } ] }, { "title": "Site-specific N-glycosylation of human chorionic gonadotrophin -- structural analysis of glycopeptides by one- and two-dimensional 1H NMR spectroscopy.", "journal": "Glycobiology", "date": "1991", "authors": "Weisshaar G, Hiyama J, Renwick AG", "evidence": [ { "database": "UniProtKB", "id": "P0DN86", "url": "https://www.uniprot.org/uniprot/P0DN86" }, { "database": "UniCarbKB", "id": "P0DN86", "url": "" }, { "database": "GlyConnect", "id": "91", "url": "https://glyconnect.expasy.org/browser/proteins/91" } ], "reference": [ { "type": "PubMed", "id": "1820200", "url": "https://glygen.org/publication/PubMed/1820200" } ] }, { "title": "Androgen-induced coactivator ANCCA mediates specific androgen receptor signaling in prostate cancer.", "journal": "Cancer research", "date": "2009", "authors": "Zou JX, Guo L, Revenko AS, Tepper CG, Gemo AT, Kung HJ, Chen HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "19318566", "url": "https://glygen.org/publication/PubMed/19318566" } ] }, { "title": "Altered glycosylation of human chorionic gonadotropin decreases its hormonal activity as determined by cyclic-adenosine 3',5'-monophosphate production in MA-10 cells.", "journal": "Glycobiology", "date": "1990", "authors": "Amano J, Nishimura R, Sato S, Kobata A", "evidence": [ { "database": "GlyConnect", "id": "88", "url": "https://glyconnect.expasy.org/browser/proteins/88" } ], "reference": [ { "type": "PubMed", "id": "1967025", "url": "https://glygen.org/publication/PubMed/1967025" } ] }, { "title": "ATAD2 is a novel cofactor for MYC, overexpressed and amplified in aggressive tumors.", "journal": "Cancer research", "date": "2009", "authors": "Ciro M, Prosperini E, Quarto M, Grazini U, Walfridsson J, McBlane F, Nucifero P, Pacchiana G, Capra M, Christensen J, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "19843847", "url": "https://glygen.org/publication/PubMed/19843847" } ] }, { "title": "Functional characterization of ATAD2 as a new cancer/testis factor and a predictor of poor prognosis in breast and lung cancers.", "journal": "Oncogene", "date": "2010", "authors": "Caron C, Lestrat C, Marsal S, Escoffier E, Curtet S, Virolle V, Barbry P, Debernardi A, Brambilla C, Brambilla E, Rousseaux S, Khochbin S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "20581866", "url": "https://glygen.org/publication/PubMed/20581866" } ] }, { "title": "Chromatin and epigenetic determinants of estrogen receptor alpha (ESR1) signaling.", "journal": "Molecular and cellular endocrinology", "date": "2014", "authors": "Magnani L, Lupien M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "23684889", "url": "https://glygen.org/publication/PubMed/23684889" } ] }, { "title": "A map of the hCG beta-LH beta gene cluster.", "journal": "J. Biol. Chem.", "date": "1986", "authors": "Policastro PF, Daniels-McQueen S, Carle G, Boime I", "evidence": [ { "database": "UniProtKB", "id": "P0DN86", "url": "https://www.uniprot.org/uniprot/P0DN86" } ], "reference": [ { "type": "PubMed", "id": "2422163", "url": "https://glygen.org/publication/PubMed/2422163" } ] }, { "title": "Site specificity of the chorionic gonadotropin N-linked oligosaccharides in signal transduction.", "journal": "The Journal of biological chemistry", "date": "1989-02-15", "authors": "Matzuk M M, Keene J L, Boime I", "evidence": [ { "database": "Automatic Literature Mining", "id": "2536708", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/2536708" } ], "reference": [ { "type": "PubMed", "id": "2536708", "url": "https://glygen.org/publication/PubMed/2536708" } ] }, { "title": "The role of Tcfap2c in tumorigenesis and cancer growth in an activated Neu model of mammary carcinogenesis.", "journal": "Oncogene", "date": "2015", "authors": "Park JM, Wu T, Cyr AR, Woodfield GW, De Andrade JP, Spanheimer PM, Li T, Sugg SL, Lal G, Domann FE, Zhang W, Weigel RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "25772240", "url": "https://glygen.org/publication/PubMed/25772240" } ] }, { "title": "ATAD2 overexpression links to enrichment of B-MYB-translational signatures and development of aggressive endometrial carcinoma.", "journal": "Oncotarget", "date": "2015", "authors": "Krakstad C, Tangen IL, Hoivik EA, Halle MK, Berg A, Werner HM, Raeder MB, Kusonmano K, Zou JX, Oyan AM, Stefansson I, Trovik J, Kalland KH, Chen HW, Salvesen HB", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "26308378", "url": "https://glygen.org/publication/PubMed/26308378" } ] }, { "title": "Mutagenesis and gene transfer define site-specific roles of the gonadotropin oligosaccharides.", "journal": "Biology of reproduction", "date": "1989-01", "authors": "Matzuk M M, Boime I", "evidence": [ { "database": "Automatic Literature Mining", "id": "2647161", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/2647161" } ], "reference": [ { "type": "PubMed", "id": "2647161", "url": "https://glygen.org/publication/PubMed/2647161" } ] }, { "title": "EGFR Is Regulated by TFAP2C in Luminal Breast Cancer and Is a Target for Vandetanib.", "journal": "Molecular cancer therapeutics", "date": "2016", "authors": "De Andrade JP, Park JM, Gu VW, Woodfield GW, Kulak MV, Lorenzen AW, Wu VT, Van Dorin SE, Spanheimer PM, Weigel RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "26832794", "url": "https://glygen.org/publication/PubMed/26832794" } ] }, { "title": "Immunohistochemical study of the expression of human chorionic gonadotropin-beta in salivary gland tumors.", "journal": "Journal of cancer research and therapeutics", "date": "2018", "authors": "Meda S, Reginald BA, Reddy BS", "evidence": [ { "database": "RefSeq", "id": "NP_000728", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000728" } ], "reference": [ { "type": "PubMed", "id": "30197330", "url": "https://glygen.org/publication/PubMed/30197330" } ] }, { "title": "Clinical characteristics and outcomes of extrauterine epithelioid trophoblastic tumors.", "journal": "Archives of gynecology and obstetrics", "date": "2019", "authors": "Zhang T, Zeng X, Xu H, Gao L, Xiong L, An R, Xue Y", "evidence": [ { "database": "RefSeq", "id": "NP_000728", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000728" } ], "reference": [ { "type": "PubMed", "id": "31312959", "url": "https://glygen.org/publication/PubMed/31312959" } ] }, { "title": "Comparative study of the mucin-type sugar chains of human chorionic gonadotropin present in the urine of patients with trophoblastic diseases and healthy pregnant women.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Amano J, Nishimura R, Mochizuki M, Kobata A", "evidence": [ { "database": "GlyConnect", "id": "88", "url": "https://glyconnect.expasy.org/browser/proteins/88" } ], "reference": [ { "type": "PubMed", "id": "3335536", "url": "https://glygen.org/publication/PubMed/3335536" } ] }, { "title": "A prospective cohort study on association of first-trimester serum biomarkers and risk of isolated foetal congenital heart defects.", "journal": "Biomarkers : biochemical indicators of exposure, response, and susceptibility to chemicals", "date": "2021", "authors": "Hematian MN, Hessami K, Torabi S, Saleh M, Nouri B, Saleh M", "evidence": [ { "database": "RefSeq", "id": "NP_000728", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000728" } ], "reference": [ { "type": "PubMed", "id": "34645361", "url": "https://glygen.org/publication/PubMed/34645361" } ] }, { "title": "Structure and location of the O-glycosidic carbohydrate units of human chorionic gonadotropin.", "journal": "The Journal of biological chemistry", "date": "1979", "authors": "Kessler MJ, Mise T, Ghai RD, Bahl OP", "evidence": [ { "database": "UniCarbKB", "id": "P0DN86", "url": "" }, { "database": "GlyConnect", "id": "91", "url": "https://glyconnect.expasy.org/browser/proteins/91" } ], "reference": [ { "type": "PubMed", "id": "468798", "url": "https://glygen.org/publication/PubMed/468798" } ] }, { "title": "Human chorionic gonadotropin. Linear amino acid sequence of the beta subunit.", "journal": "J. Biol. Chem.", "date": "1973", "authors": "Carlsen R B, Bahl O P, Swaminathan N", "evidence": [ { "database": "UniProtKB", "id": "P0DN86", "url": "https://www.uniprot.org/uniprot/P0DN86" } ], "reference": [ { "type": "PubMed", "id": "4795659", "url": "https://glygen.org/publication/PubMed/4795659" } ] }, { "title": "The beta subunit of human chorionic gonadotropin is encoded by multiple genes.", "journal": "The Journal of biological chemistry", "date": "1983", "authors": "Policastro P, Ovitt CE, Hoshina M, Fukuoka H, Boothby MR, Boime I", "evidence": [ { "database": "UniProtKB", "id": "P0DN86", "url": "https://www.uniprot.org/uniprot/P0DN86" } ], "reference": [ { "type": "PubMed", "id": "6194155", "url": "https://glygen.org/publication/PubMed/6194155" } ] }, { "title": "Phosphorylation of human choriogonadotropin. Stoichiometry and sites of phosphate incorporation.", "journal": "The Journal of biological chemistry", "date": "1983", "authors": "Keutmann HT, Ratanabanangkoon K, Pierce MW, Kitzmann K, Ryan RJ", "evidence": [ { "database": "iPTMnet", "id": "P0DN86-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P0DN86-1" } ], "reference": [ { "type": "PubMed", "id": "6196363", "url": "https://glygen.org/publication/PubMed/6196363" } ] }, { "title": "Structures of the asparagine-linked sugar chains of human chorionic gonadotropin produced in choriocarcinoma. Appearance of triantennary sugar chains and unique biantennary sugar chains.", "journal": "The Journal of biological chemistry", "date": "1983", "authors": "Mizuochi T, Nishimura R, Derappe C, Taniguchi T, Hamamoto T, Mochizuki M, Kobata A", "evidence": [ { "database": "GlyConnect", "id": "88", "url": "https://glyconnect.expasy.org/browser/proteins/88" } ], "reference": [ { "type": "PubMed", "id": "6643471", "url": "https://glygen.org/publication/PubMed/6643471" } ] }, { "title": "Evolution of the genes for the beta subunits of human chorionic gonadotropin and luteinizing hormone.", "journal": "Nature", "date": "1984", "authors": "Talmadge K, Vamvakopoulos N C, Fiddes J C", "evidence": [ { "database": "UniProtKB", "id": "P0DN86", "url": "https://www.uniprot.org/uniprot/P0DN86" } ], "reference": [ { "type": "PubMed", "id": "6690982", "url": "https://glygen.org/publication/PubMed/6690982" } ] }, { "title": "The cDNA for the beta-subunit of human chorionic gonadotropin suggests evolution of a gene by readthrough into the 3'-untranslated region.", "journal": "Nature", "date": "1980", "authors": "Fiddes J C, Goodman H M", "evidence": [ { "database": "UniProtKB", "id": "P0DN86", "url": "https://www.uniprot.org/uniprot/P0DN86" } ], "reference": [ { "type": "PubMed", "id": "6774259", "url": "https://glygen.org/publication/PubMed/6774259" } ] }, { "title": "Studies on the disulfide bonds in human pituitary follicle-stimulating hormone.", "journal": "Biochimica et biophysica acta", "date": "1980", "authors": "Fujiki Y, Rathnam P, Saxena BB", "evidence": [ { "database": "Reactome", "id": "R-HSA-209822", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-209822" } ], "reference": [ { "type": "PubMed", "id": "6774759", "url": "https://glygen.org/publication/PubMed/6774759" } ] }, { "title": "Thyroid-stimulating hormone subunits: evidence from endoglycosidase-H cleavage for late presecretory glycosylation.", "journal": "Endocrinology", "date": "1981", "authors": "Chin WW, Habener JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-209822", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-209822" } ], "reference": [ { "type": "PubMed", "id": "7215288", "url": "https://glygen.org/publication/PubMed/7215288" } ] }, { "title": "Assignment of disulfide bonds in the beta subunit of human chorionic gonadotropin.", "journal": "J. Biol. Chem.", "date": "1981", "authors": "Mise T, Bahl O P", "evidence": [ { "database": "UniProtKB", "id": "P0DN86", "url": "https://www.uniprot.org/uniprot/P0DN86" } ], "reference": [ { "type": "PubMed", "id": "7240231", "url": "https://glygen.org/publication/PubMed/7240231" } ] }, { "title": "The amino acid sequences of the prepeptides contained in the alpha and beta subunits of human choriogonadotropin.", "journal": "J. Biol. Chem.", "date": "1981", "authors": "Birken S, Fetherston J, Canfield R, Boime I", "evidence": [ { "database": "UniProtKB", "id": "P0DN86", "url": "https://www.uniprot.org/uniprot/P0DN86" } ], "reference": [ { "type": "PubMed", "id": "7462224", "url": "https://glygen.org/publication/PubMed/7462224" } ] }, { "title": "Transcriptional regulation of estrogen receptor in breast carcinomas.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "deConinck EC, McPherson LA, Weigel RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "7891714", "url": "https://glygen.org/publication/PubMed/7891714" } ] }, { "title": "Crystal structure of human chorionic gonadotropin.", "journal": "Nature", "date": "1994", "authors": "Lapthorn AJ, Harris DC, Littlejohn A, Lustbader JW, Canfield RE, Machin KJ, Morgan FJ, Isaacs NW", "evidence": [ { "database": "UniProtKB", "id": "P0DN86", "url": "https://www.uniprot.org/uniprot/P0DN86" } ], "reference": [ { "type": "PubMed", "id": "8202136", "url": "https://glygen.org/publication/PubMed/8202136" } ] }, { "title": "A family of AP-2 proteins regulates c-erbB-2 expression in mammary carcinoma.", "journal": "Oncogene", "date": "1996", "authors": "Bosher JM, Totty NF, Hsuan JJ, Williams T, Hurst HC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "8895516", "url": "https://glygen.org/publication/PubMed/8895516" } ] }, { "title": "NMR studies of the free alpha subunit of human chorionic gonadotropin. Structural influences of N-glycosylation and the beta subunit on the conformation of the alpha subunit.", "journal": "European journal of biochemistry", "date": "1996-10-01", "authors": "De Beer T, Van Zuylen C W, Leeflang B R, H\u00e5rd K, Boelens R, Kaptein R, Kamerling J P, Vliegenthart J F", "evidence": [ { "database": "Automatic Literature Mining", "id": "8898911", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/8898911" } ], "reference": [ { "type": "PubMed", "id": "8898911", "url": "https://glygen.org/publication/PubMed/8898911" } ] }, { "title": "Transcription factor AP-2 controls transcription of the human transforming growth factor-alpha gene.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Wang D, Shin TH, Kudlow JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "9162057", "url": "https://glygen.org/publication/PubMed/9162057" } ] }, { "title": "Regulation of the human chorionic gonadotropin alpha- and beta-subunit promoters by AP-2.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Johnson W, Albanese C, Handwerger S, Williams T, Pestell RG, Jameson JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "9182571", "url": "https://glygen.org/publication/PubMed/9182571" } ] }, { "title": "Carbohydrate and peptide structure of the alpha- and beta-subunits of human chorionic gonadotropin from normal and aberrant pregnancy and choriocarcinoma.", "journal": "Endocrine", "date": "1997", "authors": "Elliott MM, Kardana A, Lustbader JW, Cole LA", "evidence": [ { "database": "UniCarbKB", "id": "P0DN86", "url": "" }, { "database": "GlyConnect", "id": "91", "url": "https://glyconnect.expasy.org/browser/proteins/91" } ], "reference": [ { "type": "PubMed", "id": "9449027", "url": "https://glygen.org/publication/PubMed/9449027" } ] }, { "title": "Loss of AP-2 results in downregulation of c-KIT and enhancement of melanoma tumorigenicity and metastasis.", "journal": "The EMBO journal", "date": "1998", "authors": "Huang S, Jean D, Luca M, Tainsky MA, Bar-Eli M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "9687504", "url": "https://glygen.org/publication/PubMed/9687504" } ] }, { "title": "Expression of AP-2 transcription factors in human breast cancer correlates with the regulation of multiple growth factor signalling pathways.", "journal": "Cancer research", "date": "1998", "authors": "Turner BC, Zhang J, Gumbs AA, Maher MG, Kaplan L, Carter D, Glazer PM, Hurst HC, Haffty BG, Williams T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910" } ], "reference": [ { "type": "PubMed", "id": "9850080", "url": "https://glygen.org/publication/PubMed/9850080" } ] } ], "pathway": [ { "id": "hsa:1082", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1082", "resource": "KEGG Pathway" }, { "id": "hsa:93659", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:93659", "resource": "KEGG Pathway" }, { "id": "hsa:94115", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:94115", "resource": "KEGG Pathway" }, { "id": "R-HSA-209822", "name": "Glycoprotein hormones", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-209822", "resource": "Reactome", "description": "Glycoprotein hormones" }, { "id": "R-HSA-8866910", "name": "TFAP2 (AP-2) family regulates transcription of growth factors and their receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910", "resource": "Reactome", "description": "TFAP2 (AP-2) family regulates transcription of growth factors and their receptors" } ], "orthologs": [ { "uniprot_canonical_ac": "A6NKQ9-1", "protein_name": "Choriogonadotropin subunit beta variant 1", "gene_name": "CGB1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSTFPVLAEDIPLRERHVKGRVDPHFRAPKMEMFQRLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGP", "length": 187 }, "evidence": [ { "id": "45920636", "url": "http://www.informatics.jax.org/homology/45920636", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "O09108-1", "protein_name": "Lutropin subunit beta", "gene_name": "Lhb", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MERLQGLLLWLLLSPSVVWASRGPLRPLCRPVNATLAAENEFCPVCITFTTSICAGYCPSMVRVLPAALPPVPQPVCTYRELAFASVRLPGCPPGVDPIVSFPVALSCRCGPCRLSSSDCGGPRTQPMACDLPHLPGLLLL", "length": 141 }, "evidence": [ { "id": "45920636", "url": "http://www.informatics.jax.org/homology/45920636", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P01229-1", "protein_name": "Lutropin subunit beta", "gene_name": "LHB", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MEMLQGLLLLLLLSMGGAWASREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL", "length": 141 }, "evidence": [ { "id": "45920636", "url": "http://www.informatics.jax.org/homology/45920636", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P01230-1", "protein_name": "Lutropin subunit beta", "gene_name": "Lhb", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MERLQGLLLWLLLSPSVVWASRGPLRPLCRPVNATLAAENEFCPVCITFTTSICAGYCPSMVRVLPAALPPVPQPVCTYRELRFASVRLPGCPPGVDPIVSFPVALSCRCGPCRLSSSDCGGPRTQPMTCDLPHLPGLLLF", "length": 141 }, "evidence": [ { "id": "45920636", "url": "http://www.informatics.jax.org/homology/45920636", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P0DN87-1", "protein_name": "Choriogonadotropin subunit beta 7", "gene_name": "CGB7", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MEMFQGLLLLLLLSMGGTWASREMLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQASSSSKAPPPSLPSPSRLPGPSDTPILPQ", "length": 165 }, "evidence": [ { "id": "45920636", "url": "http://www.informatics.jax.org/homology/45920636", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q6NT52-1", "protein_name": "Choriogonadotropin subunit beta variant 2", "gene_name": "CGB2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSKGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQASSSSKAPPPSLPSPSRLPGPSDTPILPQ", "length": 163 }, "evidence": [ { "id": "45920636", "url": "http://www.informatics.jax.org/homology/45920636", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P0DN86", "url": "https://www.uniprot.org/uniprot/P0DN86" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P0DN86", "url": "https://www.uniprot.org/uniprot/P0DN86" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P0DN86", "url": "https://www.uniprot.org/uniprot/P0DN86" } ], "pmid": "" }, { "name": "pituitary gonadotropin complex", "id": "GO:0061696", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061696", "evidence": [ { "database": "UniProtKB", "id": "P0DN86", "url": "https://www.uniprot.org/uniprot/P0DN86" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "P0DN86", "url": "https://www.uniprot.org/uniprot/P0DN86" } ], "pmid": "" }, { "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "evidence": [ { "database": "UniProtKB", "id": "P0DN86", "url": "https://www.uniprot.org/uniprot/P0DN86" } ], "pmid": "" }, { "name": "cell-cell signaling", "id": "GO:0007267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007267", "evidence": [ { "database": "UniProtKB", "id": "P0DN86", "url": "https://www.uniprot.org/uniprot/P0DN86" } ], "pmid": "" }, { "name": "apoptotic process", "id": "GO:0006915", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006915", "evidence": [ { "database": "UniProtKB", "id": "P0DN86", "url": "https://www.uniprot.org/uniprot/P0DN86" } ], "pmid": "" }, { "name": "hormone-mediated signaling pathway", "id": "GO:0009755", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009755", "evidence": [ { "database": "UniProtKB", "id": "P0DN86", "url": "https://www.uniprot.org/uniprot/P0DN86" } ], "pmid": "" }, { "name": "female gamete generation", "id": "GO:0007292", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007292", "evidence": [ { "database": "UniProtKB", "id": "P0DN86", "url": "https://www.uniprot.org/uniprot/P0DN86" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "hormone activity", "id": "GO:0005179", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005179", "evidence": [ { "database": "UniProtKB", "id": "P0DN86", "url": "https://www.uniprot.org/uniprot/P0DN86" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "choriogonadotropin subunit beta 3 N-glycosylated 1 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been N-glycosylated at the residue equivalent to Asn-33 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G14996IQ. Example: UniProtKB:P0DN86-1, Asn-33, MOD:00160~GNO:G14996IQ. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054695", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054695" } ] }, { "name": "choriogonadotropin subunit beta 3 N-glycosylated 2 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been N-glycosylated at the residue equivalent to Asn-33 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G17689DH. Example: UniProtKB:P0DN86-1, Asn-33, MOD:00160~GNO:G17689DH. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054696", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054696" } ] }, { "name": "choriogonadotropin subunit beta 3 N-glycosylated 3 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been N-glycosylated at the residue equivalent to Asn-33 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G29857RC. Example: UniProtKB:P0DN86-1, Asn-33, MOD:00160~GNO:G29857RC. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054697", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054697" } ] }, { "name": "choriogonadotropin subunit beta 3 N-glycosylated 4 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been N-glycosylated at the residue equivalent to Asn-33 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G36191CD. Example: UniProtKB:P0DN86-1, Asn-33, MOD:00160~GNO:G36191CD. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054698", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054698" } ] }, { "name": "choriogonadotropin subunit beta 3 N-glycosylated 5 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been N-glycosylated at the residue equivalent to Asn-33 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G43664YB. Example: UniProtKB:P0DN86-1, Asn-33, MOD:00160~GNO:G43664YB. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054699", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054699" } ] }, { "name": "choriogonadotropin subunit beta 3 N-glycosylated 6 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been N-glycosylated at the residue equivalent to Asn-33 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G69411IG. Example: UniProtKB:P0DN86-1, Asn-33, MOD:00160~GNO:G69411IG. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054700", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054700" } ] }, { "name": "choriogonadotropin subunit beta 3 N-glycosylated 7 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been N-glycosylated at the residue equivalent to Asn-33 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G77252PU. Example: UniProtKB:P0DN86-1, Asn-33, MOD:00160~GNO:G77252PU. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054701", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054701" } ] }, { "name": "choriogonadotropin subunit beta 3 N-glycosylated 8 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been N-glycosylated at the residue equivalent to Asn-33 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G78059CC. Example: UniProtKB:P0DN86-1, Asn-33, MOD:00160~GNO:G78059CC. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054702", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054702" } ] }, { "name": "choriogonadotropin subunit beta 3 N-glycosylated 9 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been N-glycosylated at the residue equivalent to Asn-33 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G86357DX. Example: UniProtKB:P0DN86-1, Asn-33, MOD:00160~GNO:G86357DX. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054703", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054703" } ] }, { "name": "choriogonadotropin subunit beta 3 N-glycosylated 10 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been N-glycosylated at the residue equivalent to Asn-50 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G14996IQ. Example: UniProtKB:P0DN86-1, Asn-50, MOD:00160~GNO:G14996IQ. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054704", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054704" } ] }, { "name": "choriogonadotropin subunit beta 3 N-glycosylated 11 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been N-glycosylated at the residue equivalent to Asn-50 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G17689DH. Example: UniProtKB:P0DN86-1, Asn-50, MOD:00160~GNO:G17689DH. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054705", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054705" } ] }, { "name": "choriogonadotropin subunit beta 3 N-glycosylated 12 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been N-glycosylated at the residue equivalent to Asn-50 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G29857RC. Example: UniProtKB:P0DN86-1, Asn-50, MOD:00160~GNO:G29857RC. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054706", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054706" } ] }, { "name": "choriogonadotropin subunit beta 3 N-glycosylated 13 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been N-glycosylated at the residue equivalent to Asn-50 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G36191CD. Example: UniProtKB:P0DN86-1, Asn-50, MOD:00160~GNO:G36191CD. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054707", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054707" } ] }, { "name": "choriogonadotropin subunit beta 3 N-glycosylated 14 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been N-glycosylated at the residue equivalent to Asn-50 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G43664YB. Example: UniProtKB:P0DN86-1, Asn-50, MOD:00160~GNO:G43664YB. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054708", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054708" } ] }, { "name": "choriogonadotropin subunit beta 3 N-glycosylated 15 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been N-glycosylated at the residue equivalent to Asn-50 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G69411IG. Example: UniProtKB:P0DN86-1, Asn-50, MOD:00160~GNO:G69411IG. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054709", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054709" } ] }, { "name": "choriogonadotropin subunit beta 3 N-glycosylated 16 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been N-glycosylated at the residue equivalent to Asn-50 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G77252PU. Example: UniProtKB:P0DN86-1, Asn-50, MOD:00160~GNO:G77252PU. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054710", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054710" } ] }, { "name": "choriogonadotropin subunit beta 3 N-glycosylated 17 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been N-glycosylated at the residue equivalent to Asn-50 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G78059CC. Example: UniProtKB:P0DN86-1, Asn-50, MOD:00160~GNO:G78059CC. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054711", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054711" } ] }, { "name": "choriogonadotropin subunit beta 3 N-glycosylated 18 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been N-glycosylated at the residue equivalent to Asn-50 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G86357DX. Example: UniProtKB:P0DN86-1, Asn-50, MOD:00160~GNO:G86357DX. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054712", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054712" } ] }, { "name": "choriogonadotropin subunit beta 3 O-glycosylated 1 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been O-glycosylated at the residue equivalent to Ser-141 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P0DN86-1, Ser-141, MOD:00002~GNO:G00031MO. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054713", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054713" } ] }, { "name": "choriogonadotropin subunit beta 3 O-glycosylated 2 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been O-glycosylated at the residue equivalent to Ser-141 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G01614ZM. Example: UniProtKB:P0DN86-1, Ser-141, MOD:00002~GNO:G01614ZM. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054714", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054714" } ] }, { "name": "choriogonadotropin subunit beta 3 O-glycosylated 3 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been O-glycosylated at the residue equivalent to Ser-141 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G07677VL. Example: UniProtKB:P0DN86-1, Ser-141, MOD:00002~GNO:G07677VL. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054715", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054715" } ] }, { "name": "choriogonadotropin subunit beta 3 O-glycosylated 4 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been O-glycosylated at the residue equivalent to Ser-141 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G60890ZT. Example: UniProtKB:P0DN86-1, Ser-141, MOD:00002~GNO:G60890ZT. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054716", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054716" } ] }, { "name": "choriogonadotropin subunit beta 3 O-glycosylated 5 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been O-glycosylated at the residue equivalent to Ser-141 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G64973KT. Example: UniProtKB:P0DN86-1, Ser-141, MOD:00002~GNO:G64973KT. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054717", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054717" } ] }, { "name": "choriogonadotropin subunit beta 3 O-glycosylated 6 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been O-glycosylated at the residue equivalent to Ser-141 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G97345NY. Example: UniProtKB:P0DN86-1, Ser-141, MOD:00002~GNO:G97345NY. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054718", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054718" } ] }, { "name": "choriogonadotropin subunit beta 3 O-glycosylated 7 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been O-glycosylated at the residue equivalent to Ser-147 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P0DN86-1, Ser-147, MOD:00002~GNO:G00031MO. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054719", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054719" } ] }, { "name": "choriogonadotropin subunit beta 3 O-glycosylated 8 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been O-glycosylated at the residue equivalent to Ser-147 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G01614ZM. Example: UniProtKB:P0DN86-1, Ser-147, MOD:00002~GNO:G01614ZM. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054720", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054720" } ] }, { "name": "choriogonadotropin subunit beta 3 O-glycosylated 9 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been O-glycosylated at the residue equivalent to Ser-147 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G07677VL. Example: UniProtKB:P0DN86-1, Ser-147, MOD:00002~GNO:G07677VL. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054721", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054721" } ] }, { "name": "choriogonadotropin subunit beta 3 O-glycosylated 10 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been O-glycosylated at the residue equivalent to Ser-147 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G60890ZT. Example: UniProtKB:P0DN86-1, Ser-147, MOD:00002~GNO:G60890ZT. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054722", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054722" } ] }, { "name": "choriogonadotropin subunit beta 3 O-glycosylated 11 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been O-glycosylated at the residue equivalent to Ser-147 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G64973KT. Example: UniProtKB:P0DN86-1, Ser-147, MOD:00002~GNO:G64973KT. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054723", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054723" } ] }, { "name": "choriogonadotropin subunit beta 3 O-glycosylated 12 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been O-glycosylated at the residue equivalent to Ser-147 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G97345NY. Example: UniProtKB:P0DN86-1, Ser-147, MOD:00002~GNO:G97345NY. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054724", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054724" } ] }, { "name": "choriogonadotropin subunit beta 3 O-glycosylated 13 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been O-glycosylated at the residue equivalent to Ser-152 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P0DN86-1, Ser-152, MOD:00002~GNO:G00031MO. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054725", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054725" } ] }, { "name": "choriogonadotropin subunit beta 3 O-glycosylated 14 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been O-glycosylated at the residue equivalent to Ser-152 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G01614ZM. Example: UniProtKB:P0DN86-1, Ser-152, MOD:00002~GNO:G01614ZM. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054726", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054726" } ] }, { "name": "choriogonadotropin subunit beta 3 O-glycosylated 15 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been O-glycosylated at the residue equivalent to Ser-152 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G07677VL. Example: UniProtKB:P0DN86-1, Ser-152, MOD:00002~GNO:G07677VL. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054727", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054727" } ] }, { "name": "choriogonadotropin subunit beta 3 O-glycosylated 16 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been O-glycosylated at the residue equivalent to Ser-152 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G60890ZT. Example: UniProtKB:P0DN86-1, Ser-152, MOD:00002~GNO:G60890ZT. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054728", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054728" } ] }, { "name": "choriogonadotropin subunit beta 3 O-glycosylated 17 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been O-glycosylated at the residue equivalent to Ser-152 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G64973KT. Example: UniProtKB:P0DN86-1, Ser-152, MOD:00002~GNO:G64973KT. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054729", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054729" } ] }, { "name": "choriogonadotropin subunit beta 3 O-glycosylated 18 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been O-glycosylated at the residue equivalent to Ser-158 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P0DN86-1, Ser-158, MOD:00002~GNO:G00031MO. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054730", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054730" } ] }, { "name": "choriogonadotropin subunit beta 3 O-glycosylated 19 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been O-glycosylated at the residue equivalent to Ser-158 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G01614ZM. Example: UniProtKB:P0DN86-1, Ser-158, MOD:00002~GNO:G01614ZM. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054731", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054731" } ] }, { "name": "choriogonadotropin subunit beta 3 O-glycosylated 20 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been O-glycosylated at the residue equivalent to Ser-158 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G07677VL. Example: UniProtKB:P0DN86-1, Ser-158, MOD:00002~GNO:G07677VL. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054732", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054732" } ] }, { "name": "choriogonadotropin subunit beta 3 O-glycosylated 21 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been O-glycosylated at the residue equivalent to Ser-158 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G60890ZT. Example: UniProtKB:P0DN86-1, Ser-158, MOD:00002~GNO:G60890ZT. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054733", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054733" } ] }, { "name": "choriogonadotropin subunit beta 3 O-glycosylated 22 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been O-glycosylated at the residue equivalent to Ser-158 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G64973KT. Example: UniProtKB:P0DN86-1, Ser-158, MOD:00002~GNO:G64973KT. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054734", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054734" } ] }, { "name": "choriogonadotropin subunit beta 3 O-glycosylated 23 (human)", "definition": "A choriogonadotropin subunit beta 3 (human) that has been O-glycosylated at the residue equivalent to Ser-158 of the amino acid sequence represented by UniProtKB:P0DN86-1, in which the glycan structure is represented by GlyTouCan:G97345NY. Example: UniProtKB:P0DN86-1, Ser-158, MOD:00002~GNO:G97345NY. [PRO:DNx, PMID:1374031, PMID:1820200, PMID:468798, PMID:9449027]", "evidence": [ { "id": "PR:000054735", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054735" } ] } ], "site_annotation": [ { "start_pos": 33, "end_pos": 35, "annotation": "n_glycosylation_sequon" }, { "start_pos": 50, "end_pos": 52, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 33, 50, 78 ], "o_linked_sites": [ 138, 141, 147, 152, 158 ], "snv_sites": [ 33, 35, 50, 52, 137, 138, 141, 147, 152, 158 ], "glycation_sites": [], "phosphorylation_sites": [ 86, 116, 117 ], "sequon_annotation_sites": [ { "start_pos": 33, "end_pos": 35 }, { "start_pos": 50, "end_pos": 52 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 91 }, { "field": "total_sites", "count": 9 }, { "field": "n_linked_glycans", "count": 28 }, { "field": "n_linked_glycan_sites", "count": 5 }, { "field": "o_linked_glycans", "count": 15 }, { "field": "o_linked_glycan_sites", "count": 10 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 4 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 83 }, { "field": "total_sites", "count": 7 }, { "field": "n_linked_glycans", "count": 28 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 15 }, { "field": "o_linked_glycan_sites", "count": 5 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 17 }, { "field": "total_sites", "count": 10 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 17 }, { "field": "total_sites", "count": 10 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 50 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }