{ "uniprot_canonical_ac": "P0DN84-1", "uniprot_ac": "P0DN84", "uniprot_id": "DWORF_HUMAN", "mass": { "chemical_mass": 3836.0, "monoisotopic_mass": 3836.0 }, "refseq": {}, "gene_names": [ { "name": "STRIT1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P0DN84", "id": "P0DN84" }, { "name": "DWORF", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P0DN84", "id": "P0DN84" } ], "protein_names": [ { "name": "Sarcoplasmic/endoplasmic reticulum calcium ATPase regulator DWORF", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P0DN84" }, { "name": "DWORF", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DN84" }, { "name": "Dwarf open reading frame", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DN84" }, { "name": "SERCA regulator DWORF", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DN84" }, { "name": "Small transmembrane regulator of ion transport 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DN84" } ], "function": [ { "annotation": "Enhances the activity of ATP2A1/SERCA1 ATPase in sarcoplasmic reticulum by displacing ATP2A1/SERCA1 inhibitors, thereby acting as a key regulator of skeletal muscle activity. Does not directly stimulate SERCA pump activity. Enhances sarcoplasmic reticulum Ca(2+) uptake and myocyte contractility by displacing the SERCA inhibitory peptides sarcolipin (SLN), phospholamban (PLN) and myoregulin (MRLN).", "evidence": [ { "database": "UniProtKB", "id": "P0DN84", "url": "https://www.uniprot.org/uniprot/P0DN84#function" }, { "database": "UniProtKB", "id": "P0DN83", "url": "https://www.uniprot.org/uniprot/P0DN83#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DN84", "url": "https://www.uniprot.org/uniprot/P0DN84" } ], "common_name": "Human" } ], "gene": [ { "name": "STRIT1", "url": "https://www.uniprot.org/uniprot/P0DN84", "locus": { "chromosome": "3", "start_pos": 155290227, "end_pos": 155293683, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000240045", "url": "https://www.ensembl.org/id/ENSG00000240045" } ] } } ], "crossref": [ { "id": "ENSG00000240045", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240045", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd20247", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20247", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "STRIT1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=STRIT1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "52297", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=52297", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P0DN84", "url": "https://www.ebi.ac.uk/intact/interactors/id:P0DN84*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR044529", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044529", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "616891", "url": "http://www.omim.org/entry/616891", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P0DN84", "url": "https://www.nextprot.org/entry/NX_P0DN84", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "4035299at2759", "url": "http://www.orthodb.org/?query=4035299at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "7MPA", "url": "https://www.rcsb.org/structure/7MPA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "P0DN84", "url": "https://pharos.nih.gov/targets/P0DN84", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P0DN84", "url": "http://purl.obolibrary.org/obo/PR_P0DN84", "database": "PRO", "categories": [ "Protein" ] }, { "id": "P0DN84", "url": "https://www.uniprot.org/uniprot/P0DN84", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0DN84-1", "url": "https://www.uniprot.org/uniprot/P0DN84-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAEKAGSTFSHLLVPILLLIGWIVGCIIMIYVVFS", "length": 35, "header": "sp|P0DN84-1|DWORF_HUMAN Isoform 1 of Sarcoplasmic/endoplasmic reticulum calcium ATPase regulator DWORF OS=Homo sapiens OX=9606 GN=STRIT1 PE=1 SV=2 CANONICAL=P0DN84-1" }, "isoforms": [ { "isoform_ac": "P0DN84-1", "url": "", "sequence": { "sequence": "MAEKAGSTFSHLLVPILLLIGWIVGCIIMIYVVFS", "length": 35, "header": "sp|P0DN84-1|DWORF_HUMAN Isoform 1 of Sarcoplasmic/endoplasmic reticulum calcium ATPase regulator DWORF OS=Homo sapiens OX=9606 GN=STRIT1 PE=1 SV=2 CANONICAL=P0DN84-1" }, "locus": { "chromosome": "3", "start_pos": 155293632, "end_pos": 155290947, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000489090.2", "url": "https://www.ensembl.org/id/ENST00000489090.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000489859.1", "url": "https://www.ensembl.org/id/ENSP00000489859.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Muscle physiology. A peptide encoded by a transcript annotated as long noncoding RNA enhances SERCA activity in muscle.", "journal": "Science", "date": "2016", "authors": "Nelson BR, Makarewich CA, Anderson DM, Winders BR, Troupes CD, Wu F, Reese AL, McAnally JR, Chen X, Kavalali ET, Cannon SC, Houser SR, Bassel-Duby R, Olson EN", "evidence": [ { "database": "UniProtKB", "id": "P0DN84", "url": "https://www.uniprot.org/uniprot/P0DN84" } ], "reference": [ { "type": "PubMed", "id": "26816378", "url": "https://glygen.org/publication/PubMed/26816378" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "regulation of slow-twitch skeletal muscle fiber contraction", "id": "GO:0031449", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031449", "evidence": [ { "database": "UniProtKB", "id": "P0DN84", "url": "https://www.uniprot.org/uniprot/P0DN84" } ], "pmid": "" }, { "name": "regulation of ATPase-coupled calcium transmembrane transporter activity", "id": "GO:1901894", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901894", "evidence": [ { "database": "UniProtKB", "id": "P0DN84", "url": "https://www.uniprot.org/uniprot/P0DN84" } ], "pmid": "" }, { "name": "positive regulation of calcium ion import into sarcoplasmic reticulum", "id": "GO:1902082", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902082", "evidence": [ { "database": "UniProtKB", "id": "P0DN84", "url": "https://www.uniprot.org/uniprot/P0DN84" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "enzyme activator activity", "id": "GO:0008047", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008047", "evidence": [ { "database": "UniProtKB", "id": "P0DN84", "url": "https://www.uniprot.org/uniprot/P0DN84" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "sarcoplasmic reticulum membrane", "id": "GO:0033017", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033017", "evidence": [ { "database": "UniProtKB", "id": "P0DN84", "url": "https://www.uniprot.org/uniprot/P0DN84" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }