{ "uniprot_canonical_ac": "P0DN82-1", "uniprot_ac": "P0DN82", "uniprot_id": "O12D1_HUMAN", "mass": { "chemical_mass": 36420.0, "monoisotopic_mass": 36420.0 }, "refseq": { "ac": "NP_001335137", "name": "olfactory receptor 12D1", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. This olfactory receptor gene is a segregating pseudogene, where some individuals have an allele that encodes a functional olfactory receptor, while other individuals have an allele encoding a protein that is predicted to be non-functional. [provided by RefSeq, Jan 2017].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335137" }, "gene_names": [ { "name": "OR12D1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P0DN82", "id": "P0DN82" }, { "name": "OR12D1P", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P0DN82", "id": "P0DN82" }, { "name": "OR12D1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335137", "id": "NP_001335137" }, { "name": "hs6M1-19; OR12D1P", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335137", "id": "NP_001335137" } ], "protein_names": [ { "name": "Olfactory receptor 12D1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P0DN82" }, { "name": "olfactory receptor 12D1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335137", "id": "NP_001335137" }, { "name": "olfactory receptor, family 12, subfamily D, member 1 pseudogene; olfactory receptor 12D1 pseudogene", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335137", "id": "NP_001335137" } ], "function": [ { "annotation": "Odorant receptor.", "evidence": [ { "database": "UniProtKB", "id": "P0DN82", "url": "https://www.uniprot.org/uniprot/P0DN82#function" } ] }, { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. This olfactory receptor gene is a segregating pseudogene, where some individuals have an allele that encodes a functional olfactory receptor, while other individuals have an allele encoding a protein that is predicted to be non-functional. [provided by RefSeq, Jan 2017].", "evidence": [ { "database": "RefSeq", "id": "NP_001335137", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335137" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P0DN82", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DN82" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P0DN82", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DN82" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P0DN82", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DN82" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DN82", "url": "https://www.uniprot.org/uniprot/P0DN82" } ], "common_name": "Human" } ], "gene": [ { "name": "OR12D1", "url": "https://www.uniprot.org/uniprot/P0DN82", "locus": { "chromosome": "6", "start_pos": 29418905, "end_pos": 29414928, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000251608", "url": "https://www.ensembl.org/id/ENSG00000251608" } ] } } ], "crossref": [ { "id": "cd15915", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15915", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "OR12D1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=OR12D1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "26530", "url": "https://www.ncbi.nlm.nih.gov/gene/26530", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "8177", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=8177", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "NX_P0DN82", "url": "https://www.nextprot.org/entry/NX_P0DN82", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "PTHR26453", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR26453", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR26453:SF683", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR26453:SF683", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "http://pfam.xfam.org/family/PF13853", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P0DN82", "url": "https://pharos.nih.gov/targets/P0DN82", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P0DN82", "url": "http://purl.obolibrary.org/obo/PR_P0DN82", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001335137", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335137", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P0DN82", "url": "https://www.uniprot.org/uniprot/P0DN82", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0DN82-1", "url": "https://www.uniprot.org/uniprot/P0DN82-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLNTTSVTEFLLLGVTDIQELQPFLFVVFLTIYFISVAGNGAILMIVISDPRLHSPMYFFLGNLSCLDICYSSVTLPKMLQNFLSAHKAISFLGCISQLHFFHFLGSTEAMLLAVMAFDRFVAICKPLRYTVIMNPQLCTQMAITIWMIGFFHALLHSLMTSRLNFCGSNRIYHFFCDVKPLLKLACGNTELNQWLLSTVTGTIAMGPFFLTLLSYFYIITHLFFKTHSFSMLRKALSTCASHFMVVILLYAPVLFTYIHHASGTSMDQDRITAIMYTVVTPVLNPLIYTLRNKEVKGAFNRAMKRWLWPKEILKNSSEA", "length": 320, "header": "sp|P0DN82-1|O12D1_HUMAN Isoform 1 of Olfactory receptor 12D1 OS=Homo sapiens OX=9606 GN=OR12D1 PE=3 SV=2 CANONICAL=P0DN82-1" }, "isoforms": [ { "isoform_ac": "P0DN82-1", "url": "", "sequence": { "sequence": "MLNTTSVTEFLLLGVTDIQELQPFLFVVFLTIYFISVAGNGAILMIVISDPRLHSPMYFFLGNLSCLDICYSSVTLPKMLQNFLSAHKAISFLGCISQLHFFHFLGSTEAMLLAVMAFDRFVAICKPLRYTVIMNPQLCTQMAITIWMIGFFHALLHSLMTSRLNFCGSNRIYHFFCDVKPLLKLACGNTELNQWLLSTVTGTIAMGPFFLTLLSYFYIITHLFFKTHSFSMLRKALSTCASHFMVVILLYAPVLFTYIHHASGTSMDQDRITAIMYTVVTPVLNPLIYTLRNKEVKGAFNRAMKRWLWPKEILKNSSEA", "length": 320, "header": "sp|P0DN82-1|O12D1_HUMAN Isoform 1 of Olfactory receptor 12D1 OS=Homo sapiens OX=9606 GN=OR12D1 PE=3 SV=2 CANONICAL=P0DN82-1" }, "locus": { "chromosome": "HSCHR6_MHC_DBB_CTG1", "start_pos": 683753, "end_pos": 682794, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000703726.1", "url": "https://www.ensembl.org/id/ENST00000703726.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000515451.1", "url": "https://www.ensembl.org/id/ENSP00000515451.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 3, "start_aa": "Asn", "end_pos": 3, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3", "evidence": [ { "id": "P0DN82", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DN82#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Personal receptor repertoires: olfaction as a model.", "journal": "BMC Genomics", "date": "2012", "authors": "Olender Tsviya, Waszak Sebastian M, Viavant Maya, Khen Miriam, Ben-Asher Edna, Reyes Alejandro, Nativ Noam, Wysocki Charles J, Ge Dongliang, Lancet Doron", "evidence": [ { "database": "UniProtKB", "id": "P0DN82", "url": "https://www.uniprot.org/uniprot/P0DN82" } ], "reference": [ { "type": "PubMed", "id": "22908908", "url": "https://glygen.org/publication/PubMed/22908908" } ] } ], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "B2RT33-1", "protein_name": "Olfactory receptor", "gene_name": "Or12d2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSNQTSVTEFLLLGVTDIQELNPILFVVFFTIYFVNITGNGAILMIVILDPRLHSPMYFFLGNLACLDICFSTVTLPKMLQNLLSTSKAISFLGCITQLHFFHFLGSTEAMLLPVMAFDRFVAICRPLHYSVIMNHQLCIHMTVTIWTLGFFHALLHSVMTSRLSFCGPNHVHHFFCDIKPLLDLACGNTELNLWLLNTVTGTIALTPFFLTFLSYFYIITYLFLKTRSCSMLHKALSTCASHFMVVILLYVPVLFTYIRPASGSSLDQDRIIAIMYSVVTPALNPLIYTLRNKEVRSALNRKVRRWL", "length": 308 }, "evidence": [ { "id": "45916918", "url": "http://www.informatics.jax.org/homology/45916918", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "D4ACU7-1", "protein_name": "Olfactory receptor", "gene_name": "Or12d13", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSAPTSVSQGGKSVLLNQTLFTEFLLLGVTDIQELNPILFVTVLAMYFVNVFGNGAIMMIVILDPRLHSPMYFFLGNLACLDICFSTVTVPKMLENFFSTSKAISFLGCITQLHFFHFLGSTEALLLTVMAFDRFVAICRPLHYPSIMNRQVCIQVAVSIWAIPFLHALVHSILTSRLNFCGSNHIHHFFCDVKPLLELACGNTELNRWLLNTLTGTVAIGLFFLTFLSYFYIISYLFLKTHSCSMLHKALSTCASHFMVVIIFYAPVLFIYINPDSGSSLEKDRIIAVMYTVVTPALNPLIYTLRNKEVRGALNRKIRIQL", "length": 322 }, "evidence": [ { "id": "45916893", "url": "http://www.informatics.jax.org/homology/45916893", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "M0RDZ2-1", "protein_name": "Olfactory receptor", "gene_name": "Or12d14c", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGVTDIQELNPILFLTFLVMYFVNVFGNGSILMIVILDPRLHSPMYFFLGNLACVDICFSTVTVPKMLENFFSTSKAISFLGCITQLYLFHFLGSTEALLLTVMAFDRFVAICRPLHYPSIMNSHVCIQLTVVIWAIPFIPALLHSILTSQLSFCGSNHVHHFFCDVKPLLELACGNTELNRWLLNTFTGTVAIALFFLTFLSYFYIITYLFLKTRSCSMLHKALSTCASHVMVVIIFYAPVLFIYINPDSRSSLEKDRIIAVMYTVVTPALNPLIYTLRNKEVRGALNRKIRIQL", "length": 296 }, "evidence": [ { "id": "45916497", "url": "http://www.informatics.jax.org/homology/45916497", "database": "MGI" }, { "id": "45916495", "url": "http://www.informatics.jax.org/homology/45916495", "database": "MGI" }, { "id": "45916499", "url": "http://www.informatics.jax.org/homology/45916499", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P58182-1", "protein_name": "Olfactory receptor 12D2", "gene_name": "OR12D2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MLNTTSVTEFLLLGVTDIQELQPFLFVVFLTIYFISVTGNGAVLMIVISDPRLHSLMYFFLGNLSYLDICYSTVTLPKMLQNFLSTHKAISFLGCISQLHFFHSLGSTESMLFAVMAFDLSVAICKPLRYTVIMNPQLCTQMAITIWVIGFFHALLHSVMTSRLNFCGSNRIHHFLCDIKPLLKLACGNTELNQWLLSTVTGTIAMGPFFLTLLSYFYIITYLFFKTRSCSMLCKALSTCASHFMVVILFYAPVLFTYIHPALESFMDQDRIVAIMYTVVTPVLNPLIYTLRNKEVKGALGRVIRRL", "length": 307 }, "evidence": [ { "id": "45916893", "url": "http://www.informatics.jax.org/homology/45916893", "database": "MGI" }, { "id": "45916887", "url": "http://www.informatics.jax.org/homology/45916887", "database": "MGI" }, { "id": "45916497", "url": "http://www.informatics.jax.org/homology/45916497", "database": "MGI" }, { "id": "45916495", "url": "http://www.informatics.jax.org/homology/45916495", "database": "MGI" }, { "id": "45916499", "url": "http://www.informatics.jax.org/homology/45916499", "database": "MGI" }, { "id": "45916918", "url": "http://www.informatics.jax.org/homology/45916918", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q6MFW4-1", "protein_name": "Olfactory receptor", "gene_name": "Or12d2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSNQTSVTEFLLLGVTDIQELNPILFVIFFTIYFVNITGNGAILMIVILDPRLHSPMYFFLGNLACLDICFSTVTVPKMLENLLSTSKAISFLGCITQLHFFHFLGSTEALLLPVMAFDRFVAICRPLHYSVIMNRQLCSHMTVTIWIMGFLHALLHSVMTSRLSFCGPNHVHHFFCDIKPLLDLACGNTELNLWLLNTVTGTIALTPFFLTFLSYFYIITYLFLKTHSCSMLHKALSTCASHFMVVILLYVPVLFNYIRPASSSALDQERIIAIMYSVVTPALNPLIYTLRNKEVRNALNKKVRRWL", "length": 308 }, "evidence": [ { "id": "45916887", "url": "http://www.informatics.jax.org/homology/45916887", "database": "MGI" }, { "id": "45916918", "url": "http://www.informatics.jax.org/homology/45916918", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q6MFW5-1", "protein_name": "Olfactory receptor", "gene_name": "Or12d2b", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSNQTSVTEFLLLGVTDIQELNPILFVIFFTIYFVNITGNGAILMIVILDPRLHSPMYFFLGNLACLDICFSTVTVPKMLENLLSTSKAISFLGCITQLHFFHFLGSTEALLLPVMAFDRFVAICRPLHYSVIMNRQLCSHMTVTIWIIGFLHALLHSVMTSRLSFCGPNHVHHFFCDVKPLLDLACGNTELNLWLLNTVTGTIALTPFFLTFLSYFYIITYLLFKTRSCSMLHKALSTCASHFMVVCLFYAPVLFIYIRPSSGSSLDQERIIAIMYSVVTPALNPLIYTLRNKEVRSALNRKVRRWL", "length": 308 }, "evidence": [ { "id": "45916887", "url": "http://www.informatics.jax.org/homology/45916887", "database": "MGI" }, { "id": "45916918", "url": "http://www.informatics.jax.org/homology/45916918", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q6MFW6-1", "protein_name": "Olfactory receptor", "gene_name": "Or12d2c", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSNQTSVTEFLLLGVTDIQELNPILFVIFFTIYSVNITGNGAILMIVILDPRLHSPMYFFLGNLACLDICYSTVTVPKMLENLLSTSKAISFLGCITQLHFFHFLGSTEALLLPVMAFDRFVAICRPLHYSVIMNRQLCSHMTVTIWIMGFLHALLHSVMTSRLSFCGPNHVHHFFCDIKPLLELACGNTELNLWLLNTVTGTIALTPFFLTFLSYFYIITYLFLKTRSCSMLHKALSTCASHFMVVILFYAPVLFTYICPTSGSAPDQDRIIAIMYSVVTPALNPLIYTLRNKEVRSALYRKVRKWL", "length": 308 }, "evidence": [ { "id": "45916887", "url": "http://www.informatics.jax.org/homology/45916887", "database": "MGI" }, { "id": "45916918", "url": "http://www.informatics.jax.org/homology/45916918", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q920Y8-1", "protein_name": "Olfactory receptor", "gene_name": "Or12d13", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MLNQTSVTEFILLGVRDIQEPQPFLFAIFFTIYFVNITGNGAILMIVILDPRLHSPMYFFLGNLACLDISYSTVTVPKMLENLLSTNKAISLLGCITQLHFFHFLGTTESLLLAVMAFDRFVAICRPLHYSVIMNWQVCILMAVTIWTIAFLHALLHSVMTSRLSFCGLNHIHHFFCDVKPLLELACGNTELNLWLLNTVTGTIASVPFFLTFLSYFYIITYLFLKTRSCSMLHKALSTCASHFMVVVLFYAPVLFTYIRPTSGSSLDQDRIIAIMYSVVTPALNPLIYTLRNKEVRSALNRKVRRCLLLEEI", "length": 313 }, "evidence": [ { "id": "45916893", "url": "http://www.informatics.jax.org/homology/45916893", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q920Z0-1", "protein_name": "Olfactory receptor", "gene_name": "Or12d12", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSNQTSVTEFLLLGVTDIQELNPILFVIFFTIYFINITGNGAILMIVILDPRLHSPMYFFLGNLACLDISYSTVTVPKLLQNLLSTSKAISFLGCITQLHFFHFLGSTETMLLPVMAFDRFVAICRPLHYSVIMNHQLCIHMTVTIWTLGFFHALLHSVMTSRLSFCGPNHVHHFFCDIKPLLDLACGNTELNLWLLNTVTGTIALTSFFLIFLSYFYIITNLLLKTRSCSMLHKALSTCASHFMVVVLFYAPVLFTYIRPASGSSLDQDTIIAIMYSVVTPALNPLIYTLRNKEVRSALNRKVRRWL", "length": 308 }, "evidence": [ { "id": "45916887", "url": "http://www.informatics.jax.org/homology/45916887", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "P0DN82", "url": "https://www.uniprot.org/uniprot/P0DN82" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "P0DN82", "url": "https://www.uniprot.org/uniprot/P0DN82" } ], "pmid": "" }, { "name": "odorant binding", "id": "GO:0005549", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005549", "evidence": [ { "database": "UniProtKB", "id": "P0DN82", "url": "https://www.uniprot.org/uniprot/P0DN82" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P0DN82", "url": "https://www.uniprot.org/uniprot/P0DN82" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "detection of chemical stimulus involved in sensory perception of smell", "id": "GO:0050911", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050911", "evidence": [ { "database": "UniProtKB", "id": "P0DN82", "url": "https://www.uniprot.org/uniprot/P0DN82" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 316, "end_pos": 318, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3, "end_pos": 5, "annotation": "n_glycosylation_sequon" }, { "start_pos": 63, "end_pos": 65, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 3 ], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 316, "end_pos": 318 }, { "start_pos": 3, "end_pos": 5 }, { "start_pos": 63, "end_pos": 65 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }