{
    "uniprot_canonical_ac": "P0DMV0-1",
    "uniprot_ac": "P0DMV0",
    "uniprot_id": "CT457_HUMAN",
    "mass": {
        "chemical_mass": 21232.0,
        "monoisotopic_mass": 21232.0
    },
    "refseq": {
        "ac": "NP_001007552",
        "name": "cancer/testis antigen family 45 member A5",
        "summary": "This gene represents one of a cluster of several similar genes located on the q arm of chromosome X. The genes in this cluster encode members of the cancer/testis (CT) family of antigens, and are distinct from other CT antigens. These antigens are thought to be novel therapeutic targets for human cancers. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014].",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007552"
    },
    "gene_names": [
        {
            "name": "CT45A7",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/P0DMV0",
            "id": "P0DMV0"
        },
        {
            "name": "CT45-3; CT45-4; CT45-6; CT45.5; CT455; CT45A3; CT45A4; CT45A6; CT45A7",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007552",
            "id": "NP_001007552"
        },
        {
            "name": "CT45A5",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007552",
            "id": "NP_001007552"
        }
    ],
    "protein_names": [
        {
            "name": "Cancer/testis antigen family 45 member A7",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "P0DMV0"
        },
        {
            "name": "Cancer/testis antigen 45A7",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P0DMV0"
        },
        {
            "name": "cancer/testis antigen CT45-5; cancer/testis antigen 45-5; cancer/testis antigen 45A5; Cancer/testis antigen family 45 member A6; Cancer/testis antigen 45-6; Cancer/testis antigen 45A6; Cancer/testis antigen family 45 member A7; Cancer/testis antigen 45A7; Cancer/testis antigen family 45 member A3; Cancer/testis antigen 45-3; Cancer/testis antigen 45-4; Cancer/testis antigen 45A3; Cancer/testis antigen 45A4; Cancer/testis antigen family 45 member A4",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007552",
            "id": "NP_001007552"
        },
        {
            "name": "cancer/testis antigen family 45 member A5",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007552",
            "id": "NP_001007552"
        }
    ],
    "function": [
        {
            "annotation": "This gene represents one of a cluster of several similar genes located on the q arm of chromosome X. The genes in this cluster encode members of the cancer/testis (CT) family of antigens, and are distinct from other CT antigens. These antigens are thought to be novel therapeutic targets for human cancers. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014].",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001007552",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007552"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Homo sapiens",
            "taxid": 9606,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P0DMV0",
                    "url": "https://www.uniprot.org/uniprot/P0DMV0"
                }
            ],
            "common_name": "Human"
        }
    ],
    "gene": [
        {
            "name": "CT45A7",
            "url": "https://www.uniprot.org/uniprot/P0DMV0",
            "locus": {
                "chromosome": "X",
                "start_pos": 135829229,
                "end_pos": 135837280,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSG00000273696",
                        "url": "https://www.ensembl.org/id/ENSG00000273696"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSG00000273696",
            "url": "https://bgee.org/?page=gene&gene_id=ENSG00000273696",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "CT45A7",
            "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CT45A7",
            "database": "GeneCards",
            "categories": [
                "Gene Annotation",
                "Organism-specific"
            ]
        },
        {
            "id": "101060211",
            "url": "https://www.ncbi.nlm.nih.gov/gene/101060211",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "441521",
            "url": "https://www.ncbi.nlm.nih.gov/gene/441521",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "541465",
            "url": "https://www.ncbi.nlm.nih.gov/gene/541465",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "51260",
            "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=51260",
            "database": "HGNC",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "P0DMV0",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:P0DMV0*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR029307",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR029307",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "hsa:101060211",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:101060211",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "hsa:441521",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:441521",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "hsa:541465",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:541465",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "NX_P0DMV0",
            "url": "https://www.nextprot.org/entry/NX_P0DMV0",
            "database": "neXtProt",
            "categories": [
                "Protein",
                "Organism-specific"
            ]
        },
        {
            "id": "EIKCALM",
            "url": "https://omabrowser.org/oma/group/EIKCALM/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "4834110at2759",
            "url": "http://www.orthodb.org/?query=4834110at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR12957",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12957",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR12957:SF2",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12957:SF2",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF15300",
            "url": "http://pfam.xfam.org/family/PF15300",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "P0DMV0",
            "url": "https://pharos.nih.gov/targets/P0DMV0",
            "database": "PHAROS",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "PR_P0DMV0",
            "url": "http://purl.obolibrary.org/obo/PR_P0DMV0",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_001007552",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007552",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P0DMV0",
            "url": "https://www.uniprot.org/uniprot/P0DMV0",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P0DMV0-1",
            "url": "https://www.uniprot.org/uniprot/P0DMV0-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLDSQIDDFTGFSKDGMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI",
        "length": 189,
        "header": "sp|P0DMV0-1|CT457_HUMAN Isoform 1 of Cancer/testis antigen family 45 member A7  OS=Homo sapiens OX=9606 GN=CT45A7 PE=3 SV=1 CANONICAL=P0DMV0-1"
    },
    "isoforms": [
        {
            "isoform_ac": "P0DMV0-1",
            "url": "",
            "sequence": {
                "sequence": "MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLDSQIDDFTGFSKDGMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI",
                "length": 189,
                "header": "sp|P0DMV0-1|CT457_HUMAN Isoform 1 of Cancer/testis antigen family 45 member A7  OS=Homo sapiens OX=9606 GN=CT45A7 PE=3 SV=1 CANONICAL=P0DMV0-1"
            },
            "locus": {
                "chromosome": "X",
                "start_pos": 135833533,
                "end_pos": 135829443,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000610598.5",
                        "url": "https://www.ensembl.org/id/ENST00000610598.5"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000482241.1",
                        "url": "https://www.ensembl.org/id/ENSP00000482241.1"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [],
    "pathway": [
        {
            "id": "hsa:101060211",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:101060211",
            "resource": "KEGG Pathway"
        },
        {
            "id": "hsa:441521",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:441521",
            "resource": "KEGG Pathway"
        },
        {
            "id": "hsa:541465",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:541465",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "P0DMU9-1",
            "protein_name": "Cancer/testis antigen family 45 member A10",
            "gene_name": "CT45A10",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLDSQIDDFTGFSKDGMMQKPGSNAPVGGNVTSNFSGDDLECRGIASSPKSQQEINADIKCQVVKEIRCLGRKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI",
                "length": 189
            },
            "evidence": [
                {
                    "id": "45933449",
                    "url": "http://www.informatics.jax.org/homology/45933449",
                    "database": "MGI"
                }
            ],
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "P0DMV2-1",
            "protein_name": "Cancer/testis antigen family 45 member A9",
            "gene_name": "CT45A9",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLDSQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETAFSPKSQQEINADIKRQLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI",
                "length": 189
            },
            "evidence": [
                {
                    "id": "45933449",
                    "url": "http://www.informatics.jax.org/homology/45933449",
                    "database": "MGI"
                }
            ],
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "Q3UJ22-1",
            "protein_name": "Gene model 648, (NCBI)",
            "gene_name": "Ct45a",
            "tax_id": 10090,
            "organism": "Mus musculus",
            "sequence": {
                "sequence": "MLKRKISPVGEGEAMGPAKKNYTLDMVSHKSLEASAEAKGEGALVSQKAQVGMVEADPKVYAQNCASKQLMPVTGEAVLPMPGDSQTEDSLHRKDGGHDTVVGGSVNSDSSEGTAKAPAMSSSEAQPYVSSLRPNLSNYEIKCALMTEIRRFGRQYGRLFKILQEVQGPVEVRIQFVEFSIKEAARFKRRHLIQYLEKILEKLKSERSSNNDE",
                "length": 213
            },
            "evidence": [
                {
                    "id": "45933449",
                    "url": "http://www.informatics.jax.org/homology/45933449",
                    "database": "MGI"
                }
            ],
            "common_name": "Mouse"
        },
        {
            "uniprot_canonical_ac": "Q5HYN5-1",
            "protein_name": "Cancer/testis antigen family 45 member A1",
            "gene_name": "CT45A1",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKAKKLMTGHAIPPSQLDSQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI",
                "length": 189
            },
            "evidence": [
                {
                    "id": "45933449",
                    "url": "http://www.informatics.jax.org/homology/45933449",
                    "database": "MGI"
                }
            ],
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "Q8NHU0-1",
            "protein_name": "Cancer/testis antigen family 45 member A3",
            "gene_name": "CT45A3",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLDSQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI",
                "length": 189
            },
            "evidence": [
                {
                    "id": "45933449",
                    "url": "http://www.informatics.jax.org/homology/45933449",
                    "database": "MGI"
                }
            ],
            "common_name": "Human"
        }
    ],
    "go_annotation": {},
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 97,
            "end_pos": 99,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        }
    ],
    "sequence_features": {
        "n_linked_sites": [],
        "o_linked_sites": [],
        "snv_sites": [],
        "glycation_sites": [],
        "phosphorylation_sites": [],
        "sequon_annotation_sites": [
            {
                "start_pos": 97,
                "end_pos": 99
            }
        ]
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                }
            ],
            "sort_fields": []
        }
    ]
}