{ "uniprot_canonical_ac": "P0DJD7-1", "uniprot_ac": "P0DJD7", "uniprot_id": "PEPA4_HUMAN", "mass": { "chemical_mass": 41977.0, "monoisotopic_mass": 41977.0 }, "refseq": { "ac": "NP_001073276", "name": "pepsin A-4 preproprotein", "summary": "This gene encodes a protein precursor of the digestive enzyme pepsin, a member of the peptidase A1 family of endopeptidases. The encoded precursor is secreted by gastric chief cells and undergoes autocatalytic cleavage in acidic conditions to form the active enzyme, which functions in the digestion of dietary proteins. This gene is found in a cluster of related genes on chromosome 11, each of which encodes one of multiple pepsinogens. Pepsinogen levels in serum may serve as a biomarker for atrophic gastritis and gastric cancer. [provided by RefSeq, Jul 2015].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001073276" }, "gene_names": [ { "name": "PGA3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P0DJD7", "id": "P0DJD7" }, { "name": "PGA4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P0DJD7", "id": "P0DJD7" }, { "name": "PGA3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P0DJD7", "id": "P0DJD7" }, { "name": "PGA4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001073276", "id": "NP_001073276" }, { "name": "PGA4", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P0DJD7", "id": "P0DJD7" } ], "protein_names": [ { "name": "Pepsin A-4", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P0DJD7" }, { "name": "3.4.23.1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DJD7" }, { "name": "Pepsinogen-4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0DJD7" }, { "name": "pepsin A-4 preproprotein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001073276", "id": "NP_001073276" }, { "name": "pepsinogen-4; pepsinogen 4, group I (pepsinogen A); pepsin A-4; pregnancy-associated glycoprotein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001073276", "id": "NP_001073276" } ], "function": [ { "annotation": "Shows particularly broad specificity; although bonds involving phenylalanine and leucine are preferred, many others are also cleaved to some extent.", "evidence": [ { "database": "UniProtKB", "id": "P0DJD7", "url": "https://www.uniprot.org/uniprot/P0DJD7#function" } ] }, { "annotation": "This gene encodes a protein precursor of the digestive enzyme pepsin, a member of the peptidase A1 family of endopeptidases. The encoded precursor is secreted by gastric chief cells and undergoes autocatalytic cleavage in acidic conditions to form the active enzyme, which functions in the digestion of dietary proteins. This gene is found in a cluster of related genes on chromosome 11, each of which encodes one of multiple pepsinogens. Pepsinogen levels in serum may serve as a biomarker for atrophic gastritis and gastric cancer. [provided by RefSeq, Jul 2015].", "evidence": [ { "database": "RefSeq", "id": "NP_001073276", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001073276" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "75.56", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000229183", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000229183" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "99.97", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000229183", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000229183" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "92.28", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000229183", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000229183" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "56.63", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000229183", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000229183" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "89.3", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000229183", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000229183" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "73.16", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000229183", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000229183" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "39.59", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000229183", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000229183" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "82.3", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000229183", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000229183" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "74.69", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000229183", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000229183" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P0DJD7", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DJD7" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P0DJD7", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DJD7" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P0DJD7", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DJD7" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P0DJD7", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0DJD7" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DJD7", "url": "https://www.uniprot.org/uniprot/P0DJD7" } ], "common_name": "Human" } ], "gene": [ { "name": "PGA4", "url": "https://www.uniprot.org/uniprot/P0DJD7", "locus": { "chromosome": "11", "start_pos": 61231694, "end_pos": 61222347, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000229183", "url": "https://www.ensembl.org/id/ENSG00000229183" } ] } } ], "crossref": [ { "id": "ENSG00000229183", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000229183", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "ENSG00000229859", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000229859", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd05478", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05478", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "PGA4", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=PGA4", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "643847", "url": "https://www.ncbi.nlm.nih.gov/gene/643847", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "8885", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=8885", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "8886", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=8886", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P0DJD7", "url": "https://www.ebi.ac.uk/intact/interactors/id:P0DJD7*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001461", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001461", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001969", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001969", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012848", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012848", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR021109", "url": "https://www.ebi.ac.uk/interpro/entry/IPR021109", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033121", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033121", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034162", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034162", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:643847", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:643847", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "169700", "url": "http://www.omim.org/entry/169700", "database": "MIM", "categories": [ "Other" ] }, { "id": "169720", "url": "http://www.omim.org/entry/169720", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P0DJD7", "url": "https://www.nextprot.org/entry/NX_P0DJD7", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "ENYMDME", "url": "https://omabrowser.org/oma/group/ENYMDME/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "WAGTISV", "url": "https://omabrowser.org/oma/group/WAGTISV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1120702at2759", "url": "http://www.orthodb.org/?query=1120702at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR47966", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47966", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR47966:SF22", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47966:SF22", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1FLH", "url": "https://www.rcsb.org/structure/1FLH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1PSN", "url": "https://www.rcsb.org/structure/1PSN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1PSO", "url": "https://www.rcsb.org/structure/1PSO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1QRP", "url": "https://www.rcsb.org/structure/1QRP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3UTL", "url": "https://www.rcsb.org/structure/3UTL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00026", "url": "http://pfam.xfam.org/family/PF00026", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF07966", "url": "http://pfam.xfam.org/family/PF07966", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P0DJD7", "url": "https://pharos.nih.gov/targets/P0DJD7", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P0DJD7", "url": "http://purl.obolibrary.org/obo/PR_P0DJD7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001073276", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001073276", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "F5GXL4", "url": "https://www.uniprot.org/uniprot/F5GXL4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5GXL4-1", "url": "https://www.uniprot.org/uniprot/F5GXL4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H0H6", "url": "https://www.uniprot.org/uniprot/F5H0H6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H0H6-1", "url": "https://www.uniprot.org/uniprot/F5H0H6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H842", "url": "https://www.uniprot.org/uniprot/F5H842", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H842-1", "url": "https://www.uniprot.org/uniprot/F5H842-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0DJD7", "url": "https://www.uniprot.org/uniprot/P0DJD7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0DJD7-1", "url": "https://www.uniprot.org/uniprot/P0DJD7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKWLLLLGLVALSECIMYKVPLIRKKSLRRTLSERGLLKDFLKKHNLNPARKYFPQWEAPTLVDEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDQSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGEAIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQGMNLPTESGELWILGDVFIRQYFTVFDRANNQVGLAPVA", "length": 388, "header": "sp|P0DJD7-1|PEPA4_HUMAN Isoform 1 of Pepsin A-4 OS=Homo sapiens OX=9606 GN=PGA4 PE=1 SV=1 CANONICAL=P0DJD7-1" }, "isoforms": [ { "isoform_ac": "F5GXL4-1", "url": "", "sequence": { "sequence": "MVSGNNSDSAHCIGTGLRGKETTLVTPQDSPRKCPIKGSPEEATADGHTNGRTKKFMSSPLTFHSDDQSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGEAIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQGMNLPTESGELWILGDVFIRQYFTVFDRANNQVGLAPVA", "length": 234, "header": "tr|F5GXL4-1|F5GXL4_HUMAN Computationally mapped isoform of Pepsinogen A4 OS=Homo sapiens OX=9606 GN=PGA3 PE=3 SV=1 CANONICAL=P0DJD7-1" }, "locus": { "chromosome": "11", "start_pos": 61212699, "end_pos": 61209648, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000543125.5", "url": "https://www.ensembl.org/id/ENST00000543125.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000440177.1", "url": "https://www.ensembl.org/id/ENSP00000440177.1" } ] } }, { "isoform_ac": "F5H0H6-1", "url": "", "sequence": { "sequence": "MNGEAIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQGMNLPTESGELWILGDVFIRQYFTVFDRANNQVGLAPVA", "length": 128, "header": "tr|F5H0H6-1|F5H0H6_HUMAN Computationally mapped isoform of Pepsinogen A4 OS=Homo sapiens OX=9606 GN=PGA4 PE=3 SV=1 CANONICAL=P0DJD7-1" }, "locus": { "chromosome": "11", "start_pos": 61231528, "end_pos": 61229926, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000544899.1", "url": "https://www.ensembl.org/id/ENST00000544899.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000443623.1", "url": "https://www.ensembl.org/id/ENSP00000443623.1" } ] } }, { "isoform_ac": "F5H842-1", "url": "", "sequence": { "sequence": "MEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDQSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGEAIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYIL", "length": 265, "header": "tr|F5H842-1|F5H842_HUMAN Computationally mapped isoform of Pepsinogen A3 OS=Homo sapiens OX=9606 GN=PGA3 PE=3 SV=1 CANONICAL=P0DJD7-1" }, "locus": { "chromosome": "11", "start_pos": 61211432, "end_pos": 61206510, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000543505.5", "url": "https://www.ensembl.org/id/ENST00000543505.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000443732.1", "url": "https://www.ensembl.org/id/ENSP00000443732.1" } ] } }, { "isoform_ac": "P0DJD7-1", "url": "", "sequence": { "sequence": "MKWLLLLGLVALSECIMYKVPLIRKKSLRRTLSERGLLKDFLKKHNLNPARKYFPQWEAPTLVDEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDQSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGEAIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQGMNLPTESGELWILGDVFIRQYFTVFDRANNQVGLAPVA", "length": 388, "header": "sp|P0DJD7-1|PEPA4_HUMAN Isoform 1 of Pepsin A-4 OS=Homo sapiens OX=9606 GN=PGA4 PE=1 SV=1 CANONICAL=P0DJD7-1" }, "locus": { "chromosome": "11", "start_pos": 61231528, "end_pos": 61222401, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000378149.9", "url": "https://www.ensembl.org/id/ENST00000378149.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000367391.3", "url": "https://www.ensembl.org/id/ENSP00000367391.3" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 130, "end_pos": 130, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P0DJD7", "url": "https://www.uniprot.org/uniprot/P0DJD7" } ], "site_lbl": "Ser130" } ], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Crystal structure of the trimeric alpha-helical coiled-coil and the three lectin domains of human lung surfactant protein D.", "journal": "Structure (London, England : 1993)", "date": "1999", "authors": "Hakansson K, Lim NK, Hoppe HJ, Reid KB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "10368295", "url": "https://glygen.org/publication/PubMed/10368295" } ] }, { "title": "Cloning of gp-340, a putative opsonin receptor for lung surfactant protein D.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Holmskov U, Mollenhauer J, Madsen J, Vitved L, Gronlund J, Tornoe I, Kliem A, Reid KB, Poustka A, Skjodt K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "10485905", "url": "https://glygen.org/publication/PubMed/10485905" } ] }, { "title": "Characterization of human A(2B) adenosine receptors: radioligand binding, western blotting, and coupling to G(q) in human embryonic kidney 293 cells and HMC-1 mast cells.", "journal": "Molecular pharmacology", "date": "1999", "authors": "Linden J, Thai T, Figler H, Jin X, Robeva AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "10496952", "url": "https://glygen.org/publication/PubMed/10496952" } ] }, { "title": "Napsin A, a member of the aspartic protease family, is abundantly expressed in normal lung and kidney tissue and is expressed in lung adenocarcinomas.", "journal": "FEBS letters", "date": "1999", "authors": "Chuman Y, Bergman A, Ueno T, Saito S, Sakaguchi K, Alaiya AA, Franzen B, Bergman T, Arnott D, Auer G, Appella E, Jornvall H, Linder S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "10580105", "url": "https://glygen.org/publication/PubMed/10580105" } ] }, { "title": "GATA-6 activates transcription of surfactant protein A.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Bruno MD, Korfhagen TR, Liu C, Morrisey EE, Whitsett JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "10625644", "url": "https://glygen.org/publication/PubMed/10625644" } ] }, { "title": "Secretion of surfactant protein C, an integral membrane protein, requires the N-terminal propeptide.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Conkright JJ, Bridges JP, Na CL, Voorhout WF, Trapnell B, Glasser SW, Weaver TE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "11278984", "url": "https://glygen.org/publication/PubMed/11278984" } ] }, { "title": "Human salivary agglutinin binds to lung surfactant protein-D and is identical with scavenger receptor protein gp-340.", "journal": "The Biochemical journal", "date": "2001", "authors": "Ligtenberg TJ, Bikker FJ, Groenink J, Tornoe I, Leth-Larsen R, Veerman EC, Nieuw Amerongen AV, Holmskov U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "11563989", "url": "https://glygen.org/publication/PubMed/11563989" } ] }, { "title": "Rare mutations of the DMBT1 gene in human astrocytic gliomas.", "journal": "Oncogene", "date": "2002", "authors": "Mueller W, Mollenhauer J, Stockhammer F, Poustka A, von Deimling A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "12185598", "url": "https://glygen.org/publication/PubMed/12185598" } ] }, { "title": "BR22, a 26 kDa thyroid transcription factor-1 associated protein (TAP26), is expressed in human lung cells.", "journal": "The European respiratory journal", "date": "2003", "authors": "Yang MC, Wang B, Weissler JC, Margraf LR, Yang YS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "12882447", "url": "https://glygen.org/publication/PubMed/12882447" } ] }, { "title": "Molecular cloning and expression of an adenosine A2b receptor from human brain.", "journal": "Biochemical and biophysical research communications", "date": "1992", "authors": "Pierce KD, Furlong TJ, Selbie LA, Shine J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "1325798", "url": "https://glygen.org/publication/PubMed/1325798" } ] }, { "title": "Purification, characterization and cDNA cloning of human lung surfactant protein D.", "journal": "The Biochemical journal", "date": "1992", "authors": "Lu J, Willis AC, Reid KB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "1339284", "url": "https://glygen.org/publication/PubMed/1339284" } ] }, { "title": "Intracellular processing of pulmonary surfactant protein B in an endosomal/lysosomal compartment.", "journal": "The American journal of physiology", "date": "1992", "authors": "Voorhout WF, Veenendaal T, Haagsman HP, Weaver TE, Whitsett JA, van Golde LM, Geuze HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "1415726", "url": "https://glygen.org/publication/PubMed/1415726" } ] }, { "title": "Human surfactant polypeptide SP-B. Disulfide bridges, C-terminal end, and peptide analysis of the airway form.", "journal": "FEBS letters", "date": "1992", "authors": "Johansson J, Jornvall H, Curstedt T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "1568474", "url": "https://glygen.org/publication/PubMed/1568474" } ] }, { "title": "Human ADA2 belongs to a new family of growth factors with adenosine deaminase activity.", "journal": "The Biochemical journal", "date": "2005", "authors": "Zavialov AV, Engstrom A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "15926889", "url": "https://glygen.org/publication/PubMed/15926889" } ] }, { "title": "Pathways for clearance of surfactant protein A from the lung.", "journal": "American journal of physiology. Lung cellular and molecular physiology", "date": "2005", "authors": "Jain D, Dodia C, Fisher AB, Bates SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "16006481", "url": "https://glygen.org/publication/PubMed/16006481" } ] }, { "title": "LMCD1/Dyxin is a novel transcriptional cofactor that restricts GATA6 function by inhibiting DNA binding.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Rath N, Wang Z, Lu MM, Morrisey EE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "16199866", "url": "https://glygen.org/publication/PubMed/16199866" } ] }, { "title": "Processing of surfactant protein B proprotein by a cathepsin D-like protease.", "journal": "The American journal of physiology", "date": "1992", "authors": "Weaver TE, Lin S, Bogucki B, Dey C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "1636732", "url": "https://glygen.org/publication/PubMed/1636732" } ] }, { "title": "Surfactant catabolism.", "journal": "Respirology (Carlton, Vic.)", "date": "2006", "authors": "Ikegami M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "16423266", "url": "https://glygen.org/publication/PubMed/16423266" } ] }, { "title": "The TTF-1/TAP26 complex differentially modulates surfactant protein-B (SP-B) and -C (SP-C) promoters in lung cells.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Yang MC, Guo Y, Liu CC, Weissler JC, Yang YS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "16630564", "url": "https://glygen.org/publication/PubMed/16630564" } ] }, { "title": "Regulation of surfactant secretion in alveolar type II cells.", "journal": "American journal of physiology. Lung cellular and molecular physiology", "date": "2007", "authors": "Andreeva AV, Kutuzov MA, Voyno-Yasenetskaya TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "17496061", "url": "https://glygen.org/publication/PubMed/17496061" } ] }, { "title": "Salivary agglutinin/glycoprotein-340/DMBT1: a single molecule with variable composition and with different functions in infection, inflammation and cancer.", "journal": "Biological chemistry", "date": "2007", "authors": "Ligtenberg AJ, Veerman EC, Nieuw Amerongen AV, Mollenhauer J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "18020944", "url": "https://glygen.org/publication/PubMed/18020944" } ] }, { "title": "The structure of the GM-CSF receptor complex reveals a distinct mode of cytokine receptor activation.", "journal": "Cell", "date": "2008", "authors": "Hansen G, Hercus TR, McClure BJ, Stomski FC, Dottore M, Powell J, Ramshaw H, Woodcock JM, Xu Y, Guthridge M, McKinstry WJ, Lopez AF, Parker MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "18692472", "url": "https://glygen.org/publication/PubMed/18692472" } ] }, { "title": "Human surfactant protein D: SP-D contains a C-type lectin carbohydrate recognition domain.", "journal": "Archives of biochemistry and biophysics", "date": "1991", "authors": "Rust K, Grosso L, Zhang V, Chang D, Persson A, Longmore W, Cai GZ, Crouch E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "1898081", "url": "https://glygen.org/publication/PubMed/1898081" } ] }, { "title": "Genetic defects in surfactant protein A2 are associated with pulmonary fibrosis and lung cancer.", "journal": "American journal of human genetics", "date": "2009", "authors": "Wang Y, Kuan PJ, Xing C, Cronkhite JT, Torres F, Rosenblatt RL, DiMaio JM, Kinch LN, Grishin NV, Garcia CK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "19100526", "url": "https://glygen.org/publication/PubMed/19100526" } ] }, { "title": "Palmitoylation of cytoskeleton associated protein 4 by DHHC2 regulates antiproliferative factor-mediated signaling.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Planey SL, Keay SK, Zhang CO, Zacharias DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "19144824", "url": "https://glygen.org/publication/PubMed/19144824" } ] }, { "title": "Regulation of ATP-dependent surfactant secretion and activation of second-messenger systems in alveolar type II cells.", "journal": "The American journal of physiology", "date": "1991", "authors": "Voyno-Yasenetskaya TA, Dobbs LG, Williams MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "1928448", "url": "https://glygen.org/publication/PubMed/1928448" } ] }, { "title": "Alveolar surfactant homeostasis and the pathogenesis of pulmonary disease.", "journal": "Annual review of medicine", "date": "2010", "authors": "Whitsett JA, Wert SE, Weaver TE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "19824815", "url": "https://glygen.org/publication/PubMed/19824815" } ] }, { "title": "P63 (CKAP4) as an SP-A receptor: implications for surfactant turnover.", "journal": "Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology", "date": "2010", "authors": "Bates SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "20054143", "url": "https://glygen.org/publication/PubMed/20054143" } ] }, { "title": "Structural basis for the growth factor activity of human adenosine deaminase ADA2.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Zavialov AV, Yu X, Spillmann D, Lauvau G, Zavialov AV", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "20147294", "url": "https://glygen.org/publication/PubMed/20147294" } ] }, { "title": "The molecular basis of pulmonary alveolar proteinosis.", "journal": "Clinical immunology (Orlando, Fla.)", "date": "2010", "authors": "Carey B, Trapnell BC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "20338813", "url": "https://glygen.org/publication/PubMed/20338813" } ] }, { "title": "Review: Gp-340/DMBT1 in mucosal innate immunity.", "journal": "Innate immunity", "date": "2010", "authors": "Madsen J, Mollenhauer J, Holmskov U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "20418254", "url": "https://glygen.org/publication/PubMed/20418254" } ] }, { "title": "Genetic complexity of the human surfactant-associated proteins SP-A1 and SP-A2.", "journal": "Gene", "date": "2013", "authors": "Silveyra P, Floros J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "23069847", "url": "https://glygen.org/publication/PubMed/23069847" } ] }, { "title": "Orphan G protein-coupled receptor GPR116 regulates pulmonary surfactant pool size.", "journal": "American journal of respiratory cell and molecular biology", "date": "2013", "authors": "Bridges JP, Ludwig MG, Mueller M, Kinzel B, Sato A, Xu Y, Whitsett JA, Ikegami M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "23590306", "url": "https://glygen.org/publication/PubMed/23590306" } ] }, { "title": "Essential regulation of lung surfactant homeostasis by the orphan G protein-coupled receptor GPR116.", "journal": "Cell reports", "date": "2013", "authors": "Yang MY, Hilton MB, Seaman S, Haines DC, Nagashima K, Burks CM, Tessarollo L, Ivanova PT, Brown HA, Umstead TM, Floros J, Chroneos ZC, St Croix B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "23684610", "url": "https://glygen.org/publication/PubMed/23684610" } ] }, { "title": "Lung surfactant levels are regulated by Ig-Hepta/GPR116 by monitoring surfactant protein D.", "journal": "PloS one", "date": "2013", "authors": "Fukuzawa T, Ishida J, Kato A, Ichinose T, Ariestanti DM, Takahashi T, Ito K, Abe J, Suzuki T, Wakana S, Fukamizu A, Nakamura N, Hirose S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "23922714", "url": "https://glygen.org/publication/PubMed/23922714" } ] }, { "title": "Isolation of human, swine, and rat prepepsinogens and calf preprochymosin, and determination of the primary structures of their NH2-terminal signal sequences.", "journal": "J. Biochem.", "date": "1985", "authors": "Ichihara Y, Sogawa K, Takahashi K", "evidence": [ { "database": "UniProtKB", "id": "P0DJD7", "url": "https://www.uniprot.org/uniprot/P0DJD7" } ], "reference": [ { "type": "PubMed", "id": "2415509", "url": "https://glygen.org/publication/PubMed/2415509" } ] }, { "title": "SFTA3, a novel protein of the lung: three-dimensional structure, characterisation and immune activation.", "journal": "The European respiratory journal", "date": "2014", "authors": "Schicht M, Rausch F, Finotto S, Mathews M, Mattil A, Schubert M, Koch B, Traxdorf M, Bohr C, Worlitzsch D, Brandt W, Garreis F, Sel S, Paulsen F, Brauer L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "24743970", "url": "https://glygen.org/publication/PubMed/24743970" } ] }, { "title": "A comparative study on the NH2-terminal amino acid sequences and some other properties of six isozymic forms of human pepsinogens and pepsins.", "journal": "J. Biochem.", "date": "1989", "authors": "Athauda SB, Tanji M, Kageyama T, Takahashi K", "evidence": [ { "database": "UniProtKB", "id": "P0DJD7", "url": "https://www.uniprot.org/uniprot/P0DJD7" }, { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "2515193", "url": "https://glygen.org/publication/PubMed/2515193" } ] }, { "title": "New functions and signaling mechanisms for the class of adhesion G protein-coupled receptors.", "journal": "Annals of the New York Academy of Sciences", "date": "2014", "authors": "Liebscher I, Ackley B, Arac D, Ariestanti DM, Aust G, Bae BI, Bista BR, Bridges JP, Duman JG, Engel FB, Giera S, Goffinet AM, Hall RA, Hamann J, Hartmann N, Lin HH, Liu M, Luo R, Mogha A, Monk KR, Peeters MC, Promel S, Ressl S, Schioth HB, Sigoillot SM, Song H, Talbot WS, Tall GG, White JP, Wolfrum U, Xu L, Piao X", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "25424900", "url": "https://glygen.org/publication/PubMed/25424900" } ] }, { "title": "Nucleotide sequence of human preprocathepsin H, a lysosomal cysteine proteinase.", "journal": "Nucleic acids research", "date": "1989", "authors": "Fuchs R, Gassen HG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "2587265", "url": "https://glygen.org/publication/PubMed/2587265" } ] }, { "title": "Studies of the structure of lung surfactant protein SP-A.", "journal": "The American journal of physiology", "date": "1989", "authors": "Haagsman HP, White RT, Schilling J, Lau K, Benson BJ, Golden J, Hawgood S, Clements JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "2610270", "url": "https://glygen.org/publication/PubMed/2610270" } ] }, { "title": "Nucleotide sequence comparison of five human pepsinogen A (PGA) genes: evolution of the PGA multigene family.", "journal": "Genomics", "date": "1989", "authors": "Evers M P, Zelle B, Bebelman J P, van Beusechem V, Kraakman L, Hoffer M J, Pronk J C, Mager W H, Planta R J, Eriksson A W", "evidence": [ { "database": "UniProtKB", "id": "P0DJD7", "url": "https://www.uniprot.org/uniprot/P0DJD7" } ], "reference": [ { "type": "PubMed", "id": "2714789", "url": "https://glygen.org/publication/PubMed/2714789" } ] }, { "title": "Isolation and characterization of the human pulmonary surfactant apoprotein gene.", "journal": "Nature", "date": "1985", "authors": "White RT, Damm D, Miller J, Spratt K, Schilling J, Hawgood S, Benson B, Cordell B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "2995821", "url": "https://glygen.org/publication/PubMed/2995821" } ] }, { "title": "Functional evidence for adenosine A2 receptor regulation of phosphatidylcholine secretion in cultured type II pneumocytes.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "1987", "authors": "Gilfillan AM, Rooney SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "3037072", "url": "https://glygen.org/publication/PubMed/3037072" } ] }, { "title": "Activation of human pepsinogens.", "journal": "FEBS Lett.", "date": "1988", "authors": "Foltmann B", "evidence": [ { "database": "UniProtKB", "id": "P0DJD7", "url": "https://www.uniprot.org/uniprot/P0DJD7" } ], "reference": [ { "type": "PubMed", "id": "3197840", "url": "https://glygen.org/publication/PubMed/3197840" } ] }, { "title": "Hydrophobic 3.7 kDa surfactant polypeptide: structural characterization of the human and bovine forms.", "journal": "FEBS letters", "date": "1988", "authors": "Johansson J, Jornvall H, Eklund A, Christensen N, Robertson B, Curstedt T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "3366248", "url": "https://glygen.org/publication/PubMed/3366248" } ] }, { "title": "Pulmonary alveolar type II cells isolated from rats. Release of phosphatidylcholine in response to beta-adrenergic stimulation.", "journal": "The Journal of clinical investigation", "date": "1979", "authors": "Dobbs LG, Mason RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "34631", "url": "https://glygen.org/publication/PubMed/34631" } ] }, { "title": "Isolation and characterization of cDNA clones for the 35-kDa pulmonary surfactant-associated protein.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Floros J, Steinbrink R, Jacobs K, Phelps D, Kriz R, Recny M, Sultzman L, Jones S, Taeusch HW, Frank HA, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "3755136", "url": "https://glygen.org/publication/PubMed/3755136" } ] }, { "title": "P2-purinoceptors regulate surfactant secretion from rat isolated alveolar type II cells.", "journal": "British journal of pharmacology", "date": "1986", "authors": "Rice WR, Singleton FM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "3801783", "url": "https://glygen.org/publication/PubMed/3801783" } ] }, { "title": "Carboxyl-terminal sequence of human gastricsin and pepsin.", "journal": "J. Biol. Chem.", "date": "1970", "authors": "Huang W Y, Tang J", "evidence": [ { "database": "UniProtKB", "id": "P0DJD7", "url": "https://www.uniprot.org/uniprot/P0DJD7" } ], "reference": [ { "type": "PubMed", "id": "4909888", "url": "https://glygen.org/publication/PubMed/4909888" } ] }, { "title": "Primary structure of human pepsinogen gene.", "journal": "J. Biol. Chem.", "date": "1983", "authors": "Sogawa K, Fujii-Kuriyama Y, Mizukami Y, Ichihara Y, Takahashi K", "evidence": [ { "database": "UniProtKB", "id": "P0DJD7", "url": "https://www.uniprot.org/uniprot/P0DJD7" } ], "reference": [ { "type": "PubMed", "id": "6300126", "url": "https://glygen.org/publication/PubMed/6300126" } ] }, { "title": "Molecular coevolution of mammalian ribosomal gene terminator sequences and the transcription termination factor TTF-I.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Evers R, Grummt I", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "7597036", "url": "https://glygen.org/publication/PubMed/7597036" } ] }, { "title": "Crystal structure of human pepsin and its complex with pepstatin.", "journal": "Protein Sci.", "date": "1995", "authors": "Fujinaga M, Chernaia M M, Tarasova N I, Mosimann S C, James M N", "evidence": [ { "database": "UniProtKB", "id": "P0DJD7", "url": "https://www.uniprot.org/uniprot/P0DJD7" } ], "reference": [ { "type": "PubMed", "id": "7663352", "url": "https://glygen.org/publication/PubMed/7663352" } ] }, { "title": "A reversibly palmitoylated resident protein (p63) of an ER-Golgi intermediate compartment is related to a circulatory shock resuscitation protein.", "journal": "Journal of cell science", "date": "1993", "authors": "Schweizer A, Rohrer J, Jeno P, DeMaio A, Buchman TG, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "8314870", "url": "https://glygen.org/publication/PubMed/8314870" } ] }, { "title": "Genomic organization of human surfactant protein D (SP-D). SP-D is encoded on chromosome 10q22.2-23.1.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Crouch E, Rust K, Veile R, Donis-Keller H, Grosso L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "8428971", "url": "https://glygen.org/publication/PubMed/8428971" } ] }, { "title": "Characterization and expression of the human A2a adenosine receptor gene.", "journal": "Journal of neurochemistry", "date": "1996", "authors": "Peterfreund RA, MacCollin M, Gusella J, Fink JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "8522976", "url": "https://glygen.org/publication/PubMed/8522976" } ] }, { "title": "Adenosine receptor-induced cyclic AMP generation and inhibition of 5-hydroxytryptamine release in human platelets.", "journal": "British journal of clinical pharmacology", "date": "1995", "authors": "Cooper JA, Hill SJ, Alexander SP, Rubin PC, Horn EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "8527267", "url": "https://glygen.org/publication/PubMed/8527267" } ] }, { "title": "Transcription of the lung-specific surfactant protein C gene is mediated by thyroid transcription factor 1.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Kelly SE, Bachurski CJ, Burhans MS, Glasser SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "8636114", "url": "https://glygen.org/publication/PubMed/8636114" } ] }, { "title": "Regulation of surfactant protein gene transcription.", "journal": "Biochimica et biophysica acta", "date": "1998", "authors": "Whitsett JA, Glasser SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826" } ], "reference": [ { "type": "PubMed", "id": "9813380", "url": "https://glygen.org/publication/PubMed/9813380" } ] } ], "pathway": [ { "id": "hsa:643847", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:643847", "resource": "KEGG Pathway" }, { "id": "R-HSA-5683826", "name": "Surfactant metabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5683826", "resource": "Reactome", "description": "Surfactant metabolism" } ], "orthologs": [ { "uniprot_canonical_ac": "P00791-1", "protein_name": "Pepsin A", "gene_name": "PGA", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MKWLLLLSLVVLSECLVKVPLVRKKSLRQNLIKNGKLKDFLKTHKHNPASKYFPEAAALIGDEPLENYLDTEYFGTIGIGTPAQDFTVIFDTGSSNLWVPSVYCSSLACSDHNQFNPDDSSTFEATSQELSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISASGATPVFDNLWDQGLVSQDLFSVYLSSNDDSGSVVLLGGIDSSYYTGSLNWVPVSVEGYWQITLDSITMDGETIACSGGCQAIVDTGTSLLTGPTSAIANIQSDIGASENSDGEMVISCSSIDSLPDIVFTINGVQYPLSPSAYILQDDDSCTSGFEGMDVPTSSGELWILGDVFIRQYYTVFDRANNKVGLAPVA", "length": 385 }, "evidence": [ { "id": "P0DJD7", "url": "https://omabrowser.org/oma/group/P0DJD7/", "database": "OMA" } ], "common_name": "Pig" }, { "uniprot_canonical_ac": "P0DJD8-1", "protein_name": "Pepsin A-3", "gene_name": "PGA3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MKWLLLLGLVALSECIMYKVPLIRKKSLRRTLSERGLLKDFLKKHNLNPARKYFPQWKAPTLVDEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDQSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGEAIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQGMNLPTESGELWILGDVFIRQYFTVFDRANNQVGLAPVA", "length": 388 }, "evidence": [ { "id": "45935712", "url": "http://www.informatics.jax.org/homology/45935712", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P0DJD9-1", "protein_name": "Pepsin A-5", "gene_name": "PGA5", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MKWLLLLGLVALSECIMYKVPLIRKKSLRRTLSERGLLKDFLKKHNLNPARKYFPQWEAPTLVDEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDKSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGETIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQGMNVPTESGELWILGDVFIRQYFTVFDRANNQVGLAPVA", "length": 388 }, "evidence": [ { "id": "45935712", "url": "http://www.informatics.jax.org/homology/45935712", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9D106-1", "protein_name": "Pepsin A-5", "gene_name": "Pga5", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKWLWVLGLVALSECLVKIPLMKIKSMRENLRESQVLKDYLEKYPRSRAHVLLEQRRNPAVTYEPMRNYLDLVYIGIISIGTPPQEFRVVLDTGSSVLWVPSIYCSSPACAHHKAFNPLRSSTFLVSGRPVNVAYGSGEMSGFLAYDTVRIGDLTVVAQAFGLSLEEPGIFMEYAVFDGILGLGYPNLGLQGITPVFDNLWLQGLIPQNLFAFYLSSKDEKGSMLMLGGVDPSYYHGELHWVPVSKPSYWQLAVDSISMNGEVIACDGGCQGIMDTGTSLLTGPRSSIVNIQNLIGAKASGDGEYFLKCDTINTLPDIVFTIGSVTYPVPASAYIRKDRSHNCRSNFEEGMDDPSDPEMWVLGDVFLRLYFTVFDRANNRIGLAPAA", "length": 387 }, "evidence": [ { "id": "45935712", "url": "http://www.informatics.jax.org/homology/45935712", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9JJX2-1", "protein_name": "Pepsinogen A5", "gene_name": "Pga5", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKWLWVLGLVALSECLVKIPLMKIKSMRENLRESHMLKDYLEKYPRSRAHVLLEQRRNPSVTYEPMRNYLDLVYIGTISIGTPPQEFKVVLDTGSSDLWVPSIYCSSPACAHHKVFNPLQSSTFLVSGRPVNVAYGSGEMSGFLAYDTVKIGDLTVVAQAFGLSLEEPGRFMEHAVFDGILGLGYPNLGLQGVTPVFDNLWIQGLIPQNLFAFYLSSKDEKGSVLMLGGVDPSYYHGELHWVPVSKPSYWQLAVDSISMNGEIIACDGGCQGIMDTGTSLVTGPRSSILNIQNLIGAKASGDGEYFLKCDTINTLPDIVFTIDSVTYPVPASAYIRKDHSHNCRSNFEESTDDPSDPELWVLGDVFLRLYFTVFDRANNRIGLASAA", "length": 387 }, "evidence": [ { "id": "45935712", "url": "http://www.informatics.jax.org/homology/45935712", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "proteolysis", "id": "GO:0006508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006508", "evidence": [ { "database": "UniProtKB", "id": "P0DJD7", "url": "https://www.uniprot.org/uniprot/P0DJD7" } ], "pmid": "" }, { "name": "digestion", "id": "GO:0007586", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007586", "evidence": [ { "database": "UniProtKB", "id": "P0DJD7", "url": "https://www.uniprot.org/uniprot/P0DJD7" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P0DJD7", "url": "https://www.uniprot.org/uniprot/P0DJD7" } ], "pmid": "" }, { "name": "multivesicular body lumen", "id": "GO:0097486", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097486", "evidence": [ { "database": "UniProtKB", "id": "P0DJD7", "url": "https://www.uniprot.org/uniprot/P0DJD7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "aspartic-type endopeptidase activity", "id": "GO:0004190", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004190", "evidence": [ { "database": "UniProtKB", "id": "P0DJD7", "url": "https://www.uniprot.org/uniprot/P0DJD7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-HSA-5684864", "name": "NAPSA, CTSH, PGA3-5 cleave pro-SFTPB", "equation": "", "summary": "In the multivesicular body, surfactant precursor protein pro-SFTPB is most likely proteolytically cleaved by napsin-A (NAPSA), cathepsin-H (CTSH) and pepsinogens 3-5 (PGA3-5) (Chuman et al. 1999, Fuchs & Gassen 1989, Athauda et al. 1989, Johansson et al. 1992). The resultant mature peptide SFTPB (chain 201-279) forms a dimeric, disulfide-linked protein (Johansson et al. 1992) and is trafficked to lamellar bodies.", "cellular_location": "multivesicular body lumen", "input_participant_list": [ "R-HSA-5685255" ], "output_participant_list": [ "R-HSA-5685901", "R-HSA-5685910", "R-HSA-5685911" ], "enzyme_list": [ "O96009-1", "P0DJD7-1", "P0DJD9-1", "P0DJD8-1" ], "evidence": [ { "id": "R-HSA-5684864", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5684864" } ] }, { "id": "R-HSA-5685902", "name": "NAPSA, CTSH, PGA3-5 cleave pro-SFTPC", "equation": "", "summary": "In the multivesicular body, surfactant precursor protein pro-SFTPC is most likely proteolytically cleaved by napsin-A (NAPSA), cathepsin-H (CTSH) and pepsinogens 3-5 (PGA3-5) (Chuman et al. 1999, Fuchs & Gassen 1989, Athauda et al. 1989, Johansson et al. 1988). The resultant mature peptide SFTPC (chain 24-58) is trafficked to lamellar bodies.", "cellular_location": "multivesicular body lumen", "input_participant_list": [ "R-ALL-5685882" ], "output_participant_list": [ "R-HSA-5685871", "R-HSA-5685899" ], "enzyme_list": [ "O96009-1", "P0DJD7-1", "P0DJD9-1", "P0DJD8-1" ], "evidence": [ { "id": "R-HSA-5685902", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5685902" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-5685882", "participant_name": "H2O [multivesicular body lumen]", "crossref": [ { "id": "8145132", "database": "PubChem Substance", "url": "" }, { "id": "C00001", "database": "COMPOUND", "url": "" }, { "id": "HMDB0002111", "database": "HMDB Metabolite", "url": "" }, { "id": "15377", "database": "ChEBI", "url": "" }, { "id": "C00001", "database": "COMPOUND", "url": "" }, { "id": "15377", "database": "ChEBI", "url": "" }, { "id": "8145132", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0002111", "database": "HMDB Metabolite", "url": "" }, { "id": "C00001", "database": "COMPOUND", "url": "" }, { "id": "15377", "database": "ChEBI", "url": "" }, { "id": "8145132", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0002111", "database": "HMDB Metabolite", "url": "" }, { "id": "15377", "database": "ChEBI", "url": "" }, { "id": "HMDB0002111", "database": "HMDB Metabolite", "url": "" }, { "id": "8145132", "database": "PubChem Substance", "url": "" }, { "id": "C00001", "database": "COMPOUND", "url": "" }, { "id": "15377", "database": "ChEBI", "url": "" }, { "id": "HMDB0002111", "database": "HMDB Metabolite", "url": "" }, { "id": "8145132", "database": "PubChem Substance", "url": "" }, { "id": "C00001", "database": "COMPOUND", "url": "" } ] }, { "participant_id": "R-HSA-5685255", "participant_name": "pro-SFTPB [multivesicular body lumen]", "crossref": [ { "id": "P07988", "database": "UniProt", "url": "" }, { "id": "1DFW", "database": "PDB", "url": "" }, { "id": "ENSG00000168878-SFTPB", "database": "HPA", "url": "" }, { "id": "ENST00000409383", "database": "Ensembl", "url": "" }, { "id": "ENSP00000428719", "database": "Ensembl", "url": "" }, { "id": "1SSZ", "database": "PDB", "url": "" }, { "id": "ENSP00000386346", "database": "Ensembl", "url": "" }, { "id": "ENSP00000377409", "database": "Ensembl", "url": "" }, { "id": "2M1T", "database": "PDB", "url": "" }, { "id": "ENST00000393822", "database": "Ensembl", "url": "" }, { "id": "15278", "database": "Orphanet", "url": "" }, { "id": "ENST00000519937", "database": "Ensembl", "url": "" }, { "id": "NP_000533.3", "database": "RefSeq", "url": "" }, { "id": "1KMR", "database": "PDB", "url": "" }, { "id": "P07988", "database": "GeneCards", "url": "" }, { "id": "ENSG00000168878", "database": "OpenTargets", "url": "" }, { "id": "NP_942140.2", "database": "RefSeq", "url": "" }, { "id": "1RG3", "database": "PDB", "url": "" }, { "id": "P07988", "database": "PRO", "url": "" }, { "id": "2DWF", "database": "PDB", "url": "" }, { "id": "2JOU", "database": "PDB", "url": "" }, { "id": "P07988", "database": "Pharos - Targets", "url": "" }, { "id": "1RG4", "database": "PDB", "url": "" }, { "id": "ENSG00000168878", "database": "Ensembl", "url": "" }, { "id": "2M0H", "database": "PDB", "url": "" } ] }, { "participant_id": "R-HSA-5685871", "participant_name": "SFTPC(59-197) [multivesicular body lumen]", "crossref": [ { "id": "2YAD", "database": "PDB", "url": "" }, { "id": "P11686", "database": "Pharos - Targets", "url": "" }, { "id": "ENSG00000168484", "database": "OpenTargets", "url": "" }, { "id": "NP_001165881.1", "database": "RefSeq", "url": "" }, { "id": "P11686", "database": "GeneCards", "url": "" }, { "id": "ENSG00000168484-SFTPC", "database": "HPA", "url": "" }, { "id": "NP_001165828.1", "database": "RefSeq", "url": "" }, { "id": "ENSG00000168484", "database": "Ensembl", "url": "" }, { "id": "P11686", "database": "PRO", "url": "" }, { "id": "NP_001304707.1", "database": "RefSeq", "url": "" }, { "id": "NP_001304708.1", "database": "RefSeq", "url": "" }, { "id": "NP_001304709.1", "database": "RefSeq", "url": "" }, { "id": "15279", "database": "Orphanet", "url": "" }, { "id": "P11686", "database": "UniProt", "url": "" }, { "id": "ENST00000318561", "database": "Ensembl", "url": "" }, { "id": "NP_003009.2", "database": "RefSeq", "url": "" }, { "id": "ENSP00000316152", "database": "Ensembl", "url": "" } ] }, { "participant_id": "R-HSA-5685899", "participant_name": "SFTPC(24-58) [multivesicular body lumen]", "crossref": [ { "id": "NP_001304709.1", "database": "RefSeq", "url": "" }, { "id": "15279", "database": "Orphanet", "url": "" }, { "id": "NP_001304708.1", "database": "RefSeq", "url": "" }, { "id": "NP_001304707.1", "database": "RefSeq", "url": "" }, { "id": "P11686", "database": "UniProt", "url": "" }, { "id": "ENST00000318561", "database": "Ensembl", "url": "" }, { "id": "NP_003009.2", "database": "RefSeq", "url": "" }, { "id": "ENSP00000316152", "database": "Ensembl", "url": "" }, { "id": "P11686", "database": "PRO", "url": "" }, { "id": "ENSG00000168484", "database": "Ensembl", "url": "" }, { "id": "NP_001165828.1", "database": "RefSeq", "url": "" }, { "id": "ENSG00000168484-SFTPC", "database": "HPA", "url": "" }, { "id": "P11686", "database": "GeneCards", "url": "" }, { "id": "NP_001165881.1", "database": "RefSeq", "url": "" }, { "id": "P11686", "database": "Pharos - Targets", "url": "" }, { "id": "2YAD", "database": "PDB", "url": "" }, { "id": "ENSG00000168484", "database": "OpenTargets", "url": "" } ] }, { "participant_id": "R-HSA-5685901", "participant_name": "SFTPB(25-200) [multivesicular body lumen]", "crossref": [ { "id": "P07988", "database": "PRO", "url": "" }, { "id": "ENSG00000168878-SFTPB", "database": "HPA", "url": "" }, { "id": "15278", "database": "Orphanet", "url": "" }, { "id": "1RG4", "database": "PDB", "url": "" }, { "id": "ENSP00000386346", "database": "Ensembl", "url": "" }, { "id": "P07988", "database": "GeneCards", "url": "" }, { "id": "P07988", "database": "UniProt", "url": "" }, { "id": "NP_942140.2", "database": "RefSeq", "url": "" }, { "id": "2M1T", "database": "PDB", "url": "" }, { "id": "2JOU", "database": "PDB", "url": "" }, { "id": "ENSP00000428719", "database": "Ensembl", "url": "" }, { "id": "NP_000533.3", "database": "RefSeq", "url": "" }, { "id": "2M0H", "database": "PDB", "url": "" }, { "id": "ENSG00000168878", "database": "OpenTargets", "url": "" }, { "id": "ENSP00000377409", "database": "Ensembl", "url": "" }, { "id": "ENSG00000168878", "database": "Ensembl", "url": "" }, { "id": "ENST00000409383", "database": "Ensembl", "url": "" }, { "id": "2DWF", "database": "PDB", "url": "" }, { "id": "ENST00000519937", "database": "Ensembl", "url": "" }, { "id": "1DFW", "database": "PDB", "url": "" }, { "id": "1KMR", "database": "PDB", "url": "" }, { "id": "1SSZ", "database": "PDB", "url": "" }, { "id": "P07988", "database": "Pharos - Targets", "url": "" }, { "id": "1RG3", "database": "PDB", "url": "" }, { "id": "ENST00000393822", "database": "Ensembl", "url": "" } ] }, { "participant_id": "R-HSA-5685910", "participant_name": "SFTPB(201-279) [multivesicular body lumen]", "crossref": [ { "id": "15278", "database": "Orphanet", "url": "" }, { "id": "ENSG00000168878-SFTPB", "database": "HPA", "url": "" }, { "id": "P07988", "database": "PRO", "url": "" }, { "id": "1RG4", "database": "PDB", "url": "" }, { "id": "ENSP00000386346", "database": "Ensembl", "url": "" }, { "id": "P07988", "database": "GeneCards", "url": "" }, { "id": "P07988", "database": "UniProt", "url": "" }, { "id": "NP_942140.2", "database": "RefSeq", "url": "" }, { "id": "2M1T", "database": "PDB", "url": "" }, { "id": "2JOU", "database": "PDB", "url": "" }, { "id": "ENSP00000428719", "database": "Ensembl", "url": "" }, { "id": "NP_000533.3", "database": "RefSeq", "url": "" }, { "id": "2M0H", "database": "PDB", "url": "" }, { "id": "ENSG00000168878", "database": "OpenTargets", "url": "" }, { "id": "ENSP00000377409", "database": "Ensembl", "url": "" }, { "id": "ENSG00000168878", "database": "Ensembl", "url": "" }, { "id": "ENST00000409383", "database": "Ensembl", "url": "" }, { "id": "2DWF", "database": "PDB", "url": "" }, { "id": "ENST00000519937", "database": "Ensembl", "url": "" }, { "id": "1DFW", "database": "PDB", "url": "" }, { "id": "1KMR", "database": "PDB", "url": "" }, { "id": "1SSZ", "database": "PDB", "url": "" }, { "id": "P07988", "database": "Pharos - Targets", "url": "" }, { "id": "1RG3", "database": "PDB", "url": "" }, { "id": "ENST00000393822", "database": "Ensembl", "url": "" } ] }, { "participant_id": "R-HSA-5685911", "participant_name": "SFTPB(280-381) [multivesicular body lumen]", "crossref": [ { "id": "ENST00000393822", "database": "Ensembl", "url": "" }, { "id": "1DFW", "database": "PDB", "url": "" }, { "id": "1RG3", "database": "PDB", "url": "" }, { "id": "P07988", "database": "Pharos - Targets", "url": "" }, { "id": "1SSZ", "database": "PDB", "url": "" }, { "id": "1KMR", "database": "PDB", "url": "" }, { "id": "ENSG00000168878", "database": "Ensembl", "url": "" }, { "id": "ENSP00000377409", "database": "Ensembl", "url": "" }, { "id": "ENSG00000168878", "database": "OpenTargets", "url": "" }, { "id": "ENST00000409383", "database": "Ensembl", "url": "" }, { "id": "2DWF", "database": "PDB", "url": "" }, { "id": "ENST00000519937", "database": "Ensembl", "url": "" }, { "id": "2M0H", "database": "PDB", "url": "" }, { "id": "2M1T", "database": "PDB", "url": "" }, { "id": "NP_942140.2", "database": "RefSeq", "url": "" }, { "id": "ENSP00000428719", "database": "Ensembl", "url": "" }, { "id": "2JOU", "database": "PDB", "url": "" }, { "id": "NP_000533.3", "database": "RefSeq", "url": "" }, { "id": "P07988", "database": "UniProt", "url": "" }, { "id": "15278", "database": "Orphanet", "url": "" }, { "id": "P07988", "database": "PRO", "url": "" }, { "id": "ENSG00000168878-SFTPB", "database": "HPA", "url": "" }, { "id": "1RG4", "database": "PDB", "url": "" }, { "id": "P07988", "database": "GeneCards", "url": "" }, { "id": "ENSP00000386346", "database": "Ensembl", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "O96009", "gene_name": "NAPSA", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "O96009", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O96009" } ] } ] }, { "uniprot_ac": "P0DJD7", "gene_name": "PGA4", "activity": [ { "ec_number": "3.4.23.1", "activity": "Preferential cleavage: hydrophobic, preferably aromatic, residues in P1 and P1' positions. Cleaves 1-Phe-|-Val-2, 4-Gln-|-His-5, 13-Glu-|-Ala-14, 14-Ala-|-Leu-15, 15-Leu-|-Tyr-16, 16-Tyr-|-Leu-17, 23-Gly-|-Phe-24, 24-Phe-|-Phe-25 and 25-Phe-|-Tyr-26 bonds in the B chain of insulin.", "evidence": [ { "id": "P0DJD7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DJD7" } ] }, { "ec_number": "3.4.23.1", "activity": "", "evidence": [ { "id": "P0DJD7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DJD7" } ] } ] }, { "uniprot_ac": "P0DJD8", "gene_name": "PGA3", "activity": [ { "ec_number": "3.4.23.1", "activity": "Preferential cleavage: hydrophobic, preferably aromatic, residues in P1 and P1' positions. Cleaves 1-Phe-|-Val-2, 4-Gln-|-His-5, 13-Glu-|-Ala-14, 14-Ala-|-Leu-15, 15-Leu-|-Tyr-16, 16-Tyr-|-Leu-17, 23-Gly-|-Phe-24, 24-Phe-|-Phe-25 and 25-Phe-|-Tyr-26 bonds in the B chain of insulin.", "evidence": [ { "id": "P0DJD8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DJD8" } ] }, { "ec_number": "3.4.23.1", "activity": "", "evidence": [ { "id": "P0DJD8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DJD8" } ] } ] }, { "uniprot_ac": "P0DJD9", "gene_name": "PGA5", "activity": [ { "ec_number": "3.4.23.1", "activity": "Preferential cleavage: hydrophobic, preferably aromatic, residues in P1 and P1' positions. Cleaves 1-Phe-|-Val-2, 4-Gln-|-His-5, 13-Glu-|-Ala-14, 14-Ala-|-Leu-15, 15-Leu-|-Tyr-16, 16-Tyr-|-Leu-17, 23-Gly-|-Phe-24, 24-Phe-|-Phe-25 and 25-Phe-|-Tyr-26 bonds in the B chain of insulin.", "evidence": [ { "id": "P0DJD9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DJD9" } ] }, { "ec_number": "3.4.23.1", "activity": "", "evidence": [ { "id": "P0DJD9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DJD9" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 130 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 59 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }