{ "uniprot_canonical_ac": "P0CV99-1", "uniprot_ac": "P0CV99", "uniprot_id": "TSPY4_HUMAN", "mass": { "chemical_mass": 35727.0, "monoisotopic_mass": 35727.0 }, "refseq": { "ac": "NP_001157943", "name": "testis-specific Y-encoded protein 4", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157943" }, "gene_names": [ { "name": "TSPY4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P0CV99", "id": "P0CV99" }, { "name": "TSPY10; TSPY8", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157943", "id": "NP_001157943" }, { "name": "TSPY4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157943", "id": "NP_001157943" } ], "protein_names": [ { "name": "Testis-specific Y-encoded protein 4", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P0CV99" }, { "name": "testis-specific Y-encoded protein 4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157943", "id": "NP_001157943" } ], "function": [ { "annotation": "May be involved in sperm differentiation and proliferation.", "evidence": [ { "database": "UniProtKB", "id": "P0CV99", "url": "https://www.uniprot.org/uniprot/P0CV99#function" }, { "database": "UniProtKB", "id": "Q01534", "url": "https://www.uniprot.org/uniprot/Q01534#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0CV99", "url": "https://www.uniprot.org/uniprot/P0CV99" } ], "common_name": "Human" } ], "gene": [ { "name": "TSPY4", "url": "https://www.uniprot.org/uniprot/P0CV99", "locus": { "chromosome": "HG1532_PATCH", "start_pos": 207566, "end_pos": 204746, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000291458", "url": "https://www.ensembl.org/id/ENSG00000291458" } ] } } ], "crossref": [ { "id": "ENSG00000233803", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000233803", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "TSPY4", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=TSPY4", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "728395", "url": "https://www.ncbi.nlm.nih.gov/gene/728395", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "37287", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=37287", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR002164", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002164", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037231", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037231", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:728395", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:728395", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NX_P0CV99", "url": "https://www.nextprot.org/entry/NX_P0CV99", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "EMIVKEY", "url": "https://omabrowser.org/oma/group/EMIVKEY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4682607at2759", "url": "http://www.orthodb.org/?query=4682607at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11875", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11875", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11875:SF12", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11875:SF12", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00956", "url": "http://pfam.xfam.org/family/PF00956", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P0CV99", "url": "https://pharos.nih.gov/targets/P0CV99", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P0CV99", "url": "http://purl.obolibrary.org/obo/PR_P0CV99", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001157943", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157943", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P0CV99", "url": "https://www.uniprot.org/uniprot/P0CV99", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0CV99-1", "url": "https://www.uniprot.org/uniprot/P0CV99-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAFSRQREKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVEEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS", "length": 314, "header": "sp|P0CV99-1|TSPY4_HUMAN Isoform 1 of Testis-specific Y-encoded protein 4 OS=Homo sapiens OX=9606 GN=TSPY4 PE=3 SV=1 CANONICAL=P0CV99-1" }, "isoforms": [ { "isoform_ac": "P0CV99-1", "url": "", "sequence": { "sequence": "MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAFSRQREKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVEEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS", "length": 314, "header": "sp|P0CV99-1|TSPY4_HUMAN Isoform 1 of Testis-specific Y-encoded protein 4 OS=Homo sapiens OX=9606 GN=TSPY4 PE=3 SV=1 CANONICAL=P0CV99-1" }, "locus": { "chromosome": "HG1532_PATCH", "start_pos": 207369, "end_pos": 204792, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000707597.1", "url": "https://www.ensembl.org/id/ENST00000707597.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000516920.1", "url": "https://www.ensembl.org/id/ENSP00000516920.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "hsa:728395", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:728395", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "chromatin binding", "id": "GO:0003682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003682", "evidence": [ { "database": "UniProtKB", "id": "P0CV99", "url": "https://www.uniprot.org/uniprot/P0CV99" } ], "pmid": "" }, { "name": "histone binding", "id": "GO:0042393", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042393", "evidence": [ { "database": "UniProtKB", "id": "P0CV99", "url": "https://www.uniprot.org/uniprot/P0CV99" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P0CV99", "url": "https://www.uniprot.org/uniprot/P0CV99" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P0CV99", "url": "https://www.uniprot.org/uniprot/P0CV99" } ], "pmid": "" }, { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "P0CV99", "url": "https://www.uniprot.org/uniprot/P0CV99" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "spermatogenesis", "id": "GO:0007283", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007283", "evidence": [ { "database": "UniProtKB", "id": "P0CV99", "url": "https://www.uniprot.org/uniprot/P0CV99" } ], "pmid": "" }, { "name": "cell differentiation", "id": "GO:0030154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030154", "evidence": [ { "database": "UniProtKB", "id": "P0CV99", "url": "https://www.uniprot.org/uniprot/P0CV99" } ], "pmid": "" }, { "name": "nucleosome assembly", "id": "GO:0006334", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006334", "evidence": [ { "database": "UniProtKB", "id": "P0CV99", "url": "https://www.uniprot.org/uniprot/P0CV99" } ], "pmid": "" }, { "name": "gonadal mesoderm development", "id": "GO:0007506", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007506", "evidence": [ { "database": "UniProtKB", "id": "P0CV99", "url": "https://www.uniprot.org/uniprot/P0CV99" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 229, "end_pos": 231, "annotation": "n_glycosylation_sequon" }, { "start_pos": 258, "end_pos": 260, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 229, "end_pos": 231 }, { "start_pos": 258, "end_pos": 260 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }