{
    "uniprot_canonical_ac": "P0CG76-1",
    "uniprot_ac": "P0CG76",
    "uniprot_id": "UBIQA_DICDI",
    "mass": {
        "chemical_mass": 42821.0,
        "monoisotopic_mass": 42821.0
    },
    "refseq": {
        "ac": "XP_640258",
        "name": "hypothetical protein",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/XP_640258"
    },
    "gene_names": [
        {
            "name": "ubqA",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/P0CG76",
            "id": "P0CG76"
        },
        {
            "name": "DDB_G0282295",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/P0CG76",
            "id": "P0CG76"
        },
        {
            "name": "ubqA",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/XP_640258",
            "id": "XP_640258"
        }
    ],
    "protein_names": [
        {
            "name": "Polyubiquitin-A",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "P0CG76"
        },
        {
            "name": "hypothetical protein",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/XP_640258",
            "id": "XP_640258"
        }
    ],
    "function": [
        {
            "annotation": "Ubiquitin exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys residues of the ubiquitin (polyubiquitin chains) or a linear polymer linked via the initiator Met of the ubiquitin (linear polyubiquitin chains). Polyubiquitin chains, when attached to a target protein, have different functions depending on the Lys residue of the ubiquitin that is linked: Lys-48-linked is involved in protein degradation via the proteasome. Linear polymer chains formed via attachment by the initiator Met lead to cell signaling. Ubiquitin is usually conjugated to Lys residues of target proteins, however, in rare cases, conjugation to Cys or Ser residues has been observed. When polyubiquitin is free (unanchored-polyubiquitin), it also has distinct roles, such as in activation of protein kinases, and in signaling (By similarity).",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P0CG76",
                    "url": "https://www.uniprot.org/uniprot/P0CG76#function"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Dictyostelium discoideum",
            "taxid": 44689,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P0CG76",
                    "url": "https://www.uniprot.org/uniprot/P0CG76"
                }
            ],
            "common_name": "Cellular slime molds"
        }
    ],
    "gene": [
        {
            "name": "ubqA",
            "url": "https://www.uniprot.org/uniprot/P0CG76",
            "locus": {}
        }
    ],
    "crossref": [
        {
            "id": "cd01803",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01803",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "DDB_G0282295",
            "url": "http://dictybase.org/gene/DDB_G0282295",
            "database": "dictyBase",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "8623517",
            "url": "https://www.ncbi.nlm.nih.gov/gene/8623517",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR000626",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000626",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR019954",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR019954",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR019956",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR019956",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR029071",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR029071",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "ddi:DDB_G0282295",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0282295",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "HCTLREE",
            "url": "https://omabrowser.org/oma/group/HCTLREE/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR10666",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10666",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR10666:SF437",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10666:SF437",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF00240",
            "url": "http://pfam.xfam.org/family/PF00240",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_P0CG76",
            "url": "http://purl.obolibrary.org/obo/PR_P0CG76",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "R-DDI-1169408",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-1169408",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-DDI-936440",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-936440",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "XP_640258",
            "url": "https://www.ncbi.nlm.nih.gov/protein/XP_640258",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P0CG76",
            "url": "https://www.uniprot.org/uniprot/P0CG76",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P0CG76-1",
            "url": "https://www.uniprot.org/uniprot/P0CG76-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MQIFVKTLTGKTITLEVEGSDNIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDNIENVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDNIENVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDNIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDNIENVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGN",
        "length": 381,
        "header": "sp|P0CG76-1|UBIQA_DICDI Isoform 1 of Polyubiquitin-A  OS=Dictyostelium discoideum OX=44689 GN=ubqA PE=1 SV=1 CANONICAL=P0CG76-1"
    },
    "isoforms": [
        {
            "isoform_ac": "P0CG76-1",
            "url": "",
            "sequence": {
                "sequence": "MQIFVKTLTGKTITLEVEGSDNIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDNIENVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDNIENVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDNIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDNIENVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGN",
                "length": 381,
                "header": "sp|P0CG76-1|UBIQA_DICDI Isoform 1 of Polyubiquitin-A  OS=Dictyostelium discoideum OX=44689 GN=ubqA PE=1 SV=1 CANONICAL=P0CG76-1"
            },
            "locus": {}
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "The genome of the social amoeba Dictyostelium discoideum.",
            "journal": "Nature",
            "date": "2005",
            "authors": "Eichinger L, Pachebat J A, Gl\u00f6ckner G, Rajandream M-A, Sucgang R, Berriman M, Song J, Olsen R, Szafranski K, Xu Q, Tunggal B, Kummerfeld S, Madera M, Konfortov B A, Rivero F, Bankier A T, Lehmann R, Hamlin N, Davies R, Gaudet P, Fey P, Pilcher K, Chen G, Saunders D, Sodergren E, Davis P, Kerhornou A, Nie X, Hall N, Anjard C, Hemphill L, Bason N, Farbrother P, Desany B, Just E, Morio T, Rost R, Churcher C, Cooper J, Haydock S, van Driessche N, Cronin A, Goodhead I, Muzny D, Mourier T, Pain A, Lu M, Harper D, Lindsay R, Hauser H, James K, Quiles M, Madan Babu M, Saito T, Buchrieser C, Wardroper A, Felder M, Thangavelu M, Johnson D, Knights A, Loulseged H, Mungall K, Oliver K, Price C, Quail M A, Urushihara H, Hernandez J, Rabbinowitsch E, Steffen D, Sanders M, Ma J, Kohara Y, Sharp S, Simmonds M, Spiegler S, Tivey A, Sugano S, White B, Walker D, Woodward J, Winckler T, Tanaka Y, Shaulsky G, Schleicher M, Weinstock G, Rosenthal A, Cox E C, Chisholm R L, Gibbs R, Loomis W F, Platzer M, Kay R R, Williams J, Dear P H, Noegel A A, Barrell B, Kuspa A",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P0CG76",
                    "url": "https://www.uniprot.org/uniprot/P0CG76"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15875012",
                    "url": "https://glygen.org/publication/PubMed/15875012"
                }
            ]
        },
        {
            "title": "Identification of novel centrosomal proteins in Dictyostelium discoideum by comparative proteomic approaches.",
            "journal": "J. Proteome Res.",
            "date": "2006",
            "authors": "Reinders Yvonne, Schulz Irene, Gr\u00e4f Ralph, Sickmann Albert",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P0CG76",
                    "url": "https://www.uniprot.org/uniprot/P0CG76"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16512674",
                    "url": "https://glygen.org/publication/PubMed/16512674"
                }
            ]
        },
        {
            "title": "Molecular organization of developmentally regulated Dictyostelium discoideum ubiquitin cDNAs.",
            "journal": "Biochemistry",
            "date": "1989",
            "authors": "Ohmachi T, Giorda R, Shaw D R, Ennis H L",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P0CG76",
                    "url": "https://www.uniprot.org/uniprot/P0CG76"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "2548604",
                    "url": "https://glygen.org/publication/PubMed/2548604"
                }
            ]
        },
        {
            "title": "Structure of two developmentally regulated Dictyostelium discoideum ubiquitin genes.",
            "journal": "Mol. Cell. Biol.",
            "date": "1987",
            "authors": "Giorda R, Ennis H L",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P0CG76",
                    "url": "https://www.uniprot.org/uniprot/P0CG76"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "3037345",
                    "url": "https://glygen.org/publication/PubMed/3037345"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "ddi:DDB_G0282295",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0282295",
            "resource": "KEGG Pathway"
        },
        {
            "id": "R-DDI-1169408",
            "name": "ISG15 antiviral mechanism",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-1169408",
            "resource": "Reactome",
            "description": "ISG15 antiviral mechanism"
        },
        {
            "id": "R-DDI-936440",
            "name": "Negative regulators of DDX58/IFIH1 signaling",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-936440",
            "resource": "Reactome",
            "description": "Negative regulators of DDX58/IFIH1 signaling"
        }
    ],
    "orthologs": [],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 2,
                "go_terms": [
                    {
                        "name": "nucleus",
                        "id": "GO:0005634",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P0CG76",
                                "url": "https://www.uniprot.org/uniprot/P0CG76"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cytoplasm",
                        "id": "GO:0005737",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P0CG76",
                                "url": "https://www.uniprot.org/uniprot/P0CG76"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 2,
                "go_terms": [
                    {
                        "name": "ubiquitin protein ligase binding",
                        "id": "GO:0031625",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031625",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P0CG76",
                                "url": "https://www.uniprot.org/uniprot/P0CG76"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "protein tag activity",
                        "id": "GO:0031386",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031386",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P0CG76",
                                "url": "https://www.uniprot.org/uniprot/P0CG76"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 2,
                "go_terms": [
                    {
                        "name": "protein ubiquitination",
                        "id": "GO:0016567",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016567",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P0CG76",
                                "url": "https://www.uniprot.org/uniprot/P0CG76"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "modification-dependent protein catabolic process",
                        "id": "GO:0019941",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019941",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P0CG76",
                                "url": "https://www.uniprot.org/uniprot/P0CG76"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [],
    "sequence_features": {
        "n_linked_sites": [],
        "o_linked_sites": [],
        "snv_sites": [],
        "glycation_sites": [],
        "phosphorylation_sites": [],
        "sequon_annotation_sites": []
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 4
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}