{
    "uniprot_canonical_ac": "P0C7N5-1",
    "uniprot_ac": "P0C7N5",
    "uniprot_id": "OR8U9_HUMAN",
    "mass": {
        "chemical_mass": 35054.0,
        "monoisotopic_mass": 35054.0
    },
    "refseq": {
        "ac": "NP_001013375",
        "name": "olfactory receptor 8U9",
        "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013375"
    },
    "gene_names": [
        {
            "name": "OR8U9",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/P0C7N5",
            "id": "P0C7N5"
        },
        {
            "name": "OR8U9",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013375",
            "id": "NP_001013375"
        }
    ],
    "protein_names": [
        {
            "name": "Olfactory receptor 8U9",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "P0C7N5"
        },
        {
            "name": "olfactory receptor 8U9",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013375",
            "id": "NP_001013375"
        }
    ],
    "function": [
        {
            "annotation": "Odorant receptor.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P0C7N5",
                    "url": "https://www.uniprot.org/uniprot/P0C7N5#function"
                }
            ]
        },
        {
            "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001013375",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013375"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Homo sapiens",
            "taxid": 9606,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P0C7N5",
                    "url": "https://www.uniprot.org/uniprot/P0C7N5"
                }
            ],
            "common_name": "Human"
        }
    ],
    "gene": [
        {
            "name": "OR8U9",
            "url": "https://www.uniprot.org/uniprot/P0C7N5",
            "locus": {
                "chromosome": "HG142_HG150_NOVEL_TEST",
                "start_pos": 194908,
                "end_pos": 193979,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSG00000281038",
                        "url": "https://www.ensembl.org/id/ENSG00000281038"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "cd15413",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15413",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "OR8U9",
            "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=OR8U9",
            "database": "GeneCards",
            "categories": [
                "Gene Annotation",
                "Organism-specific"
            ]
        },
        {
            "id": "504190",
            "url": "https://www.ncbi.nlm.nih.gov/gene/504190",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "29166",
            "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=29166",
            "database": "HGNC",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "IPR000276",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR000725",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR017452",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "hsa:504190",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:504190",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "NX_P0C7N5",
            "url": "https://www.nextprot.org/entry/NX_P0C7N5",
            "database": "neXtProt",
            "categories": [
                "Protein",
                "Organism-specific"
            ]
        },
        {
            "id": "PTHR48018",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48018",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR48018:SF91",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48018:SF91",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF13853",
            "url": "http://pfam.xfam.org/family/PF13853",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "P0C7N5",
            "url": "https://pharos.nih.gov/targets/P0C7N5",
            "database": "PHAROS",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "PR_P0C7N5",
            "url": "http://purl.obolibrary.org/obo/PR_P0C7N5",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "R-HSA-9752946",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_001013375",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013375",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P0C7N5",
            "url": "https://www.uniprot.org/uniprot/P0C7N5",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P0C7N5-1",
            "url": "https://www.uniprot.org/uniprot/P0C7N5-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MTQINCTQVTEFILVGLTDRQELKMPLFVLFLSIYLFTVVGNLGLILLIRTDEKLNTPMYFFLSNLAFVDFCYSSVITPKMLGNFLYKQNSISFNACAAQLGCFLAFMTAECLLLASMAYDRYVAICNPLMYMVVMSPGICIQLVAAPHSYSILVALFHTILTFRLSYCHSNIVNHFYCDDMPLLRLTCSDTRFKQLWIFACAGIMFISSLLIVFVSYMFIISAILRMHSAEGRQKAFSTCGSHMLAVTIFYGTLIFMYLQPSSSHALDTDKMASVFYTVIIPMLNPLIYSLQNKEVKEALKKIIINKN",
        "length": 309,
        "header": "sp|P0C7N5-1|OR8U9_HUMAN Isoform 1 of Olfactory receptor 8U9  OS=Homo sapiens OX=9606 GN=OR8U9 PE=3 SV=1 CANONICAL=P0C7N5-1"
    },
    "isoforms": [
        {
            "isoform_ac": "P0C7N5-1",
            "url": "",
            "sequence": {
                "sequence": "MTQINCTQVTEFILVGLTDRQELKMPLFVLFLSIYLFTVVGNLGLILLIRTDEKLNTPMYFFLSNLAFVDFCYSSVITPKMLGNFLYKQNSISFNACAAQLGCFLAFMTAECLLLASMAYDRYVAICNPLMYMVVMSPGICIQLVAAPHSYSILVALFHTILTFRLSYCHSNIVNHFYCDDMPLLRLTCSDTRFKQLWIFACAGIMFISSLLIVFVSYMFIISAILRMHSAEGRQKAFSTCGSHMLAVTIFYGTLIFMYLQPSSSHALDTDKMASVFYTVIIPMLNPLIYSLQNKEVKEALKKIIINKN",
                "length": 309,
                "header": "sp|P0C7N5-1|OR8U9_HUMAN Isoform 1 of Olfactory receptor 8U9  OS=Homo sapiens OX=9606 GN=OR8U9 PE=3 SV=1 CANONICAL=P0C7N5-1"
            },
            "locus": {
                "chromosome": "HG142_HG150_NOVEL_TEST",
                "start_pos": 194905,
                "end_pos": 193979,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000626074.1",
                        "url": "https://www.ensembl.org/id/ENST00000626074.1"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000487204.1",
                        "url": "https://www.ensembl.org/id/ENSP00000487204.1"
                    }
                ]
            }
        }
    ],
    "glycosylation": [
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 5,
            "start_aa": "Asn",
            "end_pos": 5,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn5",
            "evidence": [
                {
                    "id": "P0C7N5",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P0C7N5#ptm_processing"
                }
            ]
        }
    ],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [
        "glycoprotein",
        "glycoprotein_predicted"
    ],
    "publication": [
        {
            "title": "Profiling of olfactory receptor gene expression in whole human olfactory mucosa.",
            "journal": "PloS one",
            "date": "2014",
            "authors": "Verbeurgt C, Wilkin F, Tarabichi M, Gregoire F, Dumont JE, Chatelain P",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9752946",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24800820",
                    "url": "https://glygen.org/publication/PubMed/24800820"
                }
            ]
        },
        {
            "title": "The human olfactory transcriptome.",
            "journal": "BMC genomics",
            "date": "2016",
            "authors": "Olender T, Keydar I, Pinto JM, Tatarskyy P, Alkelai A, Chien MS, Fishilevich S, Restrepo D, Matsunami H, Gilad Y, Lancet D",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9752946",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27515280",
                    "url": "https://glygen.org/publication/PubMed/27515280"
                }
            ]
        },
        {
            "title": "Structural instability and divergence from conserved residues underlie intracellular retention of mammalian odorant receptors.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "2020",
            "authors": "Ikegami K, de March CA, Nagai MH, Ghosh S, Do M, Sharma R, Bruguera ES, Lu YE, Fukutani Y, Vaidehi N, Yohda M, Matsunami H",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9752946",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "31974307",
                    "url": "https://glygen.org/publication/PubMed/31974307"
                }
            ]
        },
        {
            "title": "Single-cell analysis of olfactory neurogenesis and differentiation in adult humans.",
            "journal": "Nature neuroscience",
            "date": "2020",
            "authors": "Durante MA, Kurtenbach S, Sargi ZB, Harbour JW, Choi R, Kurtenbach S, Goss GM, Matsunami H, Goldstein BJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9752946",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "32066986",
                    "url": "https://glygen.org/publication/PubMed/32066986"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "hsa:504190",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:504190",
            "resource": "KEGG Pathway"
        },
        {
            "id": "R-HSA-9752946",
            "name": "Expression and translocation of olfactory receptors",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946",
            "resource": "Reactome",
            "description": "Expression and translocation of olfactory receptors"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "M0RCT7-1",
            "protein_name": "Olfactory receptor",
            "gene_name": "Or8u9",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MAQINCSQVTEFILVGLTDREELKMPLFGVFLFIYLFTTFGNLGLIVVIRTDARLHTPMYFFLSNLAFVDFCYSSVITPKMLGNFLYKQNVISFNACAAQLGCFLAFMTAECLLLASMAYDRYVAICNPLLYMVLMSPGICFQLVAAPYLYSFLVALFHATLTFRLCYCHSNTINHFYCDDMPLLRLTCSDTHSKQLWIFVCAGIMFISSLLIVFISYTFIISAILRMRSAEGRRKAFSTCGSHMLAVTIFYGTLIFMYLQPSSNHSLDTDKMASVFYTVIIPMLNPLIYSLRNKEVKDALKKLIISRNQMFMS",
                "length": 314
            },
            "evidence": [
                {
                    "id": "45935635",
                    "url": "http://www.informatics.jax.org/homology/45935635",
                    "database": "MGI"
                }
            ],
            "common_name": "Rat"
        },
        {
            "uniprot_canonical_ac": "Q8NH10-1",
            "protein_name": "Olfactory receptor 8U1",
            "gene_name": "OR8U1",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MAHINCTQATEFILVGLTDHQELKMPLFVLFLSIYLFTVVGNLGLILLIRADTSLNTPMYFFLSNLAFVDFCYSSVITPKMLGNFLYKQNVISFDACATQLGCFLTFMISESLLLASMAYDRYVAICNPLLYMVVMTPGICIQLVAVPYSYSFLMALFHTILTFRLSYCHSNIVNHFYCDDMPLLRLTCSDTRFKQLWIFACAGIMFISSLLIVFVSYMFIISAILRMHSAEGRQKAFSTCGSHMLAVTIFYGTLIFMYLQPSSSHALDTDKMASVFYTVIIPMLNPLIYSLQNKEVKEALKKIIINKN",
                "length": 309
            },
            "evidence": [
                {
                    "id": "45935635",
                    "url": "http://www.informatics.jax.org/homology/45935635",
                    "database": "MGI"
                }
            ],
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "Q8VGR9-1",
            "protein_name": "Olfactory receptor 8U9",
            "gene_name": "Or8u9",
            "tax_id": 10090,
            "organism": "Mus musculus",
            "sequence": {
                "sequence": "MAQINCTQVTEFILVGLTDREELKMPLFVVFLSIYLFTTLGNLGLILVIRTDARLHTPMYFFLSNLAFVDFCYSSVITPKMLGNFLYKQNMISFNACAAQLGCFLAFMTAECLLLASMAYDRYVAICNPLLYMVLMSPGICFQLVAAPYSYSFLVALFHAILTFRLCYCHSNAINHFYCDDMPLLRLTCSDTHSKQLWIFVCAGIMFISSLLIVFISYTFIISAILRMRSAEGRRKAFSTCGSHMLAVTIFYGTLIFMYLQPSSNHSLDTDKMASVFYTVIIPMLNPLIYSLRNKEVKDALKKLIASKNQMLSS",
                "length": 314
            },
            "evidence": [
                {
                    "id": "45935635",
                    "url": "http://www.informatics.jax.org/homology/45935635",
                    "database": "MGI"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Molecular Function",
                "total": 3,
                "go_terms": [
                    {
                        "name": "G protein-coupled receptor activity",
                        "id": "GO:0004930",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P0C7N5",
                                "url": "https://www.uniprot.org/uniprot/P0C7N5"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "olfactory receptor activity",
                        "id": "GO:0004984",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P0C7N5",
                                "url": "https://www.uniprot.org/uniprot/P0C7N5"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "odorant binding",
                        "id": "GO:0005549",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005549",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P0C7N5",
                                "url": "https://www.uniprot.org/uniprot/P0C7N5"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 1,
                "go_terms": [
                    {
                        "name": "plasma membrane",
                        "id": "GO:0005886",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P0C7N5",
                                "url": "https://www.uniprot.org/uniprot/P0C7N5"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 2,
                "go_terms": [
                    {
                        "name": "G protein-coupled receptor signaling pathway",
                        "id": "GO:0007186",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P0C7N5",
                                "url": "https://www.uniprot.org/uniprot/P0C7N5"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "sensory perception of smell",
                        "id": "GO:0007608",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007608",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P0C7N5",
                                "url": "https://www.uniprot.org/uniprot/P0C7N5"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 5,
            "end_pos": 7,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        }
    ],
    "sequence_features": {
        "n_linked_sites": [
            5
        ],
        "o_linked_sites": [],
        "snv_sites": [],
        "glycation_sites": [],
        "phosphorylation_sites": [],
        "sequon_annotation_sites": [
            {
                "start_pos": 5,
                "end_pos": 7
            }
        ]
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 1
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 1
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 4
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}