{ "uniprot_canonical_ac": "P0C7N1-1", "uniprot_ac": "P0C7N1", "uniprot_id": "OR8U8_HUMAN", "mass": { "chemical_mass": 36334.0, "monoisotopic_mass": 36334.0 }, "refseq": {}, "gene_names": [ { "name": "OR8U8", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P0C7N1", "id": "P0C7N1" } ], "protein_names": [ { "name": "Olfactory receptor 8U8", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P0C7N1" } ], "function": [ { "annotation": "Odorant receptor.", "evidence": [ { "database": "UniProtKB", "id": "P0C7N1", "url": "https://www.uniprot.org/uniprot/P0C7N1#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0C7N1", "url": "https://www.uniprot.org/uniprot/P0C7N1" } ], "common_name": "Human" } ], "gene": [ { "name": "OR8U8", "url": "https://www.uniprot.org/uniprot/P0C7N1", "locus": { "chromosome": "HG142_HG150_NOVEL_TEST", "start_pos": 187333, "end_pos": 186374, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000262315", "url": "https://www.ensembl.org/id/ENSG00000262315" } ] } } ], "crossref": [ { "id": "cd15413", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15413", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "OR8U8", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=OR8U8", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "27538", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=27538", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P0C7N1", "url": "https://www.ebi.ac.uk/intact/interactors/id:P0C7N1*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "NX_P0C7N1", "url": "https://www.nextprot.org/entry/NX_P0C7N1", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "PTHR48018", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48018", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR48018:SF91", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48018:SF91", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "http://pfam.xfam.org/family/PF13853", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P0C7N1", "url": "https://pharos.nih.gov/targets/P0C7N1", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P0C7N1", "url": "http://purl.obolibrary.org/obo/PR_P0C7N1", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9752946", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "P0C7N1", "url": "https://www.uniprot.org/uniprot/P0C7N1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0C7N1-1", "url": "https://www.uniprot.org/uniprot/P0C7N1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAHINCTQATEFILVGLTDHQELKMPLFVLFLSIYLFTVVGNLGLILLIRADTSLNTPMYFFLSNLAFVDFCYSSVITPKMLGNFLYKQNVISFDACATQLGCFLTFMVSESLLLASMAYDRYVAICNPLLYMVVMTPGICIQLVAVPYSYSFLMALFHTILTFRLSYCHSNIVNHFYCDDMPLLRLTCSDTRFKQLWILACAGITFICSVLIVFVSYMFIIFAILRMSSAEGRRKAFSTCSSHMLAVTIFYGTLIFMYLQPSSSHSLDADKMASVFYTVIIPMLNPLIYSLRNKDVKDALKKVIINRNHAFIFLKLRK", "length": 319, "header": "sp|P0C7N1-1|OR8U8_HUMAN Isoform 1 of Olfactory receptor 8U8 OS=Homo sapiens OX=9606 GN=OR8U8 PE=3 SV=1 CANONICAL=P0C7N1-1" }, "isoforms": [ { "isoform_ac": "P0C7N1-1", "url": "", "sequence": { "sequence": "MAHINCTQATEFILVGLTDHQELKMPLFVLFLSIYLFTVVGNLGLILLIRADTSLNTPMYFFLSNLAFVDFCYSSVITPKMLGNFLYKQNVISFDACATQLGCFLTFMVSESLLLASMAYDRYVAICNPLLYMVVMTPGICIQLVAVPYSYSFLMALFHTILTFRLSYCHSNIVNHFYCDDMPLLRLTCSDTRFKQLWILACAGITFICSVLIVFVSYMFIIFAILRMSSAEGRRKAFSTCSSHMLAVTIFYGTLIFMYLQPSSSHSLDADKMASVFYTVIIPMLNPLIYSLRNKDVKDALKKVIINRNHAFIFLKLRK", "length": 319, "header": "sp|P0C7N1-1|OR8U8_HUMAN Isoform 1 of Olfactory receptor 8U8 OS=Homo sapiens OX=9606 GN=OR8U8 PE=3 SV=1 CANONICAL=P0C7N1-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 5, "start_aa": "Asn", "end_pos": 5, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn5", "evidence": [ { "id": "P0C7N1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C7N1#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Specificity and sensitivity of a human olfactory receptor functionally expressed in human embryonic kidney 293 cells and Xenopus Laevis oocytes.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "1999", "authors": "Wetzel CH, Oles M, Wellerdieck C, Kuczkowiak M, Gisselmann G, Hatt H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "10460249", "url": "https://glygen.org/publication/PubMed/10460249" } ] }, { "title": "Identification of specific ligands for orphan olfactory receptors. G protein-dependent agonism and antagonism of odorants.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Shirokova E, Schmiedeberg K, Bedner P, Niessen H, Willecke K, Raguse JD, Meyerhof W, Krautwurst D", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "15598656", "url": "https://glygen.org/publication/PubMed/15598656" } ] }, { "title": "Structural determinants of odorant recognition by the human olfactory receptors OR1A1 and OR1A2.", "journal": "Journal of structural biology", "date": "2007", "authors": "Schmiedeberg K, Shirokova E, Weber HP, Schilling B, Meyerhof W, Krautwurst D", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "17601748", "url": "https://glygen.org/publication/PubMed/17601748" } ] }, { "title": "Genetic variation in a human odorant receptor alters odour perception.", "journal": "Nature", "date": "2007", "authors": "Keller A, Zhuang H, Chi Q, Vosshall LB, Matsunami H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "17873857", "url": "https://glygen.org/publication/PubMed/17873857" } ] }, { "title": "Genetic elucidation of human hyperosmia to isovaleric acid.", "journal": "PLoS biology", "date": "2007", "authors": "Menashe I, Abaffy T, Hasin Y, Goshen S, Yahalom V, Luetje CW, Lancet D", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "17973576", "url": "https://glygen.org/publication/PubMed/17973576" } ] }, { "title": "TMEM16B, a novel protein with calcium-dependent chloride channel activity, associates with a presynaptic protein complex in photoreceptor terminals.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2009", "authors": "Stohr H, Heisig JB, Benz PM, Schoberl S, Milenkovic VM, Strauss O, Aartsen WM, Wijnholds J, Weber BH, Schulz HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "19474308", "url": "https://glygen.org/publication/PubMed/19474308" } ] }, { "title": "Large-scale production and study of a synthetic G protein-coupled receptor: human olfactory receptor 17-4.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Cook BL, Steuerwald D, Kaiser L, Graveland-Bikker J, Vanberghem M, Berke AP, Herlihy K, Pick H, Vogel H, Zhang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "19581598", "url": "https://glygen.org/publication/PubMed/19581598" } ] }, { "title": "The missense of smell: functional variability in the human odorant receptor repertoire.", "journal": "Nature neuroscience", "date": "2014", "authors": "Mainland JD, Keller A, Li YR, Zhou T, Trimmer C, Snyder LL, Moberly AH, Adipietro KA, Liu WL, Zhuang H, Zhan S, Lee SS, Lin A, Matsunami H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "24316890", "url": "https://glygen.org/publication/PubMed/24316890" } ] }, { "title": "Profiling of olfactory receptor gene expression in whole human olfactory mucosa.", "journal": "PloS one", "date": "2014", "authors": "Verbeurgt C, Wilkin F, Tarabichi M, Gregoire F, Dumont JE, Chatelain P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9752946", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946" } ], "reference": [ { "type": "PubMed", "id": "24800820", "url": "https://glygen.org/publication/PubMed/24800820" } ] }, { "title": "Identification of agonists for a group of human odorant receptors.", "journal": "Frontiers in pharmacology", "date": "2015", "authors": "Gonzalez-Kristeller DC, do Nascimento JB, Galante PA, Malnic B", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "25784876", "url": "https://glygen.org/publication/PubMed/25784876" } ] }, { "title": "Human olfactory receptor responses to odorants.", "journal": "Scientific data", "date": "2015", "authors": "Mainland JD, Li YR, Zhou T, Liu WL, Matsunami H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "25977809", "url": "https://glygen.org/publication/PubMed/25977809" } ] }, { "title": "Altered G Protein Coupling in Olfactory Neuroepithelial Cells From Patients With Schizophrenia.", "journal": "Schizophrenia bulletin", "date": "2016", "authors": "Borgmann-Winter KE, Wang HY, Ray R, Willis BR, Moberg PJ, Rawson NE, Gur RE, Turetsky BI, Hahn CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "26373539", "url": "https://glygen.org/publication/PubMed/26373539" } ] }, { "title": "The human olfactory transcriptome.", "journal": "BMC genomics", "date": "2016", "authors": "Olender T, Keydar I, Pinto JM, Tatarskyy P, Alkelai A, Chien MS, Fishilevich S, Restrepo D, Matsunami H, Gilad Y, Lancet D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9752946", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946" } ], "reference": [ { "type": "PubMed", "id": "27515280", "url": "https://glygen.org/publication/PubMed/27515280" } ] }, { "title": "The Broadly Tuned Odorant Receptor OR1A1 is Highly Selective for 3-Methyl-2,4-nonanedione, a Key Food Odorant in Aged Wines, Tea, and Other Foods.", "journal": "Chemical senses", "date": "2017", "authors": "Geithe C, Noe F, Kreissl J, Krautwurst D", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "27916747", "url": "https://glygen.org/publication/PubMed/27916747" } ] }, { "title": "OR2M3: A Highly Specific and Narrowly Tuned Human Odorant Receptor for the Sensitive Detection of Onion Key Food Odorant 3-Mercapto-2-methylpentan-1-ol.", "journal": "Chemical senses", "date": "2017", "authors": "Noe F, Polster J, Geithe C, Kotthoff M, Schieberle P, Krautwurst D", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "27916748", "url": "https://glygen.org/publication/PubMed/27916748" } ] }, { "title": "Structural determinants of a conserved enantiomer-selective carvone binding pocket in the human odorant receptor OR1A1.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2017", "authors": "Geithe C, Protze J, Kreuchwig F, Krause G, Krautwurst D", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "28656349", "url": "https://glygen.org/publication/PubMed/28656349" } ] }, { "title": "Quantification of interacting cognate odorants with olfactory receptors in nanovesicles.", "journal": "Scientific reports", "date": "2017", "authors": "Sanmarti-Espinal M, Iavicoli P, Calo A, Taules M, Galve R, Marco MP, Samitier J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "29235485", "url": "https://glygen.org/publication/PubMed/29235485" } ] }, { "title": "Genetic variation across the human olfactory receptor repertoire alters odor perception.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2019", "authors": "Trimmer C, Keller A, Murphy NR, Snyder LL, Willer JR, Nagai MH, Katsanis N, Vosshall LB, Matsunami H, Mainland JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "31040214", "url": "https://glygen.org/publication/PubMed/31040214" } ] }, { "title": "Structural instability and divergence from conserved residues underlie intracellular retention of mammalian odorant receptors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2020", "authors": "Ikegami K, de March CA, Nagai MH, Ghosh S, Do M, Sharma R, Bruguera ES, Lu YE, Fukutani Y, Vaidehi N, Yohda M, Matsunami H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9752946", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946" } ], "reference": [ { "type": "PubMed", "id": "31974307", "url": "https://glygen.org/publication/PubMed/31974307" } ] }, { "title": "Single-cell analysis of olfactory neurogenesis and differentiation in adult humans.", "journal": "Nature neuroscience", "date": "2020", "authors": "Durante MA, Kurtenbach S, Sargi ZB, Harbour JW, Choi R, Kurtenbach S, Goss GM, Matsunami H, Goldstein BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9752946", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946" } ], "reference": [ { "type": "PubMed", "id": "32066986", "url": "https://glygen.org/publication/PubMed/32066986" } ] } ], "pathway": [ { "id": "R-HSA-381753", "name": "Olfactory Signaling Pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753", "resource": "Reactome", "description": "Olfactory Signaling Pathway" }, { "id": "R-HSA-9752946", "name": "Expression and translocation of olfactory receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946", "resource": "Reactome", "description": "Expression and translocation of olfactory receptors" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "P0C7N1", "url": "https://www.uniprot.org/uniprot/P0C7N1" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "P0C7N1", "url": "https://www.uniprot.org/uniprot/P0C7N1" } ], "pmid": "" }, { "name": "odorant binding", "id": "GO:0005549", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005549", "evidence": [ { "database": "UniProtKB", "id": "P0C7N1", "url": "https://www.uniprot.org/uniprot/P0C7N1" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P0C7N1", "url": "https://www.uniprot.org/uniprot/P0C7N1" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "evidence": [ { "database": "UniProtKB", "id": "P0C7N1", "url": "https://www.uniprot.org/uniprot/P0C7N1" } ], "pmid": "" }, { "name": "sensory perception of smell", "id": "GO:0007608", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007608", "evidence": [ { "database": "UniProtKB", "id": "P0C7N1", "url": "https://www.uniprot.org/uniprot/P0C7N1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [ 5 ], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 5, "end_pos": 7 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 20 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }