{ "uniprot_canonical_ac": "P0C617-1", "uniprot_ac": "P0C617", "uniprot_id": "O5AL1_HUMAN", "mass": { "chemical_mass": 36929.0, "monoisotopic_mass": 36929.0 }, "refseq": { "ac": "NP_001335159", "name": "olfactory receptor 5AL1", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. This olfactory receptor gene is a segregating pseudogene, where some individuals have an allele that encodes a functional olfactory receptor, while other individuals have an allele encoding a protein that is predicted to be non-functional. [provided by RefSeq, Jan 2017].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335159" }, "gene_names": [ { "name": "OR5AL1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P0C617", "id": "P0C617" }, { "name": "OR5AL1P", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335159", "id": "NP_001335159" }, { "name": "OR5AL1P", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P0C617", "id": "P0C617" }, { "name": "OR5AL1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335159", "id": "NP_001335159" } ], "protein_names": [ { "name": "Olfactory receptor 5AL1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P0C617" }, { "name": "Olfactory receptor OR11-184", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P0C617" }, { "name": "olfactory receptor 5AL1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335159", "id": "NP_001335159" }, { "name": "olfactory receptor, family 5, subfamily AL, member 1 pseudogene; olfactory receptor OR11-184", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335159", "id": "NP_001335159" } ], "function": [ { "annotation": "Odorant receptor.", "evidence": [ { "database": "UniProtKB", "id": "P0C617", "url": "https://www.uniprot.org/uniprot/P0C617#function" }, { "database": "PubMed", "id": "14983052", "url": "https://glygen.org/publication/PubMed/14983052" } ] }, { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. This olfactory receptor gene is a segregating pseudogene, where some individuals have an allele that encodes a functional olfactory receptor, while other individuals have an allele encoding a protein that is predicted to be non-functional. [provided by RefSeq, Jan 2017].", "evidence": [ { "database": "RefSeq", "id": "NP_001335159", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335159" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0C617", "url": "https://www.uniprot.org/uniprot/P0C617" } ], "common_name": "Human" } ], "gene": [ { "name": "OR5AL1", "url": "https://www.uniprot.org/uniprot/P0C617", "locus": { "chromosome": "11", "start_pos": 56413680, "end_pos": 56412696, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000272987", "url": "https://www.ensembl.org/id/ENSG00000272987" } ] } } ], "crossref": [ { "id": "cd15413", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15413", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "OR5AL1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=OR5AL1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "79482", "url": "https://www.ncbi.nlm.nih.gov/gene/79482", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "14844", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=14844", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "NX_P0C617", "url": "https://www.nextprot.org/entry/NX_P0C617", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P0C617", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P0C617", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "PTHR48018", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48018", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR48018:SF133", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48018:SF133", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "http://pfam.xfam.org/family/PF13853", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P0C617", "url": "https://pharos.nih.gov/targets/P0C617", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P0C617", "url": "http://purl.obolibrary.org/obo/PR_P0C617", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9752946", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001335159", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001335159", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P0C617", "url": "https://www.uniprot.org/uniprot/P0C617", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0C617-1", "url": "https://www.uniprot.org/uniprot/P0C617-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MCALKGFLEENFYTYSVAKGNHSTVYEFILLGLTDNAELQVTLFGIFLVVYLASFMGNFGLIMLIQISPQLHTPMYFFLSHLAFVDFSFTSSVAPNTLVNFLCEVKSITFYACAIQVCCFITFVVCELYLLSIMAYDRYVAICNPLLYVILIPRKLCIKLIASTYVYGFTVGLVQTVATSYLSFCDSNVINHFYHDDVPLVALACSDTHVKELMLLIIAGFNTLCSLVIVLISYGFIFFAILRIHSAEGRQKAFSTSASHLTSITIFYGTIIFMYPQPKSSHSLNMDKVASVFNVVVIPTLNPLIYSLRNQEVKNALKRIIEKLCLAVK", "length": 329, "header": "sp|P0C617-1|O5AL1_HUMAN Isoform 1 of Olfactory receptor 5AL1 OS=Homo sapiens OX=9606 GN=OR5AL1 PE=3 SV=2 CANONICAL=P0C617-1" }, "isoforms": [ { "isoform_ac": "P0C617-1", "url": "", "sequence": { "sequence": "MCALKGFLEENFYTYSVAKGNHSTVYEFILLGLTDNAELQVTLFGIFLVVYLASFMGNFGLIMLIQISPQLHTPMYFFLSHLAFVDFSFTSSVAPNTLVNFLCEVKSITFYACAIQVCCFITFVVCELYLLSIMAYDRYVAICNPLLYVILIPRKLCIKLIASTYVYGFTVGLVQTVATSYLSFCDSNVINHFYHDDVPLVALACSDTHVKELMLLIIAGFNTLCSLVIVLISYGFIFFAILRIHSAEGRQKAFSTSASHLTSITIFYGTIIFMYPQPKSSHSLNMDKVASVFNVVVIPTLNPLIYSLRNQEVKNALKRIIEKLCLAVK", "length": 329, "header": "sp|P0C617-1|O5AL1_HUMAN Isoform 1 of Olfactory receptor 5AL1 OS=Homo sapiens OX=9606 GN=OR5AL1 PE=3 SV=2 CANONICAL=P0C617-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 21, "start_aa": "Asn", "end_pos": 21, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn21", "evidence": [ { "id": "P0C617", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C617#ptm_processing" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P0C617", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P0C617" }, { "id": "34105348", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34105348" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Specificity and sensitivity of a human olfactory receptor functionally expressed in human embryonic kidney 293 cells and Xenopus Laevis oocytes.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "1999", "authors": "Wetzel CH, Oles M, Wellerdieck C, Kuczkowiak M, Gisselmann G, Hatt H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "10460249", "url": "https://glygen.org/publication/PubMed/10460249" } ] }, { "title": "Different noses for different people.", "journal": "Nat. Genet.", "date": "2003", "authors": "Menashe I, Man O, Lancet D, Gilad Y", "evidence": [ { "database": "UniProtKB", "id": "P0C617", "url": "https://www.uniprot.org/uniprot/P0C617" } ], "reference": [ { "type": "PubMed", "id": "12730696", "url": "https://glygen.org/publication/PubMed/12730696" } ] }, { "title": "The human olfactory receptor gene family.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Malnic B, Godfrey PA, Buck LB", "evidence": [ { "database": "UniProtKB", "id": "P0C617", "url": "https://www.uniprot.org/uniprot/P0C617" } ], "reference": [ { "type": "PubMed", "id": "14983052", "url": "https://glygen.org/publication/PubMed/14983052" } ] }, { "title": "Identification of specific ligands for orphan olfactory receptors. G protein-dependent agonism and antagonism of odorants.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Shirokova E, Schmiedeberg K, Bedner P, Niessen H, Willecke K, Raguse JD, Meyerhof W, Krautwurst D", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "15598656", "url": "https://glygen.org/publication/PubMed/15598656" } ] }, { "title": "Structural determinants of odorant recognition by the human olfactory receptors OR1A1 and OR1A2.", "journal": "Journal of structural biology", "date": "2007", "authors": "Schmiedeberg K, Shirokova E, Weber HP, Schilling B, Meyerhof W, Krautwurst D", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "17601748", "url": "https://glygen.org/publication/PubMed/17601748" } ] }, { "title": "Genetic variation in a human odorant receptor alters odour perception.", "journal": "Nature", "date": "2007", "authors": "Keller A, Zhuang H, Chi Q, Vosshall LB, Matsunami H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "17873857", "url": "https://glygen.org/publication/PubMed/17873857" } ] }, { "title": "Genetic elucidation of human hyperosmia to isovaleric acid.", "journal": "PLoS biology", "date": "2007", "authors": "Menashe I, Abaffy T, Hasin Y, Goshen S, Yahalom V, Luetje CW, Lancet D", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "17973576", "url": "https://glygen.org/publication/PubMed/17973576" } ] }, { "title": "TMEM16B, a novel protein with calcium-dependent chloride channel activity, associates with a presynaptic protein complex in photoreceptor terminals.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2009", "authors": "Stohr H, Heisig JB, Benz PM, Schoberl S, Milenkovic VM, Strauss O, Aartsen WM, Wijnholds J, Weber BH, Schulz HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "19474308", "url": "https://glygen.org/publication/PubMed/19474308" } ] }, { "title": "Large-scale production and study of a synthetic G protein-coupled receptor: human olfactory receptor 17-4.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Cook BL, Steuerwald D, Kaiser L, Graveland-Bikker J, Vanberghem M, Berke AP, Herlihy K, Pick H, Vogel H, Zhang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "19581598", "url": "https://glygen.org/publication/PubMed/19581598" } ] }, { "title": "The missense of smell: functional variability in the human odorant receptor repertoire.", "journal": "Nature neuroscience", "date": "2014", "authors": "Mainland JD, Keller A, Li YR, Zhou T, Trimmer C, Snyder LL, Moberly AH, Adipietro KA, Liu WL, Zhuang H, Zhan S, Lee SS, Lin A, Matsunami H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "24316890", "url": "https://glygen.org/publication/PubMed/24316890" } ] }, { "title": "Profiling of olfactory receptor gene expression in whole human olfactory mucosa.", "journal": "PloS one", "date": "2014", "authors": "Verbeurgt C, Wilkin F, Tarabichi M, Gregoire F, Dumont JE, Chatelain P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9752946", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946" } ], "reference": [ { "type": "PubMed", "id": "24800820", "url": "https://glygen.org/publication/PubMed/24800820" } ] }, { "title": "Identification of agonists for a group of human odorant receptors.", "journal": "Frontiers in pharmacology", "date": "2015", "authors": "Gonzalez-Kristeller DC, do Nascimento JB, Galante PA, Malnic B", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "25784876", "url": "https://glygen.org/publication/PubMed/25784876" } ] }, { "title": "Human olfactory receptor responses to odorants.", "journal": "Scientific data", "date": "2015", "authors": "Mainland JD, Li YR, Zhou T, Liu WL, Matsunami H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "25977809", "url": "https://glygen.org/publication/PubMed/25977809" } ] }, { "title": "Altered G Protein Coupling in Olfactory Neuroepithelial Cells From Patients With Schizophrenia.", "journal": "Schizophrenia bulletin", "date": "2016", "authors": "Borgmann-Winter KE, Wang HY, Ray R, Willis BR, Moberg PJ, Rawson NE, Gur RE, Turetsky BI, Hahn CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "26373539", "url": "https://glygen.org/publication/PubMed/26373539" } ] }, { "title": "The human olfactory transcriptome.", "journal": "BMC genomics", "date": "2016", "authors": "Olender T, Keydar I, Pinto JM, Tatarskyy P, Alkelai A, Chien MS, Fishilevich S, Restrepo D, Matsunami H, Gilad Y, Lancet D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9752946", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946" } ], "reference": [ { "type": "PubMed", "id": "27515280", "url": "https://glygen.org/publication/PubMed/27515280" } ] }, { "title": "The Broadly Tuned Odorant Receptor OR1A1 is Highly Selective for 3-Methyl-2,4-nonanedione, a Key Food Odorant in Aged Wines, Tea, and Other Foods.", "journal": "Chemical senses", "date": "2017", "authors": "Geithe C, Noe F, Kreissl J, Krautwurst D", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "27916747", "url": "https://glygen.org/publication/PubMed/27916747" } ] }, { "title": "OR2M3: A Highly Specific and Narrowly Tuned Human Odorant Receptor for the Sensitive Detection of Onion Key Food Odorant 3-Mercapto-2-methylpentan-1-ol.", "journal": "Chemical senses", "date": "2017", "authors": "Noe F, Polster J, Geithe C, Kotthoff M, Schieberle P, Krautwurst D", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "27916748", "url": "https://glygen.org/publication/PubMed/27916748" } ] }, { "title": "Structural determinants of a conserved enantiomer-selective carvone binding pocket in the human odorant receptor OR1A1.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2017", "authors": "Geithe C, Protze J, Kreuchwig F, Krause G, Krautwurst D", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "28656349", "url": "https://glygen.org/publication/PubMed/28656349" } ] }, { "title": "Quantification of interacting cognate odorants with olfactory receptors in nanovesicles.", "journal": "Scientific reports", "date": "2017", "authors": "Sanmarti-Espinal M, Iavicoli P, Calo A, Taules M, Galve R, Marco MP, Samitier J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "29235485", "url": "https://glygen.org/publication/PubMed/29235485" } ] }, { "title": "Genetic variation across the human olfactory receptor repertoire alters odor perception.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2019", "authors": "Trimmer C, Keller A, Murphy NR, Snyder LL, Willer JR, Nagai MH, Katsanis N, Vosshall LB, Matsunami H, Mainland JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-381753", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753" } ], "reference": [ { "type": "PubMed", "id": "31040214", "url": "https://glygen.org/publication/PubMed/31040214" } ] }, { "title": "Structural instability and divergence from conserved residues underlie intracellular retention of mammalian odorant receptors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2020", "authors": "Ikegami K, de March CA, Nagai MH, Ghosh S, Do M, Sharma R, Bruguera ES, Lu YE, Fukutani Y, Vaidehi N, Yohda M, Matsunami H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9752946", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946" } ], "reference": [ { "type": "PubMed", "id": "31974307", "url": "https://glygen.org/publication/PubMed/31974307" } ] }, { "title": "Single-cell analysis of olfactory neurogenesis and differentiation in adult humans.", "journal": "Nature neuroscience", "date": "2020", "authors": "Durante MA, Kurtenbach S, Sargi ZB, Harbour JW, Choi R, Kurtenbach S, Goss GM, Matsunami H, Goldstein BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9752946", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946" } ], "reference": [ { "type": "PubMed", "id": "32066986", "url": "https://glygen.org/publication/PubMed/32066986" } ] }, { "title": "O-GlcNAcylation Quantification of Certain Protein by the Proximity Ligation Assay and Clostridium perfringen OGA(D298N)(CpOGA(D298N)).", "journal": "ACS chemical biology", "date": "2021", "authors": "Song J, Liu C, Wang X, Xu B, Liu X, Li Y, Xia J, Li Y, Zhang C, Li D, Sun H", "evidence": [ { "database": "O-GlcNAc Database", "id": "P0C617", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P0C617" } ], "reference": [ { "type": "PubMed", "id": "34105348", "url": "https://glygen.org/publication/PubMed/34105348" } ] } ], "pathway": [ { "id": "R-HSA-381753", "name": "Olfactory Signaling Pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381753", "resource": "Reactome", "description": "Olfactory Signaling Pathway" }, { "id": "R-HSA-9752946", "name": "Expression and translocation of olfactory receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946", "resource": "Reactome", "description": "Expression and translocation of olfactory receptors" } ], "orthologs": [ { "uniprot_canonical_ac": "A2ARY0-1", "protein_name": "Olfactory receptor", "gene_name": "Or5al5", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAEGNSSTVFQFILEGLTDDPELEVTLFAVFLVIYLTTVLGNLGLIMLIQVSPQLHTPMYFFLCHLAFVDFCYTSSVTPNTIINFLREIKSITFYACATQVCCFITFAVCEMYLLSVMAYDRYVAIWNPLLYVVLMPKKLCLQVITSTYIYGFTVGLAQAVATFRLSFCGSNVINHFYCDDVPLVALACSDTHVKELMLLIIAGFNTLCSLVIVVISYICILFAILRIHSAEGRRKAFSTCASHLTSITIFYGTIIFMYLQPKSSHSLNTDKFVSVFYVVVIPMLNPLIYSLRNKEVKNALKRFTEKLSLTIHDSRKSE", "length": 319 }, "evidence": [ { "id": "45935458", "url": "http://www.informatics.jax.org/homology/45935458", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "A2ARY1-1", "protein_name": "Olfactory receptor", "gene_name": "Or5al6", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MDEDNNSTVHQFILVGLTDDPELEVILFAVFLVIYLTTVLGNLGLIMLIQVSPQLHTPMYFFLCHLAFVDFCYTSSVTPSTIINFLREIKSITFYACATQVCCFITFVVCEMYLLSVMAYDRYVAIWNPLLYVVLMPKKLCLQVIASTYIYGFTVGLVQAVATFHFSFCGSNVINHFYCDDVPLIALACSDTHVKELMLLIIAGFNTLCSLVIVVISYICILFAILRIRSVEGRRKAFSTCASHLTSITIFYGTVSFMYLQPKSSHSLNTDKFASVSYVVVIPMLNPLIYSLRNQEVKSALKRITDKLSLTIH", "length": 313 }, "evidence": [ { "id": "45935459", "url": "http://www.informatics.jax.org/homology/45935459", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "D3ZAC2-1", "protein_name": "Olfactory receptor", "gene_name": "Or5al5b", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MADGNISAVSQFIFVGLTDDPGLEIILFAVFLVIYLTTVSGNLGLIMLIHYSPQLHTPMYFFLSHLAFVDFCYTSSVTPNTIINFLRKVKSITFYACATQVCCFITFAVCEMYLLSVMAYDRYVAIWNPLLYAVLMPRRLCLQVIASTYIYGFTVDLVQAVATFHLSFCGSNVVNHFYCDDVPLVALACSDTHVKELMLLIIAGFNTLCSLLIVIISYVFIVFAILRMHSAEGRRKAFSTCASHLTSITIFYGTIIFMYLQPKSSHSLNTDKFASVFYVVVIPMLNPLIYSLRNQEVKSALKRITDKLSLIIR", "length": 313 }, "evidence": [ { "id": "45935458", "url": "http://www.informatics.jax.org/homology/45935458", "database": "MGI" }, { "id": "45935459", "url": "http://www.informatics.jax.org/homology/45935459", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "D3ZLQ7-1", "protein_name": "Olfactory receptor", "gene_name": "Or5al1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MVKSNHSAVSEFVLVGLTDDPKLQVSLFGVFLVIYLTSVVGNIGLIVLIQVSPQLHTPMYFFLTHLAFIDFCFTSSVTPNTLLNFLREVKSITFYACATQLCCFVTFVVCELYLLSIMAYDRYVAIWNPLLYAVLMPRKLCLQVIASTYIYGFTVGLAQAVETFRLSFCGSNVVNHFYCDDVPLVALACSDTHVKELMLLIIAGFNTLCSLVIVVISYICIVFAILRIHSAEGRRKAFSTCASHLTSITIFYGTVSFMYLQPKSSHSLNTDKFASVFYVVVIPMLNPLIYSLRNQEVKSALKKIVEKLTLAIK", "length": 313 }, "evidence": [ { "id": "45935457", "url": "http://www.informatics.jax.org/homology/45935457", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q7TR81-1", "protein_name": "Olfactory receptor", "gene_name": "Or5al1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MANSNHSAVSEFILVGLTDDSELQVSLFGVFLVIYLTSVVGNVGLIVLIQVSPQLHTPMYFFLTHLAFIDFCFTSSVTPNTLVNFLREVKSITFYACATQLCCFVTFVVCELYLLSIMAYDRYVAIWNPLLYAVRMPRELCLQVITSTYIYGFTVGLAQAVATFRLSFCGSNVINHFYCDDVPLVALACSDTHVKELMLLIIAGFNTLCSLVIVVISYICILFAILRIHSAEGRRKAFSTCASHLTSITIFYGTVSFMYLQPKSSHSLNTDKFASVFYVVVIPMLNPLIYSLRNQEVKSALKRIVEKLSSAIK", "length": 313 }, "evidence": [ { "id": "45935457", "url": "http://www.informatics.jax.org/homology/45935457", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "P0C617", "url": "https://www.uniprot.org/uniprot/P0C617" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "P0C617", "url": "https://www.uniprot.org/uniprot/P0C617" } ], "pmid": "" }, { "name": "odorant binding", "id": "GO:0005549", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005549", "evidence": [ { "database": "UniProtKB", "id": "P0C617", "url": "https://www.uniprot.org/uniprot/P0C617" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P0C617", "url": "https://www.uniprot.org/uniprot/P0C617" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "evidence": [ { "database": "UniProtKB", "id": "P0C617", "url": "https://www.uniprot.org/uniprot/P0C617" } ], "pmid": "" }, { "name": "sensory perception of smell", "id": "GO:0007608", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007608", "evidence": [ { "database": "UniProtKB", "id": "P0C617", "url": "https://www.uniprot.org/uniprot/P0C617" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 21, "end_pos": 23, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 21 ], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 21, "end_pos": 23 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }