{ "uniprot_canonical_ac": "P0C0P6-1", "uniprot_ac": "P0C0P6", "uniprot_id": "NPS_HUMAN", "mass": { "chemical_mass": 10103.0, "monoisotopic_mass": 10103.0 }, "refseq": { "ac": "NP_001025184", "name": "neuropeptide S precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025184" }, "gene_names": [ { "name": "NPS", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P0C0P6", "id": "P0C0P6" }, { "name": "NPS", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025184", "id": "NP_001025184" } ], "protein_names": [ { "name": "Neuropeptide S", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P0C0P6" }, { "name": "neuropeptide S precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025184", "id": "NP_001025184" }, { "name": "prepro-neuropeptide S", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025184", "id": "NP_001025184" } ], "function": [ { "annotation": "A SNP within the neuropeptide s gene is associated with decreased bioactivity. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001025184", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025184" }, { "database": "PubMed", "id": "24386135", "url": "https://glygen.org/publication/PubMed/24386135" } ] }, { "annotation": "Analgesic effects of NPS are linked with dopaminergic neurotransmission mainly through dopamine D2-like receptor signaling", "evidence": [ { "database": "RefSeq", "id": "NP_001025184", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025184" }, { "database": "PubMed", "id": "31326375", "url": "https://glygen.org/publication/PubMed/31326375" } ] }, { "annotation": "Further refining the critical region of 10q26 microdeletion syndrome: A possible involvement of INSYN2 and NPS in the cognitive phenotype.", "evidence": [ { "database": "RefSeq", "id": "NP_001025184", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025184" }, { "database": "PubMed", "id": "34252586", "url": "https://glygen.org/publication/PubMed/34252586" } ] }, { "annotation": "Modulates arousal and anxiety. May play an important anorexigenic role (By similarity). Binds to its receptor NPSR1 with nanomolar affinity to increase intracellular calcium concentrations (PubMed:15312648, PubMed:16790440).", "evidence": [ { "database": "UniProtKB", "id": "P0C0P6", "url": "https://www.uniprot.org/uniprot/P0C0P6#function" }, { "database": "PubMed", "id": "15312648", "url": "https://glygen.org/publication/PubMed/15312648" }, { "database": "PubMed", "id": "16790440", "url": "https://glygen.org/publication/PubMed/16790440" } ] }, { "annotation": "Neandertal introgression and accumulation of hypomorphic mutations in the neuropeptide S (NPS) system promote attenuated functionality.", "evidence": [ { "database": "RefSeq", "id": "NP_001025184", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025184" }, { "database": "PubMed", "id": "33556445", "url": "https://glygen.org/publication/PubMed/33556445" } ] }, { "annotation": "SNPs modify asthma risk Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001025184", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025184" }, { "database": "PubMed", "id": "28463995", "url": "https://glygen.org/publication/PubMed/28463995" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "18.51", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000214285", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214285" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "16.41", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000214285", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214285" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "17.43", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000214285", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214285" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "16.94", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000214285", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214285" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "27.44", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000214285", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214285" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "14.44", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000214285", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214285" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "16.88", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000214285", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214285" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "17.51", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000214285", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214285" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "20.11", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000214285", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214285" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P0C0P6", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P0C0P6" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0C0P6", "url": "https://www.uniprot.org/uniprot/P0C0P6" } ], "common_name": "Human" } ], "gene": [ { "name": "NPS", "url": "https://www.uniprot.org/uniprot/P0C0P6", "locus": { "chromosome": "10", "start_pos": 127553540, "end_pos": 127549309, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000214285", "url": "https://www.ensembl.org/id/ENSG00000214285" } ] } } ], "crossref": [ { "id": "ENSG00000214285", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214285", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "CHEMBL3596086", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3596086", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "NPS", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=NPS", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "594857", "url": "https://www.ncbi.nlm.nih.gov/gene/594857", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "33940", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=33940", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P0C0P6", "url": "https://www.ebi.ac.uk/intact/interactors/id:P0C0P6*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR028138", "url": "https://www.ebi.ac.uk/interpro/entry/IPR028138", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:594857", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:594857", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "609513", "url": "http://www.omim.org/entry/609513", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P0C0P6", "url": "https://www.nextprot.org/entry/NX_P0C0P6", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "MFVCSGY", "url": "https://omabrowser.org/oma/group/MFVCSGY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5313408at2759", "url": "http://www.orthodb.org/?query=5313408at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR36679", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR36679", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR36679:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR36679:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF14993", "url": "http://pfam.xfam.org/family/PF14993", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P0C0P6", "url": "https://pharos.nih.gov/targets/P0C0P6", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P0C0P6", "url": "http://purl.obolibrary.org/obo/PR_P0C0P6", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001025184", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025184", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P0C0P6", "url": "https://www.uniprot.org/uniprot/P0C0P6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0C0P6-1", "url": "https://www.uniprot.org/uniprot/P0C0P6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MISSVKLNLILVLSLSTMHVFWCYPVPSSKVSGKSDYFLILLNSCPTRLDRSKELAFLKPILEKMFVKRSFRNGVGTGMKKTSFQRAKS", "length": 89, "header": "sp|P0C0P6-1|NPS_HUMAN Isoform 1 of Neuropeptide S OS=Homo sapiens OX=9606 GN=NPS PE=3 SV=1 CANONICAL=P0C0P6-1" }, "isoforms": [ { "isoform_ac": "P0C0P6-1", "url": "", "sequence": { "sequence": "MISSVKLNLILVLSLSTMHVFWCYPVPSSKVSGKSDYFLILLNSCPTRLDRSKELAFLKPILEKMFVKRSFRNGVGTGMKKTSFQRAKS", "length": 89, "header": "sp|P0C0P6-1|NPS_HUMAN Isoform 1 of Neuropeptide S OS=Homo sapiens OX=9606 GN=NPS PE=3 SV=1 CANONICAL=P0C0P6-1" }, "locus": { "chromosome": "10", "start_pos": 127552636, "end_pos": 127549369, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000398023.3", "url": "https://www.ensembl.org/id/ENST00000398023.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000381105.2", "url": "https://www.ensembl.org/id/ENSP00000381105.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Protease-activated receptors 1 and 4 mediate activation of human platelets by thrombin.", "journal": "The Journal of clinical investigation", "date": "1999", "authors": "Kahn ML, Nakanishi-Matsui M, Shapiro MJ, Ishihara H, Coughlin SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10079109", "url": "https://glygen.org/publication/PubMed/10079109" } ] }, { "title": "Discovery of a receptor related to the galanin receptors.", "journal": "FEBS letters", "date": "1999", "authors": "Lee DK, Nguyen T, O'Neill GP, Cheng R, Liu Y, Howard AD, Coulombe N, Tan CP, Tang-Nguyen AT, George SR, O'Dowd BF", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10100623", "url": "https://glygen.org/publication/PubMed/10100623" } ] }, { "title": "Genomic organization of the human galpha14 and Galphaq genes and mutation analysis in chorea-acanthocytosis (CHAC).", "journal": "Genomics", "date": "1999", "authors": "Rubio JP, Levy ER, Dobson-Stone C, Monaco AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "10191087", "url": "https://glygen.org/publication/PubMed/10191087" } ] }, { "title": "Receptor for motilin identified in the human gastrointestinal system.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Feighner SD, Tan CP, McKee KK, Palyha OC, Hreniuk DL, Pong SS, Austin CP, Figueroa D, MacNeil D, Cascieri MA, Nargund R, Bakshi R, Abramovitz M, Stocco R, Kargman S, O'Neill G, Van Der Ploeg LH, Evans J, Patchett AA, Smith RG, Howard AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10381885", "url": "https://glygen.org/publication/PubMed/10381885" } ] }, { "title": "Melanin-concentrating hormone is the cognate ligand for the orphan G-protein-coupled receptor SLC-1.", "journal": "Nature", "date": "1999", "authors": "Chambers J, Ames RS, Bergsma D, Muir A, Fitzgerald LR, Hervieu G, Dytko GM, Foley JJ, Martin J, Liu WS, Park J, Ellis C, Ganguly S, Konchar S, Cluderay J, Leslie R, Wilson S, Sarau HM", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10421367", "url": "https://glygen.org/publication/PubMed/10421367" } ] }, { "title": "Molecular characterization of the melanin-concentrating-hormone receptor.", "journal": "Nature", "date": "1999", "authors": "Saito Y, Nothacker HP, Wang Z, Lin SH, Leslie F, Civelli O", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10421368", "url": "https://glygen.org/publication/PubMed/10421368" } ] }, { "title": "Proteolytic processing of big endothelin-3 by the kell blood group protein.", "journal": "Blood", "date": "1999", "authors": "Lee S, Lin M, Mele A, Cao Y, Farmar J, Russo D, Redman C", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10438732", "url": "https://glygen.org/publication/PubMed/10438732" } ] }, { "title": "Extensive alternative splicing in the 5'-untranslated region of the rat and human neuropeptide Y Y5 receptor genes regulates receptor expression.", "journal": "Journal of neurochemistry", "date": "1999", "authors": "Parker EM, Xia L", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10461880", "url": "https://glygen.org/publication/PubMed/10461880" } ] }, { "title": "Tissue distribution of prolactin-releasing peptide (PrRP) and its receptor.", "journal": "Regulatory peptides", "date": "1999", "authors": "Fujii R, Fukusumi S, Hosoya M, Kawamata Y, Habata Y, Hinuma S, Sekiguchi M, Kitada C, Kurokawa T, Nishimura O, Onda H, Sumino Y, Fujino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10498338", "url": "https://glygen.org/publication/PubMed/10498338" } ] }, { "title": "Human urotensin-II is a potent vasoconstrictor and agonist for the orphan receptor GPR14.", "journal": "Nature", "date": "1999", "authors": "Ames RS, Sarau HM, Chambers JK, Willette RN, Aiyar NV, Romanic AM, Louden CS, Foley JJ, Sauermelch CF, Coatney RW, Ao Z, Disa J, Holmes SD, Stadel JM, Martin JD, Liu WS, Glover GI, Wilson S, McNulty DE, Ellis CE, Elshourbagy NA, Shabon U, Trill JJ, Hay DW, Ohlstein EH, Bergsma DJ, Douglas SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10499587", "url": "https://glygen.org/publication/PubMed/10499587" } ] }, { "title": "Selective regulation of Galpha(q/11) by an RGS domain in the G protein-coupled receptor kinase, GRK2.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Carman CV, Parent JL, Day PW, Pronin AN, Sternweis PM, Wedegaertner PB, Gilman AG, Benovic JL, Kozasa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "10567430", "url": "https://glygen.org/publication/PubMed/10567430" } ] }, { "title": "Ghrelin is a growth-hormone-releasing acylated peptide from stomach.", "journal": "Nature", "date": "1999", "authors": "Kojima M, Hosoda H, Date Y, Nakazato M, Matsuo H, Kangawa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10604470", "url": "https://glygen.org/publication/PubMed/10604470" } ] }, { "title": "Selective regulation of Gq signaling by G protein-coupled receptor kinase 2: direct interaction of kinase N terminus with activated galphaq.", "journal": "Molecular pharmacology", "date": "2000", "authors": "Sallese M, Mariggio S, D'Urbano E, Iacovelli L, De Blasi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "10727532", "url": "https://glygen.org/publication/PubMed/10727532" } ] }, { "title": "Clinical pharmacokinetics of angiotensin II (AT1) receptor blockers in hypertension.", "journal": "Journal of human hypertension", "date": "2000", "authors": "Israili ZH", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10854085", "url": "https://glygen.org/publication/PubMed/10854085" } ] }, { "title": "G protein-coupled receptor kinase-5 regulates thrombin-activated signaling in endothelial cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Tiruppathi C, Yan W, Sandoval R, Naqvi T, Pronin AN, Benovic JL, Malik AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "10861009", "url": "https://glygen.org/publication/PubMed/10861009" } ] }, { "title": "Identification and characterization of two neuromedin U receptors differentially expressed in peripheral tissues and the central nervous system.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Raddatz R, Wilson AE, Artymyshyn R, Bonini JA, Borowsky B, Boteju LW, Zhou S, Kouranova EV, Nagorny R, Guevarra MS, Dai M, Lerman GS, Vaysse PJ, Branchek TA, Gerald C, Forray C, Adham N", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10899166", "url": "https://glygen.org/publication/PubMed/10899166" } ] }, { "title": "Src tyrosine kinase is a novel direct effector of G proteins.", "journal": "Cell", "date": "2000", "authors": "Ma YC, Huang J, Ali S, Lowry W, Huang XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "11007482", "url": "https://glygen.org/publication/PubMed/11007482" } ] }, { "title": "Structure, function, and control of phosphoinositide-specific phospholipase C.", "journal": "Physiological reviews", "date": "2000", "authors": "Rebecchi MJ, Pentyala SN", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "11015615", "url": "https://glygen.org/publication/PubMed/11015615" } ] }, { "title": "Growth hormone secretagogue receptor family members and ligands.", "journal": "Endocrine", "date": "2001", "authors": "Smith RG, Leonard R, Bailey AR, Palyha O, Feighner S, Tan C, Mckee KK, Pong SS, Griffin P, Howard A", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "11322507", "url": "https://glygen.org/publication/PubMed/11322507" } ] }, { "title": "Metastasis suppressor gene KiSS-1 encodes peptide ligand of a G-protein-coupled receptor.", "journal": "Nature", "date": "2001", "authors": "Ohtaki T, Shintani Y, Honda S, Matsumoto H, Hori A, Kanehashi K, Terao Y, Kumano S, Takatsu Y, Masuda Y, Ishibashi Y, Watanabe T, Asada M, Yamada T, Suenaga M, Kitada C, Usuki S, Kurokawa T, Onda H, Nishimura O, Fujino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "11385580", "url": "https://glygen.org/publication/PubMed/11385580" } ] }, { "title": "The metastasis suppressor gene KiSS-1 encodes kisspeptins, the natural ligands of the orphan G protein-coupled receptor GPR54.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Kotani M, Detheux M, Vandenbogaerde A, Communi D, Vanderwinden JM, Le Poul E, Brezillon S, Tyldesley R, Suarez-Huerta N, Vandeput F, Blanpain C, Schiffmann SN, Vassart G, Parmentier M", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "11457843", "url": "https://glygen.org/publication/PubMed/11457843" } ] }, { "title": "Cloning and molecular characterization of the novel human melanin-concentrating hormone receptor MCH2.", "journal": "Molecular pharmacology", "date": "2001", "authors": "Rodriguez M, Beauverger P, Naime I, Rique H, Ouvry C, Souchaud S, Dromaint S, Nagel N, Suply T, Audinot V, Boutin JA, Galizzi JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "11562423", "url": "https://glygen.org/publication/PubMed/11562423" } ] }, { "title": "Pharmacology of AT1-receptor blockers.", "journal": "Blood pressure. Supplement", "date": "2001", "authors": "Unger T", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "11683476", "url": "https://glygen.org/publication/PubMed/11683476" } ] }, { "title": "Competing modes of self-association in the regulatory domains of Bruton's tyrosine kinase: intramolecular contact versus asymmetric homodimerization.", "journal": "Protein science : a publication of the Protein Society", "date": "2002", "authors": "Laederach A, Cradic KW, Brazin KN, Zamoon J, Fulton DB, Huang XY, Andreotti AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "11742120", "url": "https://glygen.org/publication/PubMed/11742120" } ] }, { "title": "A unique fold of phospholipase C-beta mediates dimerization and interaction with G alpha q.", "journal": "Nature structural biology", "date": "2002", "authors": "Singer AU, Waldo GL, Harden TK, Sondek J", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "11753430", "url": "https://glygen.org/publication/PubMed/11753430" } ] }, { "title": "The orphan receptor C5L2 has high affinity binding sites for complement fragments C5a and C5a des-Arg(74).", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Cain SA, Monk PN", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "11773063", "url": "https://glygen.org/publication/PubMed/11773063" } ] }, { "title": "Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Feldman DS, Zamah AM, Pierce KL, Miller WE, Kelly F, Rapacciuolo A, Rockman HA, Koch WJ, Luttrell LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "12036966", "url": "https://glygen.org/publication/PubMed/12036966" } ] }, { "title": "Mechanism of Galpha i-mediated inhibition of type V adenylyl cyclase.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Dessauer CW, Chen-Goodspeed M, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "12058044", "url": "https://glygen.org/publication/PubMed/12058044" } ] }, { "title": "Similarities and differences in the coupling of human beta1- and beta2-adrenoceptors to Gs(alpha) splice variants.", "journal": "Biochemical pharmacology", "date": "2002", "authors": "Wenzel-Seifert K, Liu HY, Seifert R", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "12106601", "url": "https://glygen.org/publication/PubMed/12106601" } ] }, { "title": "Regulators of G-protein signalling as new central nervous system drug targets.", "journal": "Nature reviews. Drug discovery", "date": "2002", "authors": "Neubig RR, Siderovski DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "12120503", "url": "https://glygen.org/publication/PubMed/12120503" } ] }, { "title": "The pharmacology of cilostazol.", "journal": "Diabetes, obesity & metabolism", "date": "2002", "authors": "Schror K", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "12180353", "url": "https://glygen.org/publication/PubMed/12180353" } ] }, { "title": "Molecular cloning and characterization of prokineticin receptors.", "journal": "Biochimica et biophysica acta", "date": "2002", "authors": "Soga T, Matsumoto Si, Oda T, Saito T, Hiyama H, Takasaki J, Kamohara M, Ohishi T, Matsushime H, Furuichi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "12427552", "url": "https://glygen.org/publication/PubMed/12427552" } ] }, { "title": "The chemoattractant receptor-like protein C5L2 binds the C3a des-Arg77/acylation-stimulating protein.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Kalant D, Cain SA, Maslowska M, Sniderman AD, Cianflone K, Monk PN", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "12540846", "url": "https://glygen.org/publication/PubMed/12540846" } ] }, { "title": "Characterization of a family of endogenous neuropeptide ligands for the G protein-coupled receptors GPR7 and GPR8.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Tanaka H, Yoshida T, Miyamoto N, Motoike T, Kurosu H, Shibata K, Yamanaka A, Williams SC, Richardson JA, Tsujino N, Garry MG, Lerner MR, King DS, O'Dowd BF, Sakurai T, Yanagisawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "12719537", "url": "https://glygen.org/publication/PubMed/12719537" } ] }, { "title": "Molecular cloning of the human brain and gastric cholecystokinin receptor: structure, functional expression and chromosomal localization.", "journal": "Biochemical and biophysical research communications", "date": "1992", "authors": "Pisegna JR, de Weerth A, Huppi K, Wank SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1280419", "url": "https://glygen.org/publication/PubMed/1280419" } ] }, { "title": "Characterization of the 5-HT6 receptor coupled to Ca2+ signaling using an enabling chimeric G-protein.", "journal": "European journal of pharmacology", "date": "2003", "authors": "Zhang JY, Nawoschik S, Kowal D, Smith D, Spangler T, Ochalski R, Schechter L, Dunlop J", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "12860470", "url": "https://glygen.org/publication/PubMed/12860470" } ] }, { "title": "Structure-function analysis of the extracellular domains of the Duffy antigen/receptor for chemokines: characterization of antibody and chemokine binding sites.", "journal": "British journal of haematology", "date": "2003", "authors": "Tournamille C, Filipe A, Wasniowska K, Gane P, Lisowska E, Cartron JP, Colin Y, Le Van Kim C", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "12956774", "url": "https://glygen.org/publication/PubMed/12956774" } ] }, { "title": "Cloning and pharmacological characterization of a human bradykinin (BK-2) receptor.", "journal": "Biochemical and biophysical research communications", "date": "1992", "authors": "Hess JF, Borkowski JA, Young GS, Strader CD, Ransom RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1314587", "url": "https://glygen.org/publication/PubMed/1314587" } ] }, { "title": "Cloning and functional expression of a human neuropeptide Y/peptide YY receptor of the Y1 type.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Larhammar D, Blomqvist AG, Yee F, Jazin E, Yoo H, Wahlested C", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1317848", "url": "https://glygen.org/publication/PubMed/1317848" } ] }, { "title": "The cloning of a family of genes that encode the melanocortin receptors.", "journal": "Science (New York, N.Y.)", "date": "1992", "authors": "Mountjoy KG, Robbins LS, Mortrud MT, Cone RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1325670", "url": "https://glygen.org/publication/PubMed/1325670" } ] }, { "title": "Somatostatin receptors, an expanding gene family: cloning and functional characterization of human SSTR3, a protein coupled to adenylyl cyclase.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1992", "authors": "Yamada Y, Reisine T, Law SF, Ihara Y, Kubota A, Kagimoto S, Seino M, Seino Y, Bell GI, Seino S", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1337145", "url": "https://glygen.org/publication/PubMed/1337145" } ] }, { "title": "Cloning and functional characterization of a family of human and mouse somatostatin receptors expressed in brain, gastrointestinal tract, and kidney.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Yamada Y, Post SR, Wang K, Tager HS, Bell GI, Seino S", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1346068", "url": "https://glygen.org/publication/PubMed/1346068" } ] }, { "title": "Fractionation and characterization of a cyclic adenine ribonucleotide formed by tissue particles.", "journal": "The Journal of biological chemistry", "date": "1958", "authors": "SUTHERLAND EW, RALL TW", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "13549488", "url": "https://glygen.org/publication/PubMed/13549488" } ] }, { "title": "On the structure of human corticotropin (adrenocorticotropic hormone).", "journal": "The Journal of biological chemistry", "date": "1961", "authors": "LEE TH, LERNER AB, BUETTNER-JANUSCH V", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "14463577", "url": "https://glygen.org/publication/PubMed/14463577" } ] }, { "title": "Identification of urotensin II-related peptide as the urotensin II-immunoreactive molecule in the rat brain.", "journal": "Biochemical and biophysical research communications", "date": "2003", "authors": "Sugo T, Murakami Y, Shimomura Y, Harada M, Abe M, Ishibashi Y, Kitada C, Miyajima N, Suzuki N, Mori M, Fujino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "14550283", "url": "https://glygen.org/publication/PubMed/14550283" } ] }, { "title": "The GPR54 gene as a regulator of puberty.", "journal": "The New England journal of medicine", "date": "2003", "authors": "Seminara SB, Messager S, Chatzidaki EE, Thresher RR, Acierno JS Jr, Shagoury JK, Bo-Abbas Y, Kuohung W, Schwinof KM, Hendrick AG, Zahn D, Dixon J, Kaiser UB, Slaugenhaupt SA, Gusella JF, O'Rahilly S, Carlton MB, Crowley WF Jr, Aparicio SA, Colledge WH", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "14573733", "url": "https://glygen.org/publication/PubMed/14573733" } ] }, { "title": "Insights into G protein structure, function, and regulation.", "journal": "Endocrine reviews", "date": "2003", "authors": "Cabrera-Vera TM, Vanhauwe J, Thomas TO, Medkova M, Preininger A, Mazzoni MR, Hamm HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "14671004", "url": "https://glygen.org/publication/PubMed/14671004" } ] }, { "title": "Novel benzo[1,4]diazepin-2-one derivatives as endothelin receptor antagonists.", "journal": "Journal of medicinal chemistry", "date": "2004", "authors": "Bolli MH, Marfurt J, Grisostomi C, Boss C, Binkert C, Hess P, Treiber A, Thorin E, Morrison K, Buchmann S, Bur D, Ramuz H, Clozel M, Fischli W, Weller T", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "15139756", "url": "https://glygen.org/publication/PubMed/15139756" } ] }, { "title": "Beta-arrestin2, a novel member of the arrestin/beta-arrestin gene family.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Attramadal H, Arriza JL, Aoki C, Dawson TM, Codina J, Kwatra MM, Snyder SH, Caron MG, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "1517224", "url": "https://glygen.org/publication/PubMed/1517224" } ] }, { "title": "Neuropeptide S: a neuropeptide promoting arousal and anxiolytic-like effects.", "journal": "Neuron", "date": "2004", "authors": "Xu YL, Reinscheid RK, Huitron-Resendiz S, Clark SD, Wang Z, Lin SH, Brucher FA, Zeng J, Ly NK, Henriksen SJ, de Lecea L, Civelli O", "evidence": [ { "database": "UniProtKB", "id": "P0C0P6", "url": "https://www.uniprot.org/uniprot/P0C0P6" } ], "reference": [ { "type": "PubMed", "id": "15312648", "url": "https://glygen.org/publication/PubMed/15312648" } ] }, { "title": "Identity of an estrogen membrane receptor coupled to a G protein in human breast cancer cells.", "journal": "Endocrinology", "date": "2005", "authors": "Thomas P, Pang Y, Filardo EJ, Dong J", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "15539556", "url": "https://glygen.org/publication/PubMed/15539556" } ] }, { "title": "Cloning and characterization of a human angiotensin II type 1 receptor.", "journal": "Biochemical and biophysical research communications", "date": "1992", "authors": "Bergsma DJ, Ellis C, Kumar C, Nuthulaganti P, Kersten H, Elshourbagy N, Griffin E, Stadel JM, Aiyar N", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1567413", "url": "https://glygen.org/publication/PubMed/1567413" } ] }, { "title": "Effects of piclamilast, a selective phosphodiesterase-4 inhibitor, on oxidative burst of sputum cells from mild asthmatics and stable COPD patients.", "journal": "Lung", "date": "2004", "authors": "Beeh KM, Beier J, Lerch C, Schulz AK, Buhl R", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "15765929", "url": "https://glygen.org/publication/PubMed/15765929" } ] }, { "title": "Cyclic nucleotide phosphodiesterase-mediated integration of cGMP and cAMP signaling in cells of the cardiovascular system.", "journal": "Frontiers in bioscience : a journal and virtual library", "date": "2005", "authors": "Maurice DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "15769620", "url": "https://glygen.org/publication/PubMed/15769620" } ] }, { "title": "Characterization of GPRA, a novel G protein-coupled receptor related to asthma.", "journal": "American journal of respiratory cell and molecular biology", "date": "2005", "authors": "Vendelin J, Pulkkinen V, Rehn M, Pirskanen A, Raisanen-Sokolowski A, Laitinen A, Laitinen LA, Kere J, Laitinen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "15947423", "url": "https://glygen.org/publication/PubMed/15947423" } ] }, { "title": "The GAPs, GEFs, and GDIs of heterotrimeric G-protein alpha subunits.", "journal": "International journal of biological sciences", "date": "2005", "authors": "Siderovski DP, Willard FS", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "15951850", "url": "https://glygen.org/publication/PubMed/15951850" } ] }, { "title": "Cell signalling diversity of the Gqalpha family of heterotrimeric G proteins.", "journal": "Cellular signalling", "date": "2006", "authors": "Hubbard KB, Hepler JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16182515", "url": "https://glygen.org/publication/PubMed/16182515" } ] }, { "title": "Galphaq binds to p110alpha/p85alpha phosphoinositide 3-kinase and displaces Ras.", "journal": "The Biochemical journal", "date": "2006", "authors": "Ballou LM, Chattopadhyay M, Li Y, Scarlata S, Lin RZ", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16268778", "url": "https://glygen.org/publication/PubMed/16268778" } ] }, { "title": "Preferential inhibition of human phosphodiesterase 4 by ibudilast.", "journal": "Life sciences", "date": "2006", "authors": "Huang Z, Liu S, Zhang L, Salem M, Greig GM, Chan CC, Natsumeda Y, Noguchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "16313925", "url": "https://glygen.org/publication/PubMed/16313925" } ] }, { "title": "Snapshot of activated G proteins at the membrane: the Galphaq-GRK2-Gbetagamma complex.", "journal": "Science (New York, N.Y.)", "date": "2005", "authors": "Tesmer VM, Kawano T, Shankaranarayanan A, Kozasa T, Tesmer JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16339447", "url": "https://glygen.org/publication/PubMed/16339447" } ] }, { "title": "Two distinct bombesin receptor subtypes are expressed and functional in human lung carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Corjay MH, Dobrzanski DJ, Way JM, Viallet J, Shapira H, Worland P, Sausville EA, Battey JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1655761", "url": "https://glygen.org/publication/PubMed/1655761" } ] }, { "title": "G-protein-coupled receptor kinase specificity for beta-arrestin recruitment to the beta2-adrenergic receptor revealed by fluorescence resonance energy transfer.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Violin JD, Ren XR, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "16687412", "url": "https://glygen.org/publication/PubMed/16687412" } ] }, { "title": "Stable association between G alpha(q) and phospholipase C beta 1 in living cells.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Dowal L, Provitera P, Scarlata S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16754659", "url": "https://glygen.org/publication/PubMed/16754659" } ] }, { "title": "Structure-function relationships in the neuropeptide S receptor: molecular consequences of the asthma-associated mutation N107I.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Bernier V, Stocco R, Bogusky MJ, Joyce JG, Parachoniak C, Grenier K, Arget M, Mathieu MC, O'Neill GP, Slipetz D, Crackower MA, Tan CM, Therien AG", "evidence": [ { "database": "UniProtKB", "id": "P0C0P6", "url": "https://www.uniprot.org/uniprot/P0C0P6" } ], "reference": [ { "type": "PubMed", "id": "16790440", "url": "https://glygen.org/publication/PubMed/16790440" } ] }, { "title": "Structural basis of function in heterotrimeric G proteins.", "journal": "Quarterly reviews of biophysics", "date": "2006", "authors": "Oldham WM, Hamm HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16923326", "url": "https://glygen.org/publication/PubMed/16923326" } ] }, { "title": "Cloning and sequence analysis of a cDNA encoding human non-selective type of endothelin receptor.", "journal": "Biochemical and biophysical research communications", "date": "1991", "authors": "Nakamuta M, Takayanagi R, Sakai Y, Sakamoto S, Hagiwara H, Mizuno T, Saito Y, Hirose S, Yamamoto M, Nawata H", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1710450", "url": "https://glygen.org/publication/PubMed/1710450" } ] }, { "title": "Human galanin: primary structure and identification of two molecular forms.", "journal": "FEBS letters", "date": "1991", "authors": "Bersani M, Johnsen AH, Hojrup P, Dunning BE, Andreasen JJ, Holst JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1710578", "url": "https://glygen.org/publication/PubMed/1710578" } ] }, { "title": "Phosphodiesterase 4 inhibitors for the treatment of asthma and COPD.", "journal": "Current medicinal chemistry", "date": "2006", "authors": "Huang Z, Mancini JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "17168849", "url": "https://glygen.org/publication/PubMed/17168849" } ] }, { "title": "Cloning and characterization of cDNA encoding human A-type endothelin receptor.", "journal": "Biochemical and biophysical research communications", "date": "1991", "authors": "Adachi M, Yang YY, Furuichi Y, Miyamoto C", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1719979", "url": "https://glygen.org/publication/PubMed/1719979" } ] }, { "title": "Isolation and primary structure of pituitary human galanin, a 30-residue nonamidated neuropeptide.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Schmidt WE, Kratzin H, Eckart K, Drevs D, Mundkowski G, Clemens A, Katsoulis S, Schafer H, Gallwitz B, Creutzfeldt W", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1722333", "url": "https://glygen.org/publication/PubMed/1722333" } ] }, { "title": "PDE4 inhibitors as potential therapeutic agents in the treatment of COPD-focus on roflumilast.", "journal": "International journal of chronic obstructive pulmonary disease", "date": "2007", "authors": "Boswell-Smith V, Spina D", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "18044684", "url": "https://glygen.org/publication/PubMed/18044684" } ] }, { "title": "Bradykinin, a hypotensive and smooth muscle stimulating factor released from plasma globulin by snake venoms and by trypsin.", "journal": "The American journal of physiology", "date": "1949", "authors": "ROCHA E SILVA M, BERALDO WT, ROSENFELD G", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "18127230", "url": "https://glygen.org/publication/PubMed/18127230" } ] }, { "title": "Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Soundararajan M, Willard FS, Kimple AJ, Turnbull AP, Ball LJ, Schoch GA, Gileadi C, Fedorov OY, Dowler EF, Higman VA, Hutsell SQ, Sundstrom M, Doyle DA, Siderovski DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "18434541", "url": "https://glygen.org/publication/PubMed/18434541" } ] }, { "title": "The chemotactic receptor for human C5a anaphylatoxin.", "journal": "Nature", "date": "1991", "authors": "Gerard NP, Gerard C", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1847994", "url": "https://glygen.org/publication/PubMed/1847994" } ] }, { "title": "Galphaq binds two effectors separately in cells: evidence for predetermined signaling pathways.", "journal": "Biophysical journal", "date": "2008", "authors": "Golebiewska U, Scarlata S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "18515384", "url": "https://glygen.org/publication/PubMed/18515384" } ] }, { "title": "Dissociation of heterotrimeric g proteins in cells.", "journal": "Science signaling", "date": "2008", "authors": "Lambert NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "18577758", "url": "https://glygen.org/publication/PubMed/18577758" } ] }, { "title": "Assembly of high order G alpha q-effector complexes with RGS proteins.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Shankaranarayanan A, Thal DM, Tesmer VM, Roman DL, Neubig RR, Kozasa T, Tesmer JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "18936096", "url": "https://glygen.org/publication/PubMed/18936096" } ] }, { "title": "G alpha 16, a G protein alpha subunit specifically expressed in hematopoietic cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Amatruda TT 3rd, Steele DA, Slepak VZ, Simon MI", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "1905813", "url": "https://glygen.org/publication/PubMed/1905813" } ] }, { "title": "The efficacy and safety of cilomilast in COPD.", "journal": "Drugs", "date": "2008", "authors": "Rennard S, Knobil K, Rabe KF, Morris A, Schachter N, Locantore N, Canonica WG, Zhu Y, Barnhart F", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "19105585", "url": "https://glygen.org/publication/PubMed/19105585" } ] }, { "title": "AN-2728, a PDE4 inhibitor for the potential topical treatment of psoriasis and atopic dermatitis.", "journal": "Current opinion in investigational drugs (London, England : 2000)", "date": "2009", "authors": "Nazarian R, Weinberg JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "19876791", "url": "https://glygen.org/publication/PubMed/19876791" } ] }, { "title": "Ibudilast: a review of its pharmacology, efficacy and safety in respiratory and neurological disease.", "journal": "Expert opinion on pharmacotherapy", "date": "2009", "authors": "Rolan P, Hutchinson M, Johnson K", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "19929708", "url": "https://glygen.org/publication/PubMed/19929708" } ] }, { "title": "The preclinical pharmacology of roflumilast--a selective, oral phosphodiesterase 4 inhibitor in development for chronic obstructive pulmonary disease.", "journal": "Pulmonary pharmacology & therapeutics", "date": "2010", "authors": "Hatzelmann A, Morcillo EJ, Lungarella G, Adnot S, Sanjar S, Beume R, Schudt C, Tenor H", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "20381629", "url": "https://glygen.org/publication/PubMed/20381629" } ] }, { "title": "Ibudilast, a mixed PDE3/4 inhibitor, causes a selective and nitric oxide/cGMP-independent relaxation of the intracranial vertebrobasilar artery.", "journal": "European journal of pharmacology", "date": "2011", "authors": "Yamazaki T, Anraku T, Matsuzawa S", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "21036126", "url": "https://glygen.org/publication/PubMed/21036126" } ] }, { "title": "beta-Arrestin: a protein that regulates beta-adrenergic receptor function.", "journal": "Science (New York, N.Y.)", "date": "1990", "authors": "Lohse MJ, Benovic JL, Codina J, Caron MG, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "2163110", "url": "https://glygen.org/publication/PubMed/2163110" } ] }, { "title": "GPR37 and GPR37L1 are receptors for the neuroprotective and glioprotective factors prosaptide and prosaposin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Meyer RC, Giddens MM, Schaefer SA, Hall RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "23690594", "url": "https://glygen.org/publication/PubMed/23690594" } ] }, { "title": "Pharmacology of the bipyridines: amrinone and milrinone.", "journal": "Circulation", "date": "1986", "authors": "Alousi AA, Johnson DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "2417744", "url": "https://glygen.org/publication/PubMed/2417744" } ] }, { "title": "A single-nucleotide polymorphism of human neuropeptide s gene originated from Europe shows decreased bioactivity.", "journal": "PloS one", "date": "2013", "authors": "Deng C, He X, Hsueh AJ", "evidence": [ { "database": "RefSeq", "id": "NP_001025184", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025184" } ], "reference": [ { "type": "PubMed", "id": "24386135", "url": "https://glygen.org/publication/PubMed/24386135" } ] }, { "title": "Advances in targeting cyclic nucleotide phosphodiesterases.", "journal": "Nature reviews. Drug discovery", "date": "2014", "authors": "Maurice DH, Ke H, Ahmad F, Wang Y, Chung J, Manganiello VC", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "24687066", "url": "https://glygen.org/publication/PubMed/24687066" } ] }, { "title": "Pharmacokinetic-pharmacodynamic relationships of macitentan, a new endothelin receptor antagonist, after multiple dosing in healthy Korean subjects.", "journal": "American journal of cardiovascular drugs : drugs, devices, and other interventions", "date": "2014", "authors": "Ahn LY, Kim SE, Yi S, Dingemanse J, Lim KS, Jang IJ, Yu KS", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "24906252", "url": "https://glygen.org/publication/PubMed/24906252" } ] }, { "title": "Expression of Gs alpha in Escherichia coli. Purification and properties of two forms of the protein.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Graziano MP, Freissmuth M, Gilman AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "2491850", "url": "https://glygen.org/publication/PubMed/2491850" } ] }, { "title": "Pharmacology of positive inotropic phosphodiesterase III inhibitors.", "journal": "European heart journal", "date": "1989", "authors": "Honerjager P", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "2553411", "url": "https://glygen.org/publication/PubMed/2553411" } ] }, { "title": "Multiple signaling pathways of histamine H2 receptors. Identification of an H2 receptor-dependent Ca2+ mobilization pathway in human HL-60 promyelocytic leukemia cells.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Mitsuhashi M, Mitsuhashi T, Payan DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "2553705", "url": "https://glygen.org/publication/PubMed/2553705" } ] }, { "title": "Pentoxifylline for intermittent claudication.", "journal": "The Cochrane database of systematic reviews", "date": "2015", "authors": "Salhiyyah K, Forster R, Senanayake E, Abdel-Hadi M, Booth A, Michaels JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "26417854", "url": "https://glygen.org/publication/PubMed/26417854" } ] }, { "title": "The human endothelin family: three structurally and pharmacologically distinct isopeptides predicted by three separate genes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Inoue A, Yanagisawa M, Kimura S, Kasuya Y, Miyauchi T, Goto K, Masaki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "2649896", "url": "https://glygen.org/publication/PubMed/2649896" } ] }, { "title": "Preparation and preliminary characterization of recombinant neurolysin for in vivo studies.", "journal": "Journal of biotechnology", "date": "2016", "authors": "Wangler NJ, Jayaraman S, Zhu R, Mechref Y, Abbruscato TJ, Bickel U, Karamyan VT", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "27496565", "url": "https://glygen.org/publication/PubMed/27496565" } ] }, { "title": "Purification and characterization of membrane-bound phospholipase C specific for phosphoinositides from human platelets.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Banno Y, Yada Y, Nozawa Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "2841328", "url": "https://glygen.org/publication/PubMed/2841328" } ] }, { "title": "Neuropeptide S (NPS) variants modify the signaling and risk effects of NPS Receptor 1 (NPSR1) variants in asthma.", "journal": "PloS one", "date": "2017", "authors": "Acevedo N, Ezer S, Kebede Merid S, Gaertner VD, Soderhall C, D'Amato M, Kabesch M, Melen E, Kere J, Pulkkinen V", "evidence": [ { "database": "RefSeq", "id": "NP_001025184", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025184" } ], "reference": [ { "type": "PubMed", "id": "28463995", "url": "https://glygen.org/publication/PubMed/28463995" } ] }, { "title": "Beta-adrenergic receptor kinase: identification of a novel protein kinase that phosphorylates the agonist-occupied form of the receptor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1986", "authors": "Benovic JL, Strasser RH, Caron MG, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "2871555", "url": "https://glygen.org/publication/PubMed/2871555" } ] }, { "title": "Effect and safety of roflumilast for chronic obstructive pulmonary disease in Chinese patients.", "journal": "Medicine", "date": "2018", "authors": "Liu DY, Wang ZG, Gao Y, Zhang HM, Zhang YX, Wang XJ, Peng D", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "29443750", "url": "https://glygen.org/publication/PubMed/29443750" } ] }, { "title": "Use of cilomilast-loaded phosphatiosomes to suppress neutrophilic inflammation for attenuating acute lung injury: the effect of nanovesicular surface charge.", "journal": "Journal of nanobiotechnology", "date": "2018", "authors": "Liu FC, Yu HP, Lin CY, Elzoghby AO, Hwang TL, Fang JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "29602314", "url": "https://glygen.org/publication/PubMed/29602314" } ] }, { "title": "IL-12/IL-23p40 identified as a downstream target of apremilast in ex vivo models of arthritis.", "journal": "Therapeutic advances in musculoskeletal disease", "date": "2019", "authors": "Kragstrup TW, Adams M, Lomholt S, Nielsen MA, Heftdal LD, Schafer P, Deleuran B", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "30833991", "url": "https://glygen.org/publication/PubMed/30833991" } ] }, { "title": "The influence of bound GDP on the kinetics of guanine nucleotide binding to G proteins.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Ferguson KM, Higashijima T, Smigel MD, Gilman AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "3086311", "url": "https://glygen.org/publication/PubMed/3086311" } ] }, { "title": "Isolation and characterization of the human Gs alpha gene.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1988", "authors": "Kozasa T, Itoh H, Tsukamoto T, Kaziro Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "3127824", "url": "https://glygen.org/publication/PubMed/3127824" } ] }, { "title": "Crisaborole 2% ointment for the treatment of intertriginous, anogenital, and facial psoriasis: A double-blind, randomized, vehicle-controlled trial.", "journal": "Journal of the American Academy of Dermatology", "date": "2020", "authors": "Hashim PW, Chima M, Kim HJ, Bares J, Yao CJ, Singer G, Chen T, Genece J, Baum D, Kimmel GW, Nia JK, Gagliotti M, Lebwohl MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "31279028", "url": "https://glygen.org/publication/PubMed/31279028" } ] }, { "title": "Dopamine D1 and D2 receptors mediate neuropeptide S-induced antinociception in the mouse formalin test.", "journal": "European journal of pharmacology", "date": "2019", "authors": "Holanda VAD, Oliveira MC, Souza LS, Lobao-Soares B, Andre E, Da Silva Junior ED, Guerrini R, Calo G, Ruzza C, Gavioli EC", "evidence": [ { "database": "RefSeq", "id": "NP_001025184", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025184" } ], "reference": [ { "type": "PubMed", "id": "31326375", "url": "https://glygen.org/publication/PubMed/31326375" } ] }, { "title": "Effect of the inhaled PDE4 inhibitor CHF6001 on biomarkers of inflammation in COPD.", "journal": "Respiratory research", "date": "2019", "authors": "Singh D, Beeh KM, Colgan B, Kornmann O, Leaker B, Watz H, Lucci G, Geraci S, Emirova A, Govoni M, Nandeuil MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "31399091", "url": "https://glygen.org/publication/PubMed/31399091" } ] }, { "title": "Simple assessment of quality of life and lower limb functional capacity during cilostazol treatment - results of the SHort-tERm cIlostazol eFFicacy and quality of life (SHERIFF) study.", "journal": "VASA. Zeitschrift fur Gefasskrankheiten", "date": "2020", "authors": "Farkas K, Kolossvary E, Jarai Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "31983287", "url": "https://glygen.org/publication/PubMed/31983287" } ] }, { "title": "Isolation and primary structure of human peptide YY.", "journal": "Biochemical and biophysical research communications", "date": "1988", "authors": "Tatemoto K, Nakano I, Makk G, Angwin P, Mann M, Schilling J, Go VL", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "3202875", "url": "https://glygen.org/publication/PubMed/3202875" } ] }, { "title": "Inhaled Phosphodiesterase 4 (PDE4) Inhibitors for Inflammatory Respiratory Diseases.", "journal": "Frontiers in pharmacology", "date": "2020", "authors": "Phillips JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "32226383", "url": "https://glygen.org/publication/PubMed/32226383" } ] }, { "title": "Commentary: Phosphodiesterase 4 inhibitors as potential adjunct treatment targeting the cytokine storm in COVID-19.", "journal": "Metabolism: clinical and experimental", "date": "2020", "authors": "Dalamaga M, Karampela I, Mantzoros CS", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "32497535", "url": "https://glygen.org/publication/PubMed/32497535" } ] }, { "title": "Repositioning of pentoxifylline as an immunomodulator and regulator of the renin-angiotensin system in the treatment of COVID-19.", "journal": "Medical hypotheses", "date": "2020", "authors": "Maldonado V, Loza-Mejia MA, Chavez-Alderete J", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "32540603", "url": "https://glygen.org/publication/PubMed/32540603" } ] }, { "title": "COVID-19 patients with psoriasis and psoriatic arthritis on biologic immunosuppressant therapy vs apremilast in North Spain.", "journal": "Dermatologic therapy", "date": "2020", "authors": "Queiro Silva R, Armesto S, Gonzalez Vela C, Naharro Fernandez C, Gonzalez-Gay MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "32618402", "url": "https://glygen.org/publication/PubMed/32618402" } ] }, { "title": "Hypothesis: Pentoxifylline is a potential cytokine modulator therapeutic in COVID-19 patients.", "journal": "Pharmacology research & perspectives", "date": "2020", "authors": "Hendry BM, Stafford N, Arnold AD, Sangwaiya A, Manglam V, Rosen SD, Arnold J", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "32715661", "url": "https://glygen.org/publication/PubMed/32715661" } ] }, { "title": "Pentoxifylline: A Drug with Antiviral and Anti-Inflammatory Effects to Be Considered in the Treatment of Coronavirus Disease 2019.", "journal": "Medical principles and practice : international journal of the Kuwait University, Health Science Centre", "date": "2021", "authors": "Ghasemnejad-Berenji M, Pashapour S, Sadeghpour S", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "33049737", "url": "https://glygen.org/publication/PubMed/33049737" } ] }, { "title": "Neandertal introgression and accumulation of hypomorphic mutations in the neuropeptide S (NPS) system promote attenuated functionality.", "journal": "Peptides", "date": "2021", "authors": "Reinscheid RK, Mafessoni F, Luttjohann A, Jungling K, Pape HC, Schulz S", "evidence": [ { "database": "RefSeq", "id": "NP_001025184", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025184" } ], "reference": [ { "type": "PubMed", "id": "33556445", "url": "https://glygen.org/publication/PubMed/33556445" } ] }, { "title": "Isolation and identification of hydroxyproline analogues of bradykinin in human urine.", "journal": "FEBS letters", "date": "1988", "authors": "Kato H, Matsumura Y, Maeda H", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "3366244", "url": "https://glygen.org/publication/PubMed/3366244" } ] }, { "title": "Further refining the critical region of 10q26 microdeletion syndrome: A possible involvement of INSYN2 and NPS in the cognitive phenotype.", "journal": "European journal of medical genetics", "date": "2021", "authors": "Cherik F, Lepage M, Remerand G, Francannet C, Delabaere A, Salaun G, Pebrel-Richard C, Gouas L, Vago P, Tchirkov A, Goumy C", "evidence": [ { "database": "RefSeq", "id": "NP_001025184", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001025184" } ], "reference": [ { "type": "PubMed", "id": "34252586", "url": "https://glygen.org/publication/PubMed/34252586" } ] }, { "title": "Purification and characterization of a novel neurotensin-degrading peptidase from rat brain synaptic membranes.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Checler F, Vincent JP, Kitabgi P", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "3525564", "url": "https://glygen.org/publication/PubMed/3525564" } ] }, { "title": "Molecular cloning of the human cholecystokinin gene by use of a synthetic probe containing deoxyinosine.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1985", "authors": "Takahashi Y, Kato K, Hayashizaki Y, Wakabayashi T, Ohtsuka E, Matsuki S, Ikehara M, Matsubara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "3856870", "url": "https://glygen.org/publication/PubMed/3856870" } ] }, { "title": "The new inotropic phosphodiesterase inhibitors.", "journal": "Archives internationales de physiologie et de biochimie", "date": "1984", "authors": "el Allaf D, D'Orio V, Carlier J", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "6085243", "url": "https://glygen.org/publication/PubMed/6085243" } ] }, { "title": "Isolation and structural organization of the human corticotropin--beta-lipotropin precursor gene.", "journal": "FEBS letters", "date": "1981", "authors": "Takahashi H, Teranishi Y, Nakanishi S, Numa S", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "6274691", "url": "https://glygen.org/publication/PubMed/6274691" } ] }, { "title": "Isolation and structural organization of the human preproenkephalin gene.", "journal": "Nature", "date": "1982", "authors": "Noda M, Teranishi Y, Takahashi H, Toyosato M, Notake M, Nakanishi S, Numa S", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "6281660", "url": "https://glygen.org/publication/PubMed/6281660" } ] }, { "title": "A cDNA encoding a small common precursor for human pancreatic polypeptide and pancreatic icosapeptide.", "journal": "The EMBO journal", "date": "1984", "authors": "Boel E, Schwartz TW, Norris KE, Fiil NP", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "6373251", "url": "https://glygen.org/publication/PubMed/6373251" } ] }, { "title": "Cloning, characterization, and DNA sequence of a human cDNA encoding neuropeptide tyrosine.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1984", "authors": "Minth CD, Bloom SR, Polak JM, Dixon JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "6589611", "url": "https://glygen.org/publication/PubMed/6589611" } ] }, { "title": "Primary structure of the human Met- and Leu-enkephalin precursor and its mRNA.", "journal": "Nature", "date": "1982", "authors": "Comb M, Seeburg PH, Adelman J, Eiden L, Herbert E", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "7057924", "url": "https://glygen.org/publication/PubMed/7057924" } ] }, { "title": "Molecular cloning of a functional human galanin receptor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Habert-Ortoli E, Amiranoff B, Loquet I, Laburthe M, Mayaux JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "7524088", "url": "https://glygen.org/publication/PubMed/7524088" } ] }, { "title": "The cloning and chromosomal mapping of two novel human opioid-somatostatin-like receptor genes, GPR7 and GPR8, expressed in discrete areas of the brain.", "journal": "Genomics", "date": "1995", "authors": "O'Dowd BF, Scheideler MA, Nguyen T, Cheng R, Rasmussen JS, Marchese A, Zastawny R, Heng HH, Tsui LC, Shi X, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "7590751", "url": "https://glygen.org/publication/PubMed/7590751" } ] }, { "title": "Expression cloning and pharmacological characterization of a human hippocampal neuropeptide Y/peptide YY Y2 receptor subtype.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Gerald C, Walker MW, Vaysse PJ, He C, Branchek TA, Weinshank RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "7592910", "url": "https://glygen.org/publication/PubMed/7592910" } ] }, { "title": "Cloning and functional expression of a human Y4 subtype receptor for pancreatic polypeptide, neuropeptide Y, and peptide YY.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Bard JA, Walker MW, Branchek TA, Weinshank RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "7592911", "url": "https://glygen.org/publication/PubMed/7592911" } ] }, { "title": "kappa-Opioid receptor in humans: cDNA and genomic cloning, chromosomal assignment, functional expression, pharmacology, and expression pattern in the central nervous system.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Simonin F, Gaveriaux-Ruff C, Befort K, Matthes H, Lannes B, Micheletti G, Mattei MG, Charron G, Bloch B, Kieffer B", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "7624359", "url": "https://glygen.org/publication/PubMed/7624359" } ] }, { "title": "Endothelin-converting enzyme-2 is a membrane-bound, phosphoramidon-sensitive metalloprotease with acidic pH optimum.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Emoto N, Yanagisawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "7797512", "url": "https://glygen.org/publication/PubMed/7797512" } ] }, { "title": "Human mu opiate receptor. cDNA and genomic clones, pharmacologic characterization and chromosomal assignment.", "journal": "FEBS letters", "date": "1994", "authors": "Wang JB, Johnson PS, Persico AM, Hawkins AL, Griffin CA, Uhl GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "7905839", "url": "https://glygen.org/publication/PubMed/7905839" } ] }, { "title": "Mechanism of GTP hydrolysis by G-protein alpha subunits.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Kleuss C, Raw AS, Lee E, Sprang SR, Gilman AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "7937899", "url": "https://glygen.org/publication/PubMed/7937899" } ] }, { "title": "Pharmacological characterization of bosentan, a new potent orally active nonpeptide endothelin receptor antagonist.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "1994", "authors": "Clozel M, Breu V, Gray GA, Kalina B, Loffler BM, Burri K, Cassal JM, Hirth G, Muller M, Neidhart W, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8035319", "url": "https://glygen.org/publication/PubMed/8035319" } ] }, { "title": "ECE-1: a membrane-bound metalloprotease that catalyzes the proteolytic activation of big endothelin-1.", "journal": "Cell", "date": "1994", "authors": "Xu D, Emoto N, Giaid A, Slaughter C, Kaw S, deWit D, Yanagisawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8062389", "url": "https://glygen.org/publication/PubMed/8062389" } ] }, { "title": "Expression cloning of a human B1 bradykinin receptor.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Menke JG, Borkowski JA, Bierilo KK, MacNeil T, Derrick AW, Schneck KA, Ransom RW, Strader CD, Linemeyer DL, Hess JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8063797", "url": "https://glygen.org/publication/PubMed/8063797" } ] }, { "title": "Molecular cloning and expression of the gene encoding human angiotensin II type 2 receptor.", "journal": "Biochemical and biophysical research communications", "date": "1994", "authors": "Tsuzuki S, Ichiki T, Nakakubo H, Kitami Y, Guo DF, Shirai H, Inagami T", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8185599", "url": "https://glygen.org/publication/PubMed/8185599" } ] }, { "title": "Identification of a human delta opioid receptor: cloning and expression.", "journal": "Life sciences", "date": "1994", "authors": "Knapp RJ, Malatynska E, Fang L, Li X, Babin E, Nguyen M, Santoro G, Varga EV, Hruby VJ, Roeske WR, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8201839", "url": "https://glygen.org/publication/PubMed/8201839" } ] }, { "title": "Cloning of glycoprotein D cDNA, which encodes the major subunit of the Duffy blood group system and the receptor for the Plasmodium vivax malaria parasite.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Chaudhuri A, Polyakova J, Zbrzezna V, Williams K, Gulati S, Pogo AO", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8248172", "url": "https://glygen.org/publication/PubMed/8248172" } ] }, { "title": "A human gene that shows identity with the gene encoding the angiotensin receptor is located on chromosome 11.", "journal": "Gene", "date": "1993", "authors": "O'Dowd BF, Heiber M, Chan A, Heng HH, Tsui LC, Kennedy JL, Shi X, Petronis A, George SR, Nguyen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8294032", "url": "https://glygen.org/publication/PubMed/8294032" } ] }, { "title": "Polypeptide variants of beta-arrestin and arrestin3.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Sterne-Marr R, Gurevich VV, Goldsmith P, Bodine RC, Sanders C, Donoso LA, Benovic JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "8340388", "url": "https://glygen.org/publication/PubMed/8340388" } ] }, { "title": "Cloning, functional expression and pharmacological characterization of a fourth (hSSTR4) and a fifth (hSSTR5) human somatostatin receptor subtype.", "journal": "Biochemical and biophysical research communications", "date": "1993", "authors": "Yamada Y, Kagimoto S, Kubota A, Yasuda K, Masuda K, Someya Y, Ihara Y, Li Q, Imura H, Seino S, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8373420", "url": "https://glygen.org/publication/PubMed/8373420" } ] }, { "title": "Cloning and expression of a complementary DNA encoding a high affinity human neurotensin receptor.", "journal": "FEBS letters", "date": "1993", "authors": "Vita N, Laurent P, Lefort S, Chalon P, Dumont X, Kaghad M, Gully D, Le Fur G, Ferrara P, Caput D", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8381365", "url": "https://glygen.org/publication/PubMed/8381365" } ] }, { "title": "BRS-3: a novel bombesin receptor subtype selectively expressed in testis and lung carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Fathi Z, Corjay MH, Shapira H, Wada E, Benya R, Jensen R, Viallet J, Sausville EA, Battey JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8383682", "url": "https://glygen.org/publication/PubMed/8383682" } ] }, { "title": "Molecular cloning of a functional human thyrotropin-releasing hormone receptor.", "journal": "Biochemical and biophysical research communications", "date": "1993", "authors": "Matre V, Karlsen HE, Wright MS, Lundell I, Fjeldheim AK, Gabrielsen OS, Larhammar D, Gautvik KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8395824", "url": "https://glygen.org/publication/PubMed/8395824" } ] }, { "title": "Molecular characterization and regulation of the human endothelin receptors.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Elshourbagy NA, Korman DR, Wu HL, Sylvester DR, Lee JA, Nuthalaganti P, Bergsma DJ, Kumar CS, Nambi P", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8440682", "url": "https://glygen.org/publication/PubMed/8440682" } ] }, { "title": "Molecular cloning of a novel melanocortin receptor.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Gantz I, Konda Y, Tashiro T, Shimoto Y, Miwa H, Munzert G, Watson SJ, DelValle J, Yamada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8463333", "url": "https://glygen.org/publication/PubMed/8463333" } ] }, { "title": "Molecular cloning and functional expression of the human gallbladder cholecystokinin A receptor.", "journal": "Biochemical and biophysical research communications", "date": "1993", "authors": "Ulrich CD, Ferber I, Holicky E, Hadac E, Buell G, Miller LJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8503909", "url": "https://glygen.org/publication/PubMed/8503909" } ] }, { "title": "Phosphorylation and desensitization of human m2 muscarinic cholinergic receptors by two isoforms of the beta-adrenergic receptor kinase.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Richardson RM, Kim C, Benovic JL, Hosey MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "8514797", "url": "https://glygen.org/publication/PubMed/8514797" } ] }, { "title": "Molecular cloning, expression and potential functions of the human proteinase-activated receptor-2.", "journal": "The Biochemical journal", "date": "1996", "authors": "Bohm SK, Kong W, Bromme D, Smeekens SP, Anderson DC, Connolly A, Kahn M, Nelken NA, Coughlin SR, Payan DG, Bunnett NW", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8615752", "url": "https://glygen.org/publication/PubMed/8615752" } ] }, { "title": "Human G(alpha q): cDNA and tissue distribution.", "journal": "Biochimica et biophysica acta", "date": "1996", "authors": "Chen B, Leverette RD, Schwinn DA, Kwatra MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "8664309", "url": "https://glygen.org/publication/PubMed/8664309" } ] }, { "title": "Cloning and chromosomal mapping of three novel genes, GPR9, GPR10, and GPR14, encoding receptors related to interleukin 8, neuropeptide Y, and somatostatin receptors.", "journal": "Genomics", "date": "1995", "authors": "Marchese A, Heiber M, Nguyen T, Heng HH, Saldivia VR, Cheng R, Murphy PM, Tsui LC, Shi X, Gregor P, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8666380", "url": "https://glygen.org/publication/PubMed/8666380" } ] }, { "title": "Members of the G protein-coupled receptor kinase family that phosphorylate the beta2-adrenergic receptor facilitate sequestration.", "journal": "Biochemistry", "date": "1996", "authors": "Menard L, Ferguson SS, Barak LS, Bertrand L, Premont RT, Colapietro AM, Lefkowitz RJ, Caron MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "8672451", "url": "https://glygen.org/publication/PubMed/8672451" } ] }, { "title": "Molecular cloning and characterization of the human anaphylatoxin C3a receptor.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Ames RS, Li Y, Sarau HM, Nuthulaganti P, Foley JJ, Ellis C, Zeng Z, Su K, Jurewicz AJ, Hertzberg RP, Bergsma DJ, Kumar C", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8702752", "url": "https://glygen.org/publication/PubMed/8702752" } ] }, { "title": "Primary structure of human prethrombin 2 and alpha-thrombin.", "journal": "The Journal of biological chemistry", "date": "1977", "authors": "Butkowski RJ, Elion J, Downing MR, Mann KG", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "873923", "url": "https://glygen.org/publication/PubMed/873923" } ] }, { "title": "Pharmacokinetics and pharmacodynamics of the endothelin-receptor antagonist bosentan in healthy human subjects.", "journal": "Clinical pharmacology and therapeutics", "date": "1996", "authors": "Weber C, Schmitt R, Birnboeck H, Hopfgartner G, van Marle SP, Peeters PA, Jonkman JH, Jones CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8823230", "url": "https://glygen.org/publication/PubMed/8823230" } ] }, { "title": "Discovery of TBC11251, a potent, long acting, orally active endothelin receptor-A selective antagonist.", "journal": "Journal of medicinal chemistry", "date": "1997", "authors": "Wu C, Chan MF, Stavros F, Raju B, Okun I, Mong S, Keller KM, Brock T, Kogan TP, Dixon RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9171878", "url": "https://glygen.org/publication/PubMed/9171878" } ] }, { "title": "Anagrelide as a new platelet-lowering agent in essential thrombocythemia: mechanism of actin, efficacy, toxicity, current indications.", "journal": "Seminars in thrombosis and hemostasis", "date": "1997", "authors": "Tefferi A, Silverstein MN, Petitt RM, Mesa RA, Solberg LA Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "9263355", "url": "https://glygen.org/publication/PubMed/9263355" } ] }, { "title": "Direct stimulation of Bruton's tyrosine kinase by G(q)-protein alpha-subunit.", "journal": "Nature", "date": "1997", "authors": "Bence K, Ma W, Kozasa T, Huang XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "9305846", "url": "https://glygen.org/publication/PubMed/9305846" } ] }, { "title": "Crystal structure of the catalytic domains of adenylyl cyclase in a complex with Gsalpha.GTPgammaS.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Tesmer JJ, Sunahara RK, Gilman AG, Sprang SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "9417641", "url": "https://glygen.org/publication/PubMed/9417641" } ] }, { "title": "Nocistatin, a peptide that blocks nociceptin action in pain transmission.", "journal": "Nature", "date": "1998", "authors": "Okuda-Ashitaka E, Minami T, Tachibana S, Yoshihara Y, Nishiuchi Y, Kimura T, Ito S", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9521323", "url": "https://glygen.org/publication/PubMed/9521323" } ] }, { "title": "DNA methylation contributes to expression of the human neurotensin/neuromedin N gene.", "journal": "The American journal of physiology", "date": "1998", "authors": "Dong Z, Wang X, Zhao Q, Townsend CM Jr, Evers BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9530155", "url": "https://glygen.org/publication/PubMed/9530155" } ] }, { "title": "Association of XK and Kell blood group proteins.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Russo D, Redman C, Lee S", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9593744", "url": "https://glygen.org/publication/PubMed/9593744" } ] }, { "title": "A prolactin-releasing peptide in the brain.", "journal": "Nature", "date": "1998", "authors": "Hinuma S, Habata Y, Fujii R, Kawamata Y, Hosoya M, Fukusumi S, Kitada C, Masuo Y, Asano T, Matsumoto H, Sekiguchi M, Kurokawa T, Nishimura O, Onda H, Fujino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9607765", "url": "https://glygen.org/publication/PubMed/9607765" } ] }, { "title": "Stimulation of type 1 and type 8 Ca2+/calmodulin-sensitive adenylyl cyclases by the Gs-coupled 5-hydroxytryptamine subtype 5-HT7A receptor.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Baker LP, Nielsen MD, Impey S, Metcalf MA, Poser SW, Chan G, Obrietan K, Hamblin MW, Storm DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "9651336", "url": "https://glygen.org/publication/PubMed/9651336" } ] }, { "title": "Molecular characterization, pharmacological properties and chromosomal localization of the human GALR2 galanin receptor.", "journal": "Brain research. Molecular brain research", "date": "1998", "authors": "Fathi Z, Battaglino PM, Iben LG, Li H, Baker E, Zhang D, McGovern R, Mahle CD, Sutherland GR, Iismaa TP, Dickinson KE, Zimanyi IA", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9685625", "url": "https://glygen.org/publication/PubMed/9685625" } ] }, { "title": "Cloned human and rat galanin GALR3 receptors. Pharmacology and activation of G-protein inwardly rectifying K+ channels.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Smith KE, Walker MW, Artymyshyn R, Bard J, Borowsky B, Tamm JA, Yao WJ, Vaysse PJ, Branchek TA, Gerald C, Jones KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9722565", "url": "https://glygen.org/publication/PubMed/9722565" } ] }, { "title": "Identification of the binding site for Gqalpha on its effector Bruton's tyrosine kinase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Ma YC, Huang XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "9770463", "url": "https://glygen.org/publication/PubMed/9770463" } ] }, { "title": "Isolation and characterization of a novel endogenous peptide ligand for the human APJ receptor.", "journal": "Biochemical and biophysical research communications", "date": "1998", "authors": "Tatemoto K, Hosoya M, Habata Y, Fujii R, Kakegawa T, Zou MX, Kawamata Y, Fukusumi S, Hinuma S, Kitada C, Kurokawa T, Onda H, Fujino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9792798", "url": "https://glygen.org/publication/PubMed/9792798" } ] }, { "title": "Molecular characterization and expression of cloned human galanin receptors GALR2 and GALR3.", "journal": "Journal of neurochemistry", "date": "1998", "authors": "Kolakowski LF Jr, O'Neill GP, Howard AD, Broussard SR, Sullivan KA, Feighner SD, Sawzdargo M, Nguyen T, Kargman S, Shiao LL, Hreniuk DL, Tan CP, Evans J, Abramovitz M, Chateauneuf A, Coulombe N, Ng G, Johnson MP, Tharian A, Khoshbouei H, George SR, Smith RG, O'Dowd BF", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9832121", "url": "https://glygen.org/publication/PubMed/9832121" } ] }, { "title": "Neurotensin is an antagonist of the human neurotensin NT2 receptor expressed in Chinese hamster ovary cells.", "journal": "European journal of pharmacology", "date": "1998", "authors": "Vita N, Oury-Donat F, Chalon P, Guillemot M, Kaghad M, Bachy A, Thurneyssen O, Garcia S, Poinot-Chazel C, Casellas P, Keane P, Le Fur G, Maffrand JP, Soubrie P, Caput D, Ferrara P", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9851594", "url": "https://glygen.org/publication/PubMed/9851594" } ] } ], "pathway": [ { "id": "hsa:594857", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:594857", "resource": "KEGG Pathway" }, { "id": "R-HSA-375276", "name": "Peptide ligand-binding receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276", "resource": "Reactome", "description": "Peptide ligand-binding receptors" }, { "id": "R-HSA-416476", "name": "G alpha (q) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476", "resource": "Reactome", "description": "G alpha (q) signalling events" }, { "id": "R-HSA-418555", "name": "G alpha (s) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555", "resource": "Reactome", "description": "G alpha (s) signalling events" } ], "orthologs": [ { "uniprot_canonical_ac": "P0C0P7-1", "protein_name": "Neuropeptide S", "gene_name": "Nps", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MIGSLKLNLILALSLSVVHVIWSYPVLSSKVPGKPDYFLILLSTCPARLEGSDGLAFLKPILEKTSMKRSFRNGVGSGVKKTSFRRAKQ", "length": 89 }, "evidence": [ { "id": "45935111", "url": "http://www.informatics.jax.org/homology/45935111", "database": "MGI" }, { "id": "P0C0P6", "url": "https://omabrowser.org/oma/group/P0C0P6/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P0C0P8-1", "protein_name": "Neuropeptide S", "gene_name": "Nps", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MIGSLKLSFVLALSLSVMHVLWCYPVLSSKVPGKPDYFLILLSSCPARLEGSDRLAFLKPILEKTSMKRSFRNGVGSGAKKTSFRRAKQ", "length": 89 }, "evidence": [ { "id": "45935111", "url": "http://www.informatics.jax.org/homology/45935111", "database": "MGI" }, { "id": "P0C0P6", "url": "https://omabrowser.org/oma/group/P0C0P6/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P0C0P6", "url": "https://www.uniprot.org/uniprot/P0C0P6" } ], "pmid": "" }, { "name": "synapse", "id": "GO:0045202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045202", "evidence": [ { "database": "UniProtKB", "id": "P0C0P6", "url": "https://www.uniprot.org/uniprot/P0C0P6" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "neuropeptide signaling pathway", "id": "GO:0007218", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007218", "evidence": [ { "database": "UniProtKB", "id": "P0C0P6", "url": "https://www.uniprot.org/uniprot/P0C0P6" } ], "pmid": "" }, { "name": "visual learning", "id": "GO:0008542", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008542", "evidence": [ { "database": "UniProtKB", "id": "P0C0P6", "url": "https://www.uniprot.org/uniprot/P0C0P6" } ], "pmid": "" }, { "name": "positive regulation of synaptic transmission, GABAergic", "id": "GO:0032230", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032230", "evidence": [ { "database": "UniProtKB", "id": "P0C0P6", "url": "https://www.uniprot.org/uniprot/P0C0P6" } ], "pmid": "" }, { "name": "synaptic transmission, glutamatergic", "id": "GO:0035249", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035249", "evidence": [ { "database": "UniProtKB", "id": "P0C0P6", "url": "https://www.uniprot.org/uniprot/P0C0P6" } ], "pmid": "" }, { "name": "positive regulation of synaptic transmission, glutamatergic", "id": "GO:0051968", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051968", "evidence": [ { "database": "UniProtKB", "id": "P0C0P6", "url": "https://www.uniprot.org/uniprot/P0C0P6" } ], "pmid": "" }, { "name": "positive regulation of action potential", "id": "GO:0045760", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045760", "evidence": [ { "database": "UniProtKB", "id": "P0C0P6", "url": "https://www.uniprot.org/uniprot/P0C0P6" } ], "pmid": "" }, { "name": "positive regulation of circadian sleep/wake cycle, wakefulness", "id": "GO:0010841", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010841", "evidence": [ { "database": "UniProtKB", "id": "P0C0P6", "url": "https://www.uniprot.org/uniprot/P0C0P6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 171 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }