{ "uniprot_canonical_ac": "P09919-1", "uniprot_ac": "P09919", "uniprot_id": "CSF3_HUMAN", "mass": { "chemical_mass": 22293.0, "monoisotopic_mass": 22293.0 }, "refseq": { "ac": "NP_000750", "name": "granulocyte colony-stimulating factor isoform a precursor", "summary": "This gene encodes a member of the IL-6 superfamily of cytokines. The encoded cytokine controls the production, differentiation, and function of granulocytes. Granulocytes are a type of white blood cell that are part of the innate immune response. A modified form of this protein is commonly administered to manage chemotherapy-induced neutropenia. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2020].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000750" }, "gene_names": [ { "name": "CSF3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P09919", "id": "P09919" }, { "name": "C17orf33; CSF3OS; GCSF", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000750", "id": "NP_000750" }, { "name": "C17orf33", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P09919", "id": "P09919" }, { "name": "CSF3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000750", "id": "NP_000750" }, { "name": "GCSF", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P09919", "id": "P09919" }, { "name": "hCG_30013", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P09919", "id": "P09919" } ], "protein_names": [ { "name": "Granulocyte colony-stimulating factor", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P09919" }, { "name": "G-CSF", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P09919" }, { "name": "Pluripoietin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P09919" }, { "name": "granulocyte colony-stimulating factor isoform a precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000750", "id": "NP_000750" }, { "name": "pluripoietin; filgrastim; lenograstim; granulocyte-colony stimulating factor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000750", "id": "NP_000750" } ], "function": [ { "annotation": "Elevated G-CSF, IL8, and HGF in patients with definite Meniere's disease may indicate the role of NET formation in triggering autoimmunity and autoinflammation. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000750", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000750" }, { "database": "PubMed", "id": "36175465", "url": "https://glygen.org/publication/PubMed/36175465" } ] }, { "annotation": "G-CSF reshapes the cytosolic PCNA scaffold and modulates glycolysis in neutrophils.", "evidence": [ { "database": "RefSeq", "id": "NP_000750", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000750" }, { "database": "PubMed", "id": "37824822", "url": "https://glygen.org/publication/PubMed/37824822" } ] }, { "annotation": "Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes.", "evidence": [ { "database": "UniProtKB", "id": "J3KTH8", "url": "https://www.uniprot.org/uniprot/J3KTH8#function" }, { "database": "UniProtKB", "id": "ARBA00024794", "url": "https://www.uniprot.org/uniprot/ARBA00024794#function" }, { "database": "UniProtKB", "id": "J3QRX2", "url": "https://www.uniprot.org/uniprot/J3QRX2#function" }, { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919#function" }, { "database": "UniProtKB", "id": "Q8N4W3", "url": "https://www.uniprot.org/uniprot/Q8N4W3#function" } ] }, { "annotation": "P140Cap inhibits beta-Catenin in the breast cancer stem cell compartment instructing a protective anti-tumor immune response. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000750", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000750" }, { "database": "PubMed", "id": "37169737", "url": "https://glygen.org/publication/PubMed/37169737" } ] }, { "annotation": "Serum cytokines MCP-1 and GCS-F as potential biomarkers in pediatric inflammatory bowel disease. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000750", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000750" }, { "database": "PubMed", "id": "37922289", "url": "https://glygen.org/publication/PubMed/37922289" } ] }, { "annotation": "This gene encodes a member of the IL-6 superfamily of cytokines. The encoded cytokine controls the production, differentiation, and function of granulocytes. Granulocytes are a type of white blood cell that are part of the innate immune response. A modified form of this protein is commonly administered to manage chemotherapy-induced neutropenia. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2020].", "evidence": [ { "database": "RefSeq", "id": "NP_000750", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000750" } ] }, { "annotation": "Tumor-derived GCSF Alters Tumor and Systemic Immune System Cell Subset Composition and Signaling. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000750", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000750" }, { "database": "PubMed", "id": "36911097", "url": "https://glygen.org/publication/PubMed/36911097" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "67.14", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000108342", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108342" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "65.17", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000108342", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108342" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "61.15", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000108342", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108342" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "86.5", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000108342", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108342" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "52.43", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000108342", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108342" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "53.75", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000108342", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108342" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "77.95", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000108342", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108342" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "53.53", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000108342", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108342" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "63.23", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000108342", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108342" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "95.14", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000108342", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108342" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "47.53", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000108342", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108342" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "58.42", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000108342", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108342" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "60.5", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000108342", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108342" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P09919", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09919" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P09919", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09919" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P09919", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09919" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P09919", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09919" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P09919", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09919" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P09919", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09919" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P09919", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09919" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P09919", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09919" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P09919", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09919" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P09919", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09919" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P09919", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09919" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P09919", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09919" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "common_name": "Human" } ], "gene": [ { "name": "CSF3", "url": "https://www.uniprot.org/uniprot/P09919", "locus": { "chromosome": "17", "start_pos": 40017813, "end_pos": 40015361, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000108342", "url": "https://www.ensembl.org/id/ENSG00000108342" } ] } } ], "crossref": [ { "id": "ENSG00000108342", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108342", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "CSF3", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CSF3", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "1440", "url": "https://www.ncbi.nlm.nih.gov/gene/1440", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "2438", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=2438", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P09919", "url": "https://www.ebi.ac.uk/intact/interactors/id:P09919*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR009079", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009079", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR030473", "url": "https://www.ebi.ac.uk/interpro/entry/IPR030473", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR030474", "url": "https://www.ebi.ac.uk/interpro/entry/IPR030474", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040117", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040117", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:1440", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1440", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "138970", "url": "http://www.omim.org/entry/138970", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P09919", "url": "https://www.nextprot.org/entry/NX_P09919", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "APLEQCH", "url": "https://omabrowser.org/oma/group/APLEQCH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4636828at2759", "url": "http://www.orthodb.org/?query=4636828at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10511", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10511", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10511:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10511:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1CD9", "url": "https://www.rcsb.org/structure/1CD9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1GNC", "url": "https://www.rcsb.org/structure/1GNC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1PGR", "url": "https://www.rcsb.org/structure/1PGR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1RHG", "url": "https://www.rcsb.org/structure/1RHG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2D9Q", "url": "https://www.rcsb.org/structure/2D9Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5GW9", "url": "https://www.rcsb.org/structure/5GW9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5ZO6", "url": "https://www.rcsb.org/structure/5ZO6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF16647", "url": "http://pfam.xfam.org/family/PF16647", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P09919", "url": "https://pharos.nih.gov/targets/P09919", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P09919", "url": "http://purl.obolibrary.org/obo/PR_P09919", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9705462", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705462", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000750", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000750", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "J3KTH8", "url": "https://www.uniprot.org/uniprot/J3KTH8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3KTH8-1", "url": "https://www.uniprot.org/uniprot/J3KTH8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3QRD4", "url": "https://www.uniprot.org/uniprot/J3QRD4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3QRD4-1", "url": "https://www.uniprot.org/uniprot/J3QRD4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3QRX2", "url": "https://www.uniprot.org/uniprot/J3QRX2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3QRX2-1", "url": "https://www.uniprot.org/uniprot/J3QRX2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P09919-1", "url": "https://www.uniprot.org/uniprot/P09919-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P09919-2", "url": "https://www.uniprot.org/uniprot/P09919-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P09919-3", "url": "https://www.uniprot.org/uniprot/P09919-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8N4W3", "url": "https://www.uniprot.org/uniprot/Q8N4W3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8N4W3-1", "url": "https://www.uniprot.org/uniprot/Q8N4W3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP", "length": 207, "header": "sp|P09919-1|CSF3_HUMAN Isoform 1 of Granulocyte colony-stimulating factor OS=Homo sapiens OX=9606 GN=CSF3 PE=1 SV=1 CANONICAL=P09919-1" }, "isoforms": [ { "isoform_ac": "J3KTH8-1", "url": "", "sequence": { "sequence": "MSPEPALSPALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP", "length": 164, "header": "tr|J3KTH8-1|CSF3_HUMAN Computationally mapped isoform of Granulocyte colony-stimulating factor OS=Homo sapiens OX=9606 GN=CSF3 PE=1 SV=1 CANONICAL=P09919-1" }, "locus": { "chromosome": "17", "start_pos": 40016956, "end_pos": 40015663, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000577675.1", "url": "https://www.ensembl.org/id/ENST00000577675.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000462991.1", "url": "https://www.ensembl.org/id/ENSP00000462991.1" } ] } }, { "isoform_ac": "J3QRD4-1", "url": "", "sequence": { "sequence": "MAGPATQSPMKLMVCHLQAVPPRGAGAARTLSGHPLGSPEQLPQPGPAAGRLLEPTP", "length": 57, "header": "tr|J3QRD4-1|J3QRD4_HUMAN Computationally mapped isoform of Colony stimulating factor 3 OS=Homo sapiens OX=9606 GN=CSF3 PE=4 SV=1 CANONICAL=P09919-1" }, "locus": { "chromosome": "17", "start_pos": 40016507, "end_pos": 40015475, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000579852.1", "url": "https://www.ensembl.org/id/ENST00000579852.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000464157.1", "url": "https://www.ensembl.org/id/ENSP00000464157.1" } ] } }, { "isoform_ac": "J3QRX2-1", "url": "", "sequence": { "sequence": "MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFL", "length": 155, "header": "tr|J3QRX2-1|CSF3_HUMAN Computationally mapped isoform of Granulocyte colony-stimulating factor OS=Homo sapiens OX=9606 GN=CSF3 PE=1 SV=1 CANONICAL=P09919-1" }, "locus": { "chromosome": "17", "start_pos": 40016917, "end_pos": 40015475, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000583218.5", "url": "https://www.ensembl.org/id/ENST00000583218.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000464421.1", "url": "https://www.ensembl.org/id/ENSP00000464421.1" } ] } }, { "isoform_ac": "P09919-1", "url": "", "sequence": { "sequence": "MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP", "length": 207, "header": "sp|P09919-1|CSF3_HUMAN Isoform 1 of Granulocyte colony-stimulating factor OS=Homo sapiens OX=9606 GN=CSF3 PE=1 SV=1 CANONICAL=P09919-1" }, "locus": { "chromosome": "17", "start_pos": 40016956, "end_pos": 40015475, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000225474.6", "url": "https://www.ensembl.org/id/ENST00000225474.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000225474.2", "url": "https://www.ensembl.org/id/ENSP00000225474.2" } ] } }, { "isoform_ac": "P09919-2", "url": "", "sequence": { "sequence": "MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP", "length": 204, "header": "sp|P09919-2|CSF3_HUMAN Isoform 2 of Granulocyte colony-stimulating factor OS=Homo sapiens OX=9606 GN=CSF3 PE=1 SV=1 CANONICAL=P09919-1" }, "locus": { "chromosome": "17", "start_pos": 40016956, "end_pos": 40015475, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000394149.8", "url": "https://www.ensembl.org/id/ENST00000394149.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000377705.4", "url": "https://www.ensembl.org/id/ENSP00000377705.4" } ] } }, { "isoform_ac": "P09919-3", "url": "", "sequence": { "sequence": "MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSEAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP", "length": 171, "header": "sp|P09919-3|CSF3_HUMAN Isoform 3 of Granulocyte colony-stimulating factor OS=Homo sapiens OX=9606 GN=CSF3 PE=1 SV=1 CANONICAL=P09919-1" }, "locus": { "chromosome": "17", "start_pos": 40016956, "end_pos": 40015475, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000394148.7", "url": "https://www.ensembl.org/id/ENST00000394148.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000377704.3", "url": "https://www.ensembl.org/id/ENSP00000377704.3" } ] } }, { "isoform_ac": "Q8N4W3-1", "url": "", "sequence": { "sequence": "MSPEPALSPALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP", "length": 200, "header": "tr|Q8N4W3-1|CSF3_HUMAN Computationally mapped isoform of Granulocyte colony-stimulating factor OS=Homo sapiens OX=9606 GN=CSF3 PE=1 SV=1 CANONICAL=P09919-1" }, "locus": { "chromosome": "17", "start_pos": 40016956, "end_pos": 40015663, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000331769.6", "url": "https://www.ensembl.org/id/ENST00000331769.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000327766.2", "url": "https://www.ensembl.org/id/ENSP00000327766.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "predicted", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 166, "start_aa": "Thr", "end_pos": 166, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr166", "evidence": [ { "id": "P09919", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09919#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Modulation of formyl peptide receptor expression by IL-10 in human monocytes and neutrophils.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Thivierge M, Parent JL, Stankova J, Rola-Pleszczynski M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "10092818", "url": "https://glygen.org/publication/PubMed/10092818" } ] }, { "title": "Processing, secretion, and anti-HIV-1 activity of IL-16 with or without a signal peptide in CD4+ T cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Zhou P, Devadas K, Tewari D, Jegorow A, Notkins AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "10395686", "url": "https://glygen.org/publication/PubMed/10395686" } ] }, { "title": "Regulation of macrophage chemokine expression by lipopolysaccharide in vitro and in vivo.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Kopydlowski KM, Salkowski CA, Cody MJ, van Rooijen N, Major J, Hamilton TA, Vogel SN", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "10415057", "url": "https://glygen.org/publication/PubMed/10415057" } ] }, { "title": "The interleukin-10 signal transduction pathway and regulation of gene expression in mononuclear phagocytes.", "journal": "Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research", "date": "1999", "authors": "Donnelly RP, Dickensheets H, Finbloom DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "10433356", "url": "https://glygen.org/publication/PubMed/10433356" } ] }, { "title": "Identification of a CD4 domain required for interleukin-16 binding and lymphocyte activation.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Liu Y, Cruikshank WW, O'Loughlin T, O'Reilly P, Center DM, Kornfeld H", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "10438516", "url": "https://glygen.org/publication/PubMed/10438516" } ] }, { "title": "Atomic structure of the GCSF-receptor complex showing a new cytokine-receptor recognition scheme.", "journal": "Nature", "date": "1999", "authors": "Aritomi M, Kunishima N, Okamoto T, Kuroki R, Ota Y, Morikawa K", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" }, { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "10537111", "url": "https://glygen.org/publication/PubMed/10537111" } ] }, { "title": "Association of src-kinase Lyn and non-src-kinase Syk with the granulocyte colony-stimulating factor receptor (G-CSFR) is not abrogated in neutrophils from severe congenital neutropenia patients with point mutations in the G-CSFR mRNA.", "journal": "International journal of hematology", "date": "1999", "authors": "Kasper B, Tidow N, Welte K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "10643150", "url": "https://glygen.org/publication/PubMed/10643150" } ] }, { "title": "Suppressor of cytokine signaling-3 is recruited to the activated granulocyte-colony stimulating factor receptor and modulates its signal transduction.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2002", "authors": "Hortner M, Nielsch U, Mayr LM, Johnston JA, Heinrich PC, Haan S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705462", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705462" } ], "reference": [ { "type": "PubMed", "id": "12133942", "url": "https://glygen.org/publication/PubMed/12133942" } ] }, { "title": "IL-28, IL-29 and their class II cytokine receptor IL-28R.", "journal": "Nature immunology", "date": "2003", "authors": "Sheppard P, Kindsvogel W, Xu W, Henderson K, Schlutsmeyer S, Whitmore TE, Kuestner R, Garrigues U, Birks C, Roraback J, Ostrander C, Dong D, Shin J, Presnell S, Fox B, Haldeman B, Cooper E, Taft D, Gilbert T, Grant FJ, Tackett M, Krivan W, McKnight G, Clegg C, Foster D, Klucher KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "12469119", "url": "https://glygen.org/publication/PubMed/12469119" } ] }, { "title": "New microRNAs from mouse and human.", "journal": "RNA (New York, N.Y.)", "date": "2003", "authors": "Lagos-Quintana M, Rauhut R, Meyer J, Borkhardt A, Tuschl T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "12554859", "url": "https://glygen.org/publication/PubMed/12554859" } ] }, { "title": "Taxilin; a novel syntaxin-binding protein that is involved in Ca2+-dependent exocytosis in neuroendocrine cells.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2003", "authors": "Nogami S, Satoh S, Nakano M, Shimizu H, Fukushima H, Maruyama A, Terano A, Shirataki H", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "12558796", "url": "https://glygen.org/publication/PubMed/12558796" } ] }, { "title": "Activation of STAT3 by IL-6 and IL-10 in primary human macrophages is differentially modulated by suppressor of cytokine signaling 3.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2003", "authors": "Niemand C, Nimmesgern A, Haan S, Fischer P, Schaper F, Rossaint R, Heinrich PC, Muller-Newen G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "12626585", "url": "https://glygen.org/publication/PubMed/12626585" } ] }, { "title": "Secondary structure of human granulocyte colony-stimulating factor derived from NMR spectroscopy.", "journal": "FEBS Lett.", "date": "1992", "authors": "Zink T, Ross A, Ambrosius D, Rudolph R, Holak TA", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "reference": [ { "type": "PubMed", "id": "1281794", "url": "https://glygen.org/publication/PubMed/1281794" } ] }, { "title": "STATs dimerize in the absence of phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Braunstein J, Brutsaert S, Olson R, Schindler C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "12832402", "url": "https://glygen.org/publication/PubMed/12832402" } ] }, { "title": "Receptor activation and 2 distinct COOH-terminal motifs control G-CSF receptor distribution and internalization kinetics.", "journal": "Blood", "date": "2004", "authors": "Aarts LH, Roovers O, Ward AC, Touw IP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705462", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705462" } ], "reference": [ { "type": "PubMed", "id": "14512302", "url": "https://glygen.org/publication/PubMed/14512302" } ] }, { "title": "IL-10 stimulates monocyte Fc gamma R surface expression and cytotoxic activity. Distinct regulation of antibody-dependent cellular cytotoxicity by IFN-gamma, IL-4, and IL-10.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1992", "authors": "te Velde AA, de Waal Malefijt R, Huijbens RJ, de Vries JE, Figdor CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "1460289", "url": "https://glygen.org/publication/PubMed/1460289" } ] }, { "title": "PCR isolation and cloning of novel splice variant mRNAs from known drug target genes.", "journal": "Genomics", "date": "2004", "authors": "Jin Pei, Fu Glenn K, Wilson Amy D, Yang Junming, Chien David, Hawkins Phillip R, Au-Young Janice, Stuve Laura L", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "reference": [ { "type": "PubMed", "id": "15028279", "url": "https://glygen.org/publication/PubMed/15028279" } ] }, { "title": "Distinct activities of suppressor of cytokine signaling (SOCS) proteins and involvement of the SOCS box in controlling G-CSF signaling.", "journal": "Journal of leukocyte biology", "date": "2004", "authors": "van de Geijn GJ, Gits J, Touw IP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705462", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705462" } ], "reference": [ { "type": "PubMed", "id": "15107455", "url": "https://glygen.org/publication/PubMed/15107455" } ] }, { "title": "VHL-box and SOCS-box domains determine binding specificity for Cul2-Rbx1 and Cul5-Rbx2 modules of ubiquitin ligases.", "journal": "Genes & development", "date": "2004", "authors": "Kamura T, Maenaka K, Kotoshiba S, Matsumoto M, Kohda D, Conaway RC, Conaway JW, Nakayama KI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705462", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705462" } ], "reference": [ { "type": "PubMed", "id": "15601820", "url": "https://glygen.org/publication/PubMed/15601820" } ] }, { "title": "STAT3 nuclear import is independent of tyrosine phosphorylation and mediated by importin-alpha3.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Liu L, McBride KM, Reich NC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "15919823", "url": "https://glygen.org/publication/PubMed/15919823" } ] }, { "title": "Proteinase 3 is an IL-32 binding protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Novick D, Rubinstein M, Azam T, Rabinkov A, Dinarello CA, Kim SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "16488976", "url": "https://glygen.org/publication/PubMed/16488976" } ] }, { "title": "Homodimeric cross-over structure of the human granulocyte colony-stimulating factor (GCSF) receptor signaling complex.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2006", "authors": "Tamada T, Honjo E, Maeda Y, Okamoto T, Ishibashi M, Tokunaga M, Kuroki R", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" }, { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "16492764", "url": "https://glygen.org/publication/PubMed/16492764" } ] }, { "title": "The interaction of G-CSF with its receptor.", "journal": "Frontiers in bioscience : a journal and virtual library", "date": "2006", "authors": "Layton JE, Hall NE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "16720384", "url": "https://glygen.org/publication/PubMed/16720384" } ] }, { "title": "Conformational changes mediate interleukin-10 receptor 2 (IL-10R2) binding to IL-10 and assembly of the signaling complex.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Yoon SI, Logsdon NJ, Sheikh F, Donnelly RP, Walter MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "16982608", "url": "https://glygen.org/publication/PubMed/16982608" } ] }, { "title": "Three different mRNAs encoding human granulocyte colony-stimulating factor receptor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Fukunaga R, Seto Y, Mizushima S, Nagata S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "1701053", "url": "https://glygen.org/publication/PubMed/1701053" } ] }, { "title": "Suppressor of cytokine signaling 3 controls lysosomal routing of G-CSF receptor.", "journal": "The EMBO journal", "date": "2007", "authors": "Irandoust MI, Aarts LH, Roovers O, Gits J, Erkeland SJ, Touw IP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705462", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705462" } ], "reference": [ { "type": "PubMed", "id": "17363902", "url": "https://glygen.org/publication/PubMed/17363902" } ] }, { "title": "The granulocyte colony stimulating factor (G-CSF) activates Jak/STAT and MAPK pathways in a trophoblastic cell line.", "journal": "Journal of cellular biochemistry", "date": "2008", "authors": "Marino VJ, Roguin LP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "17879956", "url": "https://glygen.org/publication/PubMed/17879956" } ] }, { "title": "Discovery of a cytokine and its receptor by functional screening of the extracellular proteome.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "Lin H, Lee E, Hestir K, Leo C, Huang M, Bosch E, Halenbeck R, Wu G, Zhou A, Behrens D, Hollenbaugh D, Linnemann T, Qin M, Wong J, Chu K, Doberstein SK, Williams LT", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "18467591", "url": "https://glygen.org/publication/PubMed/18467591" } ] }, { "title": "G-CSF stimulates Jak2-dependent Gab2 phosphorylation leading to Erk1/2 activation and cell proliferation.", "journal": "Cellular signalling", "date": "2008", "authors": "Wang L, Xue J, Zadorozny EV, Robinson LJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "18644434", "url": "https://glygen.org/publication/PubMed/18644434" } ] }, { "title": "IL-10 inhibits cytokine production by activated macrophages.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1991", "authors": "Fiorentino DF, Zlotnik A, Mosmann TR, Howard M, O'Garra A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "1940369", "url": "https://glygen.org/publication/PubMed/1940369" } ] }, { "title": "Interleukin 10(IL-10) inhibits cytokine synthesis by human monocytes: an autoregulatory role of IL-10 produced by monocytes.", "journal": "The Journal of experimental medicine", "date": "1991", "authors": "de Waal Malefyt R, Abrams J, Bennett B, Figdor CG, de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "1940799", "url": "https://glygen.org/publication/PubMed/1940799" } ] }, { "title": "Site-specific ubiquitination determines lysosomal sorting and signal attenuation of the granulocyte colony-stimulating factor receptor.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2009", "authors": "Wolfler A, Irandoust M, Meenhuis A, Gits J, Roovers O, Touw IP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705462", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705462" } ], "reference": [ { "type": "PubMed", "id": "19453968", "url": "https://glygen.org/publication/PubMed/19453968" } ] }, { "title": "Cyclooxygenase-2 is a novel transcriptional target of the nuclear EGFR-STAT3 and EGFRvIII-STAT3 signaling axes.", "journal": "Molecular cancer research : MCR", "date": "2010", "authors": "Lo HW, Cao X, Zhu H, Ali-Osman F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "20145033", "url": "https://glygen.org/publication/PubMed/20145033" } ] }, { "title": "Granulocyte colony-stimulating factor expression as a prognostic biomarker in non-small cell lung cancer.", "journal": "Oncology reports", "date": "2011", "authors": "Stathopoulos GP, Armakolas A, Tranga T, Marinou H, Stathopoulos J, Chandrinou H", "evidence": [ { "database": "GlyGen", "id": "A0043", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "21431281", "url": "https://glygen.org/publication/PubMed/21431281" } ] }, { "title": "Expression cloning of a human granulocyte colony-stimulating factor receptor: a structural mosaic of hematopoietin receptor, immunoglobulin, and fibronectin domains.", "journal": "The Journal of experimental medicine", "date": "1990", "authors": "Larsen A, Davis T, Curtis BM, Gimpel S, Sims JE, Cosman D, Park L, Sorensen E, March CJ, Smith CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "2147944", "url": "https://glygen.org/publication/PubMed/2147944" } ] }, { "title": "A cytokine gene screen uncovers SOCS1 as genetic risk factor for multiple sclerosis.", "journal": "Genes and immunity", "date": "2012", "authors": "Vandenbroeck K, Alvarez J, Swaminathan B, Alloza I, Matesanz F, Urcelay E, Comabella M, Alcina A, Fedetz M, Ortiz MA, Izquierdo G, Fernandez O, Rodriguez-Ezpeleta N, Matute C, Caillier S, Arroyo R, Montalban X, Oksenberg JR, Antiguedad A, Aransay A", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "21716315", "url": "https://glygen.org/publication/PubMed/21716315" } ] }, { "title": "A variant upstream of IFNL3 (IL28B) creating a new interferon gene IFNL4 is associated with impaired clearance of hepatitis C virus.", "journal": "Nature genetics", "date": "2013", "authors": "Prokunina-Olsson L, Muchmore B, Tang W, Pfeiffer RM, Park H, Dickensheets H, Hergott D, Porter-Gill P, Mumy A, Kohaar I, Chen S, Brand N, Tarway M, Liu L, Sheikh F, Astemborski J, Bonkovsky HL, Edlin BR, Howell CD, Morgan TR, Thomas DL, Rehermann B, Donnelly RP, O'Brien TR", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "23291588", "url": "https://glygen.org/publication/PubMed/23291588" } ] }, { "title": "Receptor-type protein-tyrosine phosphatase zeta is a functional receptor for interleukin-34.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Nandi S, Cioce M, Yeung YG, Nieves E, Tesfa L, Lin H, Hsu AW, Halenbeck R, Cheng HY, Gokhan S, Mehler MF, Stanley ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "23744080", "url": "https://glygen.org/publication/PubMed/23744080" } ] }, { "title": "Recombinant human granulocyte colony-stimulating factor: effects on normal and leukemic myeloid cells.", "journal": "Science", "date": "1986", "authors": "Souza L M, Boone T C, Gabrilove J, Lai P H, Zsebo K M, Murdock D C, Chazin V R, Bruszewski J, Lu H, Chen K K, Barendt J, Platzer E, Moore M A S, Mertelsmann R, Welte K", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "reference": [ { "type": "PubMed", "id": "2420009", "url": "https://glygen.org/publication/PubMed/2420009" } ] }, { "title": "Granulocyte colony-stimulating factor receptor signalling via Janus kinase 2/signal transducer and activator of transcription 3 in ovarian cancer.", "journal": "British journal of cancer", "date": "2014", "authors": "Kumar J, Fraser FW, Riley C, Ahmed N, McCulloch DR, Ward AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "24220695", "url": "https://glygen.org/publication/PubMed/24220695" } ] }, { "title": "The chromosomal gene structure and two mRNAs for human granulocyte colony-stimulating factor.", "journal": "EMBO J.", "date": "1986", "authors": "Nagata S, Tsuchiya M, Asano S, Yamamoto O, Hirata Y, Kubota N, Oheda M, Nomura H, Yamazaki T", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "reference": [ { "type": "PubMed", "id": "2423327", "url": "https://glygen.org/publication/PubMed/2423327" } ] }, { "title": "STAT3 Target Genes Relevant to Human Cancers.", "journal": "Cancers", "date": "2014", "authors": "Carpenter RL, Lo HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "24743777", "url": "https://glygen.org/publication/PubMed/24743777" } ] }, { "title": "Syndecan-1 regulates the biological activities of interleukin-34.", "journal": "Biochimica et biophysica acta", "date": "2015", "authors": "Segaliny AI, Brion R, Mortier E, Maillasson M, Cherel M, Jacques Y, Le Goff B, Heymann D", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "25662098", "url": "https://glygen.org/publication/PubMed/25662098" } ] }, { "title": "IL-34 and M-CSF form a novel heteromeric cytokine and regulate the M-CSF receptor activation and localization.", "journal": "Cytokine", "date": "2015", "authors": "Segaliny AI, Brion R, Brulin B, Maillasson M, Charrier C, Teletchea S, Heymann D", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "26095744", "url": "https://glygen.org/publication/PubMed/26095744" } ] }, { "title": "Tyrosyl phosphorylation of KRAS stalls GTPase cycle via alteration of switch I and II conformation.", "journal": "Nature communications", "date": "2019", "authors": "Kano Y, Gebregiworgis T, Marshall CB, Radulovich N, Poon BPK, St-Germain J, Cook JD, Valencia-Sama I, Grant BMM, Herrera SG, Miao J, Raught B, Irwin MS, Lee JE, Yeh JJ, Zhang ZY, Tsao MS, Ikura M, Ohh M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "30644389", "url": "https://glygen.org/publication/PubMed/30644389" } ] }, { "title": "Clinical features of patients infected with 2019 novel coronavirus in Wuhan, China.", "journal": "Lancet (London, England)", "date": "2020", "authors": "Huang C, Wang Y, Li X, Ren L, Zhao J, Hu Y, Zhang L, Fan G, Xu J, Gu X, Cheng Z, Yu T, Xia J, Wei Y, Wu W, Xie X, Yin W, Li H, Liu M, Xiao Y, Gao H, Guo L, Xie J, Wang G, Jiang R, Gao Z, Jin Q, Wang J, Cao B", "evidence": [ { "database": "GlyGen", "id": "A0043", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "31986264", "url": "https://glygen.org/publication/PubMed/31986264" } ] }, { "title": "The use of anti-inflammatory drugs in the treatment of people with severe coronavirus disease 2019 (COVID-19): The Perspectives of clinical immunologists from China.", "journal": "Clinical immunology (Orlando, Fla.)", "date": "2020", "authors": "Zhang W, Zhao Y, Zhang F, Wang Q, Li T, Liu Z, Wang J, Qin Y, Zhang X, Yan X, Zeng X, Zhang S", "evidence": [ { "database": "GlyGen", "id": "A0043", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "32222466", "url": "https://glygen.org/publication/PubMed/32222466" } ] }, { "title": "Molecular cloning and expression of cDNA for human granulocyte colony-stimulating factor.", "journal": "Nature", "date": "1986", "authors": "Nagata S, Tsuchiya M, Asano S, Kaziro Y, Yamazaki T, Yamamoto O, Hirata Y, Kubota N, Oheda M, Nomura H", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "reference": [ { "type": "PubMed", "id": "3484805", "url": "https://glygen.org/publication/PubMed/3484805" } ] }, { "title": "Expression of granulocyte colony-stimulating factor by human cell lines.", "journal": "J. Leukoc. Biol.", "date": "1987", "authors": "Devlin J J, Devlin P E, Myambo K, Lilly M B, Rado T A, Warren M K", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "reference": [ { "type": "PubMed", "id": "3494801", "url": "https://glygen.org/publication/PubMed/3494801" } ] }, { "title": "Elevated G-CSF, IL8, and HGF in patients with definite Meniere's disease may indicate the role of NET formation in triggering autoimmunity and autoinflammation.", "journal": "Scientific reports", "date": "2022", "authors": "Zou J, Zhao Z, Song X, Zhang G, Li H, Zhang Q, Pyykko I", "evidence": [ { "database": "RefSeq", "id": "NP_000750", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000750" } ], "reference": [ { "type": "PubMed", "id": "36175465", "url": "https://glygen.org/publication/PubMed/36175465" } ] }, { "title": "Tumor-derived GCSF Alters Tumor and Systemic Immune System Cell Subset Composition and Signaling.", "journal": "Cancer research communications", "date": "2023-03", "authors": "Matos Israel, Barvalia Maunish, Chehal Manreet K, Robertson A Gordon, Kulic Iva, Silva Jessica A F D, Ranganathan Abhinandan, Short Amy, Huang Yu-Hsuan, Long Erin, Priatel John J, Dhanji Salim, Nelson Brad H, Krebs Danielle L, Harder Kenneth W", "evidence": [ { "database": "RefSeq", "id": "NP_000750", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000750" } ], "reference": [ { "type": "PubMed", "id": "36911097", "url": "https://glygen.org/publication/PubMed/36911097" } ] }, { "title": "p140Cap inhibits \u03b2-Catenin in the breast cancer stem cell compartment instructing a protective anti-tumor immune response.", "journal": "Nature communications", "date": "2023-05-11", "authors": "Salemme Vincenzo, Vedelago Mauro, Sarcinella Alessandro, Moietta Federico, Piccolantonio Alessio, Moiso Enrico, Centonze Giorgia, Manco Marta, Guala Andrea, Lamolinara Alessia, Angelini Costanza, Morellato Alessandro, Natalini Dora, Calogero Raffaele, Incarnato Danny, Oliviero Salvatore, Conti Laura, Iezzi Manuela, Tosoni Daniela, Bertalot Giovanni, Freddi Stefano, Tucci Francesco A, De Sanctis Francesco, Frusteri Cristina, Ugel Stefano, Bronte Vincenzo, Cavallo Federica, Provero Paolo, Gai Marta, Taverna Daniela, Turco Emilia, Pece Salvatore, Defilippi Paola", "evidence": [ { "database": "RefSeq", "id": "NP_000750", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000750" } ], "reference": [ { "type": "PubMed", "id": "37169737", "url": "https://glygen.org/publication/PubMed/37169737" } ] }, { "title": "G-CSF reshapes the cytosolic PCNA scaffold and modulates glycolysis in neutrophils.", "journal": "Journal of leukocyte biology", "date": "2024-01-19", "authors": "Aymonnier Karen, Bosetta Enzo, Leborgne Nathan G F, Ullmer Audrey, Le Gall Morgane, De Chiara Alessia, Salnot Virginie, Many Souganya, Scapini Patrizia, Wicks Ian, Chatfield Simon, Martin Katherine R, Witko-Sarsat V\u00e9ronique", "evidence": [ { "database": "RefSeq", "id": "NP_000750", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000750" } ], "reference": [ { "type": "PubMed", "id": "37824822", "url": "https://glygen.org/publication/PubMed/37824822" } ] }, { "title": "Serum cytokines MCP-1 and GCS-F as potential biomarkers in pediatric inflammatory bowel disease.", "journal": "PloS one", "date": "2023", "authors": "Ott Andrea, Tutdibi Erol, Goedicke-Fritz Sybelle, Sch\u00f6pe Jakob, Zemlin Michael, Nourkami-Tutdibi Nasenien", "evidence": [ { "database": "RefSeq", "id": "NP_000750", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000750" } ], "reference": [ { "type": "PubMed", "id": "37922289", "url": "https://glygen.org/publication/PubMed/37922289" } ] }, { "title": "Interferon activation of the transcription factor Stat91 involves dimerization through SH2-phosphotyrosyl peptide interactions.", "journal": "Cell", "date": "1994", "authors": "Shuai K, Horvath CM, Huang LH, Qureshi SA, Cowburn D, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7510216", "url": "https://glygen.org/publication/PubMed/7510216" } ] }, { "title": "Interleukin-10 inhibits B7 and intercellular adhesion molecule-1 expression on human monocytes.", "journal": "European journal of immunology", "date": "1994", "authors": "Willems F, Marchant A, Delville JP, Gerard C, Delvaux A, Velu T, de Boer M, Goldman M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7512027", "url": "https://glygen.org/publication/PubMed/7512027" } ] }, { "title": "Molecular cloning of APRF, a novel IFN-stimulated gene factor 3 p91-related transcription factor involved in the gp130-mediated signaling pathway.", "journal": "Cell", "date": "1994", "authors": "Akira S, Nishio Y, Inoue M, Wang XJ, Wei S, Matsusaka T, Yoshida K, Sudo T, Naruto M, Kishimoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7512451", "url": "https://glygen.org/publication/PubMed/7512451" } ] }, { "title": "Tyrosine kinase JAK1 is associated with the granulocyte-colony-stimulating factor receptor and both become tyrosine-phosphorylated after receptor activation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Nicholson SE, Oates AC, Harpur AG, Ziemiecki A, Wilks AF, Layton JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "7512720", "url": "https://glygen.org/publication/PubMed/7512720" } ] }, { "title": "Interleukin 12 synergizes with B7/CD28 interaction in inducing efficient proliferation and cytokine production of human T cells.", "journal": "The Journal of experimental medicine", "date": "1994", "authors": "Kubin M, Kamoun M, Trinchieri G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7516408", "url": "https://glygen.org/publication/PubMed/7516408" } ] }, { "title": "Structure and dynamics of the human granulocyte colony-stimulating factor determined by NMR spectroscopy. Loop mobility in a four-helix-bundle protein.", "journal": "Biochemistry", "date": "1994", "authors": "Zink T, Ross A, L\u00fcers K, Cieslar C, Rudolph R, Holak T A", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "reference": [ { "type": "PubMed", "id": "7518249", "url": "https://glygen.org/publication/PubMed/7518249" } ] }, { "title": "Rapid activation of the STAT3 transcription factor by granulocyte colony-stimulating factor.", "journal": "Blood", "date": "1994", "authors": "Tian SS, Lamb P, Seidel HM, Stein RB, Rosen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "7521688", "url": "https://glygen.org/publication/PubMed/7521688" } ] }, { "title": "IL-10 induces the tyrosine phosphorylation of tyk2 and Jak1 and the differential assembly of STAT1 alpha and STAT3 complexes in human T cells and monocytes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1995", "authors": "Finbloom DS, Winestock KD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7543512", "url": "https://glygen.org/publication/PubMed/7543512" } ] }, { "title": "IL-10 inhibits metalloproteinase and stimulates TIMP-1 production in human mononuclear phagocytes.", "journal": "The Journal of clinical investigation", "date": "1995", "authors": "Lacraz S, Nicod LP, Chicheportiche R, Welgus HG, Dayer JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7593617", "url": "https://glygen.org/publication/PubMed/7593617" } ] }, { "title": "Inhibition of macrophage inflammatory protein-1 alpha expression by IL-10. Differential sensitivities in human blood monocytes and alveolar macrophages.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1995", "authors": "Berkman N, John M, Roesems G, Jose PJ, Barnes PJ, Chung KF", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7594602", "url": "https://glygen.org/publication/PubMed/7594602" } ] }, { "title": "The CD4-associated tyrosine kinase p56lck is required for lymphocyte chemoattractant factor-induced T lymphocyte migration.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Ryan TC, Cruikshank WW, Kornfeld H, Collins TL, Center DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "7615501", "url": "https://glygen.org/publication/PubMed/7615501" } ] }, { "title": "Direct effects of IL-10 on subsets of human CD4+ T cell clones and resting T cells. Specific inhibition of IL-2 production and proliferation.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1993", "authors": "de Waal Malefyt R, Yssel H, de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7684412", "url": "https://glygen.org/publication/PubMed/7684412" } ] }, { "title": "The structure of granulocyte-colony-stimulating factor and its relationship to other growth factors.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1993", "authors": "Hill C P, Osslund T D, Eisenberg D", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "reference": [ { "type": "PubMed", "id": "7685117", "url": "https://glygen.org/publication/PubMed/7685117" } ] }, { "title": "Glycosidase digestion, electrophoresis and chromatographic analysis of recombinant human granulocyte colony-stimulating factor glycoforms produced in Chinese hamster ovary cells.", "journal": "J. Chromatogr. A", "date": "1993", "authors": "Clogston C L, Hu S, Boone T C, Lu H S", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "reference": [ { "type": "PubMed", "id": "7685769", "url": "https://glygen.org/publication/PubMed/7685769" } ] }, { "title": "IL-10 inhibits macrophage costimulatory activity by selectively inhibiting the up-regulation of B7 expression.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1993", "authors": "Ding L, Linsley PS, Huang LY, Germain RN, Shevach EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7687627", "url": "https://glygen.org/publication/PubMed/7687627" } ] }, { "title": "Evidence for the ligand-induced conversion from a dimer to a tetramer of the granulocyte colony-stimulating factor receptor.", "journal": "FEBS letters", "date": "1994", "authors": "Hiraoka O, Anaguchi H, Ota Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "7805849", "url": "https://glygen.org/publication/PubMed/7805849" } ] }, { "title": "Effects of IL-13 on phenotype, cytokine production, and cytotoxic function of human monocytes. Comparison with IL-4 and modulation by IFN-gamma or IL-10.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1993", "authors": "de Waal Malefyt R, Figdor CG, Huijbens R, Mohan-Peterson S, Bennett B, Culpepper J, Dang W, Zurawski G, de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7902377", "url": "https://glygen.org/publication/PubMed/7902377" } ] }, { "title": "Interleukin 10 suppression of monocyte prostaglandin H synthase-2. Mechanism of inhibition of prostaglandin-dependent matrix metalloproteinase production.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Mertz PM, DeWitt DL, Stetler-Stevenson WG, Wahl LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8063757", "url": "https://glygen.org/publication/PubMed/8063757" } ] }, { "title": "Interleukin 10 (IL-10) inhibits human lymphocyte interferon gamma-production by suppressing natural killer cell stimulatory factor/IL-12 synthesis in accessory cells.", "journal": "The Journal of experimental medicine", "date": "1993", "authors": "D'Andrea A, Aste-Amezaga M, Valiante NM, Ma X, Kubin M, Trinchieri G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8102388", "url": "https://glygen.org/publication/PubMed/8102388" } ] }, { "title": "Expression cloning and characterization of a human IL-10 receptor.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1994", "authors": "Liu Y, Wei SH, Ho AS, de Waal Malefyt R, Moore KW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8120391", "url": "https://glygen.org/publication/PubMed/8120391" } ] }, { "title": "Interleukin 10 (IL-10) upregulates IL-1 receptor antagonist production from lipopolysaccharide-stimulated human polymorphonuclear leukocytes by delaying mRNA degradation.", "journal": "The Journal of experimental medicine", "date": "1994", "authors": "Cassatella MA, Meda L, Gasperini S, Calzetti F, Bonora S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8163946", "url": "https://glygen.org/publication/PubMed/8163946" } ] }, { "title": "The effects of interleukin-10 on interleukin-1 receptor antagonist and interleukin-1 beta production in human monocytes and neutrophils.", "journal": "Lymphokine and cytokine research", "date": "1994", "authors": "Jenkins JK, Malyak M, Arend WP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8186324", "url": "https://glygen.org/publication/PubMed/8186324" } ] }, { "title": "Granulocyte colony-stimulating factor receptor signaling involves the formation of a three-component complex with Lyn and Syk protein-tyrosine kinases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Corey SJ, Burkhardt AL, Bolen JB, Geahlen RL, Tkatch LS, Tweardy DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "8197119", "url": "https://glygen.org/publication/PubMed/8197119" } ] }, { "title": "Macrophage-colony-stimulating factor expression by anti-CD45 stimulated human monocytes is transcriptionally up-regulated by IL-1 beta and inhibited by IL-4 and IL-10.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1994", "authors": "Gruber MF, Williams CC, Gerrard TL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8301137", "url": "https://glygen.org/publication/PubMed/8301137" } ] }, { "title": "Elevated plasma levels of tumor necrosis factor (TNF)-alpha, soluble TNF receptors, interleukin (IL)-6, and IL-10 in patients with hemorrhagic fever with renal syndrome.", "journal": "The Journal of infectious diseases", "date": "1996", "authors": "Linderholm M, Ahlm C, Settergren B, Waage A, Tarnvik A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8537680", "url": "https://glygen.org/publication/PubMed/8537680" } ] }, { "title": "Extracellular domain of granulocyte-colony stimulating factor receptor. Interaction with its ligand and identification of a domain in close proximity of ligand-binding region.", "journal": "Arch. Biochem. Biophys.", "date": "1995", "authors": "Haniu M, Horan T, Arakawa T, Le J, Katta V, Rohde M F", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "reference": [ { "type": "PubMed", "id": "8554326", "url": "https://glygen.org/publication/PubMed/8554326" } ] }, { "title": "Receptors for interleukin (IL)-10 and IL-6-type cytokines use similar signaling mechanisms for inducing transcription through IL-6 response elements.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Lai CF, Ripperger J, Morella KK, Jurlander J, Hawley TS, Carson WE, Kordula T, Caligiuri MA, Hawley RG, Fey GH, Baumann H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8662928", "url": "https://glygen.org/publication/PubMed/8662928" } ] }, { "title": "Interleukin-10 drives human monocytes to CD16 positive macrophages.", "journal": "Journal of inflammation", "date": "1996", "authors": "Calzada-Wack JC, Frankenberger M, Ziegler-Heitbrock HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8734788", "url": "https://glygen.org/publication/PubMed/8734788" } ] }, { "title": "IL-4, IL-10 and IFN-gamma have distinct, but interacting, effects on differentiation-induced changes in TNF-alpha and TNF receptor release by cultured human monocytes.", "journal": "Cytokine", "date": "1996", "authors": "Joyce DA, Steer JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8742066", "url": "https://glygen.org/publication/PubMed/8742066" } ] }, { "title": "Regulation of surface and soluble TNF receptor expression on human monocytes and synovial fluid macrophages by IL-4 and IL-10.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1996", "authors": "Hart PH, Hunt EK, Bonder CS, Watson CJ, Finlay-Jones JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8871669", "url": "https://glygen.org/publication/PubMed/8871669" } ] }, { "title": "Crystal structure of human interleukin-10 at 1.6 A resolution and a model of a complex with its soluble receptor.", "journal": "Protein science : a publication of the Protein Society", "date": "1996", "authors": "Zdanov A, Schalk-Hihi C, Wlodawer A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8897595", "url": "https://glygen.org/publication/PubMed/8897595" } ] }, { "title": "Stat3 recruitment by two distinct ligand-induced, tyrosine-phosphorylated docking sites in the interleukin-10 receptor intracellular domain.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Weber-Nordt RM, Riley JK, Greenlund AC, Moore KW, Darnell JE, Schreiber RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8910398", "url": "https://glygen.org/publication/PubMed/8910398" } ] }, { "title": "Contrasting effects of IL-4, IL-10 and corticosteroids on RANTES production by human monocytes.", "journal": "International immunology", "date": "1996", "authors": "Marfaing-Koka A, Maravic M, Humbert M, Galanaud P, Emilie D", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8921438", "url": "https://glygen.org/publication/PubMed/8921438" } ] }, { "title": "IL-10 suppresses cell surface CD23/Fc epsilon RII expression, not by enhancing soluble CD23 release, but by reducing CD23 mRNA expression in human monocytes.", "journal": "Journal of clinical immunology", "date": "1996", "authors": "Morinobu A, Kumagai S, Yanagida H, Ota H, Ishida H, Matsui M, Yodoi J, Nakao K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8946277", "url": "https://glygen.org/publication/PubMed/8946277" } ] }, { "title": "Multiple signaling pathways induced by granulocyte colony-stimulating factor involving activation of JAKs, STAT5, and/or STAT3 are required for regulation of three distinct classes of immediate early genes.", "journal": "Blood", "date": "1996", "authors": "Tian SS, Tapley P, Sincich C, Stein RB, Rosen J, Lamb P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "8977235", "url": "https://glygen.org/publication/PubMed/8977235" } ] }, { "title": "Identification through bioinformatics of two new macrophage proinflammatory human chemokines: MIP-3alpha and MIP-3beta.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1997", "authors": "Rossi DL, Vicari AP, Franz-Bacon K, McClanahan TK, Zlotnik A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9013939", "url": "https://glygen.org/publication/PubMed/9013939" } ] }, { "title": "Jak1 plays an essential role for receptor phosphorylation and Stat activation in response to granulocyte colony-stimulating factor.", "journal": "Blood", "date": "1997", "authors": "Shimoda K, Feng J, Murakami H, Nagata S, Watling D, Rogers NC, Stark GR, Kerr IM, Ihle JN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "9226159", "url": "https://glygen.org/publication/PubMed/9226159" } ] }, { "title": "Identification and functional characterization of a second chain of the interleukin-10 receptor complex.", "journal": "The EMBO journal", "date": "1997", "authors": "Kotenko SV, Krause CD, Izotova LS, Pollack BP, Wu W, Pestka S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9312047", "url": "https://glygen.org/publication/PubMed/9312047" } ] }, { "title": "Interleukin-10 upregulates tumor necrosis factor receptor type-II (p75) gene expression in endotoxin-stimulated human monocytes.", "journal": "Blood", "date": "1997", "authors": "Dickensheets HL, Freeman SL, Smith MF, Donnelly RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9354687", "url": "https://glygen.org/publication/PubMed/9354687" } ] }, { "title": "Processing and activation of pro-interleukin-16 by caspase-3.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Zhang Y, Center DM, Wu DM, Cruikshank WW, Yuan J, Andrews DW, Kornfeld H", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "9422780", "url": "https://glygen.org/publication/PubMed/9422780" } ] }, { "title": "Interleukin 10 increases CCR5 expression and HIV infection in human monocytes.", "journal": "The Journal of experimental medicine", "date": "1998", "authors": "Sozzani S, Ghezzi S, Iannolo G, Luini W, Borsatti A, Polentarutti N, Sica A, Locati M, Mackay C, Wells TN, Biswas P, Vicenzi E, Poli G, Mantovani A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9449724", "url": "https://glygen.org/publication/PubMed/9449724" } ] }, { "title": "IFN-gamma and IL-10 inhibit induction of IL-1 receptor type I and type II gene expression by IL-4 and IL-13 in human monocytes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1997", "authors": "Dickensheets HL, Donnelly RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9550426", "url": "https://glygen.org/publication/PubMed/9550426" } ] }, { "title": "STCP-1 (MDC) CC chemokine acts specifically on chronically activated Th2 lymphocytes and is produced by monocytes on stimulation with Th2 cytokines IL-4 and IL-13.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1998", "authors": "Andrew DP, Chang MS, McNinch J, Wathen ST, Rihanek M, Tseng J, Spellberg JP, Elias CG 3rd", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9794440", "url": "https://glygen.org/publication/PubMed/9794440" } ] }, { "title": "Structural and biological stability of the human interleukin 10 homodimer.", "journal": "Biochemistry", "date": "1998", "authors": "Syto R, Murgolo NJ, Braswell EH, Mui P, Huang E, Windsor WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9836587", "url": "https://glygen.org/publication/PubMed/9836587" } ] }, { "title": "Tyrosine-dependent and -independent mechanisms of STAT3 activation by the human granulocyte colony-stimulating factor (G-CSF) receptor are differentially utilized depending on G-CSF concentration.", "journal": "Blood", "date": "1999", "authors": "Ward AC, Hermans MH, Smith L, van Aesch YM, Schelen AM, Antonissen C, Touw IP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9674555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555" } ], "reference": [ { "type": "PubMed", "id": "9864153", "url": "https://glygen.org/publication/PubMed/9864153" } ] }, { "title": "Defective internalization and sustained activation of truncated granulocyte colony-stimulating factor receptor found in severe congenital neutropenia/acute myeloid leukemia.", "journal": "Blood", "date": "1999", "authors": "Ward AC, van Aesch YM, Schelen AM, Touw IP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705462", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705462" } ], "reference": [ { "type": "PubMed", "id": "9885206", "url": "https://glygen.org/publication/PubMed/9885206" } ] }, { "title": "Interleukin 10 (IL-10) inhibition of primary human prostate cell-induced angiogenesis: IL-10 stimulation of tissue inhibitor of metalloproteinase-1 and inhibition of matrix metalloproteinase (MMP)-2/MMP-9 secretion.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "1999", "authors": "Stearns ME, Rhim J, Wang M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9918218", "url": "https://glygen.org/publication/PubMed/9918218" } ] } ], "pathway": [ { "id": "hsa:1440", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1440", "resource": "KEGG Pathway" }, { "id": "R-HSA-449836", "name": "Other interleukin signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836", "resource": "Reactome", "description": "Other interleukin signaling" }, { "id": "R-HSA-6783783", "name": "Interleukin-10 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783", "resource": "Reactome", "description": "Interleukin-10 signaling" }, { "id": "R-HSA-9674555", "name": "Signaling by CSF3 (G-CSF)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9674555", "resource": "Reactome", "description": "Signaling by CSF3 (G-CSF)" }, { "id": "R-HSA-9705462", "name": "Inactivation of CSF3 (G-CSF) signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705462", "resource": "Reactome", "description": "Inactivation of CSF3 (G-CSF) signaling" } ], "orthologs": [ { "uniprot_canonical_ac": "O02837-1", "protein_name": "Granulocyte colony-stimulating factor", "gene_name": "CSF3", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MKLMALQLLLWHIALWMVPEAAPLSPASSLPQSFLLKCLEQVRKIQADGAELQERLCATHKLCHPQELVLLGHSLGLPQASLSSCSSQALQLTGCLNQLHGGLVLYQGLLQALAGISPELAPALDILQLDVTDLATNIWLQMEDLRMAPASLPTQGTVPTFTSAFQRRAGGVLVVSQLQSFLELAYRVLRYLAEP", "length": 195 }, "evidence": [ { "id": "P09919", "url": "https://omabrowser.org/oma/group/P09919/", "database": "OMA" } ], "common_name": "Pig" }, { "uniprot_canonical_ac": "P09920-1", "protein_name": "Granulocyte colony-stimulating factor", "gene_name": "Csf3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAQLSAQRRMKLMALQLLLWQSALWSGREAVPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA", "length": 208 }, "evidence": [ { "id": "45922760", "url": "http://www.informatics.jax.org/homology/45922760", "database": "MGI" }, { "id": "P09919", "url": "https://omabrowser.org/oma/group/P09919/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "pmid": "" }, { "name": "lysosomal lumen", "id": "GO:0043202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043202", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "pmid": "" }, { "name": "endocytic vesicle lumen", "id": "GO:0071682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071682", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 14, "go_terms": [ { "name": "immune response", "id": "GO:0006955", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006955", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "pmid": "" }, { "name": "positive regulation of myeloid cell differentiation", "id": "GO:0045639", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045639", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "pmid": "" }, { "name": "granulocyte differentiation", "id": "GO:0030851", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030851", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "pmid": "" }, { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "pmid": "" }, { "name": "response to ethanol", "id": "GO:0045471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045471", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "pmid": "" }, { "name": "positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction", "id": "GO:0051897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051897", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "pmid": "" }, { "name": "cellular response to lipopolysaccharide", "id": "GO:0071222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071222", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "pmid": "" }, { "name": "positive regulation of peptidyl-tyrosine phosphorylation", "id": "GO:0050731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050731", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "pmid": "" }, { "name": "cellular response to cytokine stimulus", "id": "GO:0071345", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071345", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "pmid": "" }, { "name": "positive regulation of actin filament polymerization", "id": "GO:0030838", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030838", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "pmid": "" }, { "name": "cytokine-mediated signaling pathway", "id": "GO:0019221", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019221", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "pmid": "" }, { "name": "granulocyte colony-stimulating factor signaling pathway", "id": "GO:0038158", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038158", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "pmid": "" }, { "name": "regulation of actin filament organization", "id": "GO:0110053", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0110053", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "cytokine activity", "id": "GO:0005125", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005125", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "pmid": "" }, { "name": "enzyme binding", "id": "GO:0019899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "pmid": "" }, { "name": "growth factor activity", "id": "GO:0008083", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008083", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "pmid": "" }, { "name": "granulocyte colony-stimulating factor receptor binding", "id": "GO:0005130", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005130", "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprot/P09919" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [ { "assessed_biomarker_entity": "Granulocyte colony-stimulating factor (CSF3)", "biomarker_id": "A0043", "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "21431281", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21431281" }, { "id": "31986264", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31986264" }, { "id": "32222466", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32222466" } ], "instances": [ { "best_biomarker_type": "prognostic", "status": "increased CSF3 level", "disease": { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] }, "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "21431281", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21431281" } ] }, { "best_biomarker_type": "monitoring", "status": "increased CSF3 level", "disease": { "disease_id": "DOID:0080600", "recommended_name": { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "COVID-19", "description": "A Coronavirus infection that is characterized by fever, cough and shortness of breath and that has_material_basis_in SARS-CoV-2." }, "synonyms": [ { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "2019 Novel Coronavirus (2019-nCoV)", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "2019-nCoV infection", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "Wuhan coronavirus infection", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "Wuhan seafood market pneumonia virus infection", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "COVID19", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "SARS-CoV-2 infection", "description": "" } ] }, "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "31986264", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31986264" }, { "id": "32222466", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32222466" } ] } ] } ], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 166 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 101 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }