{
"uniprot_canonical_ac": "P09884-1",
"uniprot_ac": "P09884",
"uniprot_id": "DPOLA_HUMAN",
"mass": {
"chemical_mass": 165913.0,
"monoisotopic_mass": 165913.0
},
"refseq": {
"ac": "NP_058633",
"name": "DNA polymerase alpha catalytic subunit isoform 2",
"summary": "This gene encodes the catalytic subunit of DNA polymerase, which together with a regulatory and two primase subunits, forms the DNA polymerase alpha complex. The catalytic subunit plays an essential role in the initiation of DNA replication. [provided by RefSeq, Mar 2010].",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_058633"
},
"gene_names": [
{
"name": "POLA1",
"resource": "UniProtKB",
"type": "recommended",
"url": "https://www.uniprot.org/uniprot/P09884",
"id": "P09884"
},
{
"name": "NSX; p180; PDR; POLA; VEODS",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_058633",
"id": "NP_058633"
},
{
"name": "POLA1",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_058633",
"id": "NP_058633"
},
{
"name": "POLA",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/P09884",
"id": "P09884"
}
],
"protein_names": [
{
"name": "DNA polymerase alpha catalytic subunit",
"resource": "UniProtKB",
"type": "recommended",
"url": "",
"id": "P09884"
},
{
"name": "2.7.7.7",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P09884"
},
{
"name": "DNA polymerase alpha catalytic subunit isoform 2",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_058633",
"id": "NP_058633"
},
{
"name": "DNA polymerase alpha catalytic subunit p180",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P09884"
},
{
"name": "polymerase (DNA-directed), alpha (70kD); polymerase (DNA) alpha 1, catalytic subunit; DNA polymerase alpha catalytic subunit p180; polymerase (DNA directed), alpha 1, catalytic subunit",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_058633",
"id": "NP_058633"
}
],
"function": [
{
"annotation": "Catalytic subunit of the DNA polymerase alpha complex (also known as the alpha DNA polymerase-primase complex) which plays an essential role in the initiation of DNA synthesis. During the S phase of the cell cycle, the DNA polymerase alpha complex (composed of a catalytic subunit POLA1, a regulatory subunit POLA2 and two primase subunits PRIM1 and PRIM2) is recruited to DNA at the replicative forks via direct interactions with MCM10 and WDHD1. The primase subunit of the polymerase alpha complex initiates DNA synthesis by oligomerising short RNA primers on both leading and lagging strands. These primers are initially extended by the polymerase alpha catalytic subunit and subsequently transferred to polymerase delta and polymerase epsilon for processive synthesis on the lagging and leading strand, respectively. The reason this transfer occurs is because the polymerase alpha has limited processivity and lacks intrinsic 3' exonuclease activity for proofreading error, and therefore is not well suited for replicating long complexes. In the cytosol, responsible for a substantial proportion of the physiological concentration of cytosolic RNA:DNA hybrids, which are necessary to prevent spontaneous activation of type I interferon responses (PubMed:27019227).",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884#function"
},
{
"database": "PubMed",
"id": "27019227",
"url": "https://glygen.org/publication/PubMed/27019227"
},
{
"database": "PubMed",
"id": "9518481",
"url": "https://glygen.org/publication/PubMed/9518481"
},
{
"database": "PubMed",
"id": "26975377",
"url": "https://glygen.org/publication/PubMed/26975377"
},
{
"database": "PubMed",
"id": "31006512",
"url": "https://glygen.org/publication/PubMed/31006512"
}
]
},
{
"annotation": "Defective DNA Polymerase alpha-Primase Leads to X-Linked Intellectual Disability Associated with Severe Growth Retardation, Microcephaly, and Hypogonadism.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_058633",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_058633"
},
{
"database": "PubMed",
"id": "31006512",
"url": "https://glygen.org/publication/PubMed/31006512"
}
]
},
{
"annotation": "Detailed structural comparison of Polalpha with other replicative DNA polymerases disclosed common features and some differences, which may reflect the specialization of each polymerase in genome replication",
"evidence": [
{
"database": "RefSeq",
"id": "NP_058633",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_058633"
},
{
"database": "PubMed",
"id": "29555682",
"url": "https://glygen.org/publication/PubMed/29555682"
}
]
},
{
"annotation": "Pol alpha-primase dependent nuclear localization of the mammalian CST complex. Publication Status: Online-Only",
"evidence": [
{
"database": "RefSeq",
"id": "NP_058633",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_058633"
},
{
"database": "PubMed",
"id": "33731801",
"url": "https://glygen.org/publication/PubMed/33731801"
}
]
},
{
"annotation": "Small tandem DNA duplications result from CST-guided Pol alpha-primase action at DNA break termini. Publication Status: Online-Only",
"evidence": [
{
"database": "RefSeq",
"id": "NP_058633",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_058633"
},
{
"database": "PubMed",
"id": "34376693",
"url": "https://glygen.org/publication/PubMed/34376693"
}
]
},
{
"annotation": "This gene encodes the catalytic subunit of DNA polymerase, which together with a regulatory and two primase subunits, forms the DNA polymerase alpha complex. The catalytic subunit plays an essential role in the initiation of DNA replication. [provided by RefSeq, Mar 2010].",
"evidence": [
{
"database": "RefSeq",
"id": "NP_058633",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_058633"
}
]
},
{
"annotation": "We propose that completely skewed XCI favoring the normal X chromosome resulted from death of cells with an active derivative X that was caused by a non-functional POLA1 gene. In summary, we conclude that functional monosomy of 6q27-qter and functional disomy of Xpter-p22.11 are responsible for the clinical phenotype of the patient",
"evidence": [
{
"database": "RefSeq",
"id": "NP_058633",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_058633"
},
{
"database": "PubMed",
"id": "28371302",
"url": "https://glygen.org/publication/PubMed/28371302"
}
]
}
],
"disease": [
{
"disease_id": "DOID:0111834",
"recommended_name": {
"id": "DOID:0111834",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0111834",
"name": "X-linked reticulate pigmentary disorder",
"description": "A pigmentation disease characterized by early onset of recurrent respiratory infections, failure to thrive resulting from inflammatory gastroenteritis or colitis, and reticular pigmentation abnormalities of the skin in hemizygous males and only pigmentary abnormalities along the lines of Blaschko in heterozygous females that has_material_basis_in mutation in the POLA1 gene on chromosome Xp22.1-p21.3."
},
"synonyms": [
{
"id": "DOID:0111834",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0111834",
"name": "PDR",
"description": ""
},
{
"id": "DOID:0111834",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0111834",
"name": "Partington disease",
"description": ""
},
{
"id": "DOID:0111834",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0111834",
"name": "X-linked reticulate pigmentary disorder with systemic manifestations",
"description": ""
},
{
"id": "MONDO:0010523",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010523",
"name": "X-linked reticulate pigmentary disorder",
"description": "X-linked reticulate pigmentary disorder is an extremely rare skin disease described in only four families to date and characterized in males by diffuse reticulate brown hyperpigmentated skin lesions developing in early childhood and a variety of systemic manifestations (recurrent pneumonia, corneal opacification, gastrointestinal inflammation, urethral stricture, failure to thrive, hypohidrosis, digital clubbing, and unruly hair and flared eyebrows), while in females, there is only cutaneous involvement with the development in early childhood of localized brown hyperpigmented skin lesions following the lines of Blaschko. This disease was first considered as a cutaneous amyloidosis, but amyloid deposits are an inconstant feature."
},
{
"id": "MONDO:0010523",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010523",
"name": "PDR",
"description": ""
},
{
"id": "MONDO:0010523",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010523",
"name": "Partington disease",
"description": ""
},
{
"id": "MONDO:0010523",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010523",
"name": "X-linked cutaneous amyloidosis",
"description": ""
},
{
"id": "MONDO:0010523",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010523",
"name": "XLPDR",
"description": ""
},
{
"id": "MONDO:0010523",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010523",
"name": "familial cutaneous amyloidosis",
"description": ""
},
{
"id": "MONDO:0010523",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010523",
"name": "pigmentary disorder, reticulate, with systemic manifestations, X-linked, X-linked recessive",
"description": ""
},
{
"id": "MONDO:0010523",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010523",
"name": "amyloidosis, familial cutaneous",
"description": ""
},
{
"id": "MONDO:0010523",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010523",
"name": "pigmentary disorder, reticulate, with systemic manifestations",
"description": ""
},
{
"id": "MONDO:0010523",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010523",
"name": "pigmentary disorder, reticulate, with systemic manifestations, X-linked",
"description": ""
},
{
"id": "MIM:301220",
"resource": "MIM",
"url": "https://www.omim.org/entry/301220",
"name": "Pigmentary disorder, reticulate, with systemic manifestations, X-linked",
"description": "Pigmentary disorder, reticulate, with systemic manifestations, X-linked"
}
],
"evidence": [
{
"id": "301220",
"database": "MIM",
"url": "https://www.omim.org/entry/301220"
}
]
},
{
"disease_id": "DOID:0111840",
"recommended_name": {
"id": "DOID:0111840",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0111840",
"name": "Van Esch-O'Driscoll syndrome",
"description": "A syndromic X-linked intellectual disability characterized by variable degrees of intellectual disability, moderate to severe short stature, microcephaly, hypogonadism, and variable congenital malformations that has_material_basis_in hemizygous mutation in the POLA1 gene on chromosome Xp22.1-p21.3."
},
"synonyms": [
{
"id": "DOID:0111840",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0111840",
"name": "MRXSVEOD",
"description": ""
},
{
"id": "DOID:0111840",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0111840",
"name": "VEODS",
"description": ""
},
{
"id": "DOID:0111840",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0111840",
"name": "X-linked intellectual disability, Van Esch type",
"description": ""
},
{
"id": "DOID:0111840",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0111840",
"name": "X-linked syndromic mental retardation Van Esch-O'Driscoll type",
"description": ""
},
{
"id": "MONDO:0015601",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0015601",
"name": "X-linked intellectual disability, van Esch type",
"description": "X-linked intellectual deficit, Van Esch type is characterized by mild to moderate intellectual deficit associated with low birth weight, short stature, microcephaly and variable hypergonadotropic hypogonadism."
},
{
"id": "MONDO:0015601",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0015601",
"name": "VEODS",
"description": ""
},
{
"id": "MONDO:0015601",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0015601",
"name": "Van Esch-O'Driscoll syndrome",
"description": ""
},
{
"id": "MONDO:0015601",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0015601",
"name": "Van Esch-O'Driscoll syndrome, X-linked recessive",
"description": ""
},
{
"id": "MONDO:0015601",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0015601",
"name": "mental retardation, X-Linked, syndromic, Van Esch-O'Driscoll type",
"description": ""
},
{
"id": "MIM:301030",
"resource": "MIM",
"url": "https://www.omim.org/entry/301030",
"name": "Van Esch-O'Driscoll syndrome",
"description": "Van Esch-O'Driscoll syndrome"
}
],
"evidence": [
{
"id": "301030",
"database": "MIM",
"url": "https://www.omim.org/entry/301030"
}
]
}
],
"snv": [
{
"evidence": [
{
"id": "P09884",
"database": "BioMuta",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P09884"
}
],
"glycoeffect": [],
"start_pos": 116,
"end_pos": 116,
"subjects_tested": "0",
"subjects_positive": "0",
"frequency": "0.0",
"sequence_org": "R",
"sequence_mut": "H",
"comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).",
"chr_id": "X",
"chr_pos": "24714572",
"ref_nt": "G",
"alt_nt": "A",
"minor_allelic_frequency": "",
"site_lbl": "R116",
"disease": [
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
},
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
},
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
],
"keywords": [
"biomuta",
"somatic",
"cancer",
"disease"
]
},
{
"evidence": [
{
"id": "P09884",
"database": "BioMuta",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P09884"
}
],
"glycoeffect": [],
"start_pos": 1356,
"end_pos": 1356,
"subjects_tested": "0",
"subjects_positive": "0",
"frequency": "0.0",
"sequence_org": "R",
"sequence_mut": "Q",
"comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (4).",
"chr_id": "X",
"chr_pos": "24888043",
"ref_nt": "G",
"alt_nt": "A",
"minor_allelic_frequency": "",
"site_lbl": "R1356",
"disease": [
{
"disease_id": "DOID:1319",
"recommended_name": {
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "brain cancer",
"description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain."
},
"synonyms": [
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "BT - Brain tumour",
"description": ""
},
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "adult brain tumor",
"description": ""
},
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "adult malignant brain neoplasm",
"description": ""
},
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "brain neoplasm",
"description": ""
},
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "brain neoplasm, adult",
"description": ""
},
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "malignant brain tumour",
"description": ""
},
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "malignant primary brain neoplasm",
"description": ""
},
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "malignant primary brain tumor",
"description": ""
},
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "malignant tumor of Brain",
"description": ""
},
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "malignant tumor of adult brain",
"description": ""
},
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "neoplasm of brain",
"description": ""
},
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "primary brain neoplasm",
"description": ""
},
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "primary brain tumor",
"description": ""
},
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "primary malignant neoplasm of brain",
"description": ""
},
{
"id": "DOID:1319",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1319",
"name": "tumor of the Brain",
"description": ""
}
]
},
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
},
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
},
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
}
],
"keywords": [
"biomuta",
"somatic",
"cancer",
"disease"
]
}
],
"mutagenesis": [],
"expression_tissue": [
{
"tissue": {
"name": "Adult mammalian kidney",
"namespace": "UBERON",
"id": "0000082",
"url": "http://purl.obolibrary.org/obo/UBERON_0000082"
},
"score": "64.07",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000101868",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000101868"
}
]
},
{
"tissue": {
"name": "Oral cavity",
"namespace": "UBERON",
"id": "0000167",
"url": "http://purl.obolibrary.org/obo/UBERON_0000167"
},
"score": "69.49",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000101868",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000101868"
}
]
},
{
"tissue": {
"name": "Stomach",
"namespace": "UBERON",
"id": "0000945",
"url": "http://purl.obolibrary.org/obo/UBERON_0000945"
},
"score": "70.51",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000101868",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000101868"
}
]
},
{
"tissue": {
"name": "Uterus",
"namespace": "UBERON",
"id": "0000995",
"url": "http://purl.obolibrary.org/obo/UBERON_0000995"
},
"score": "49.96",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000101868",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000101868"
}
]
},
{
"tissue": {
"name": "Esophagus",
"namespace": "UBERON",
"id": "0001043",
"url": "http://purl.obolibrary.org/obo/UBERON_0001043"
},
"score": "78.29",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000101868",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000101868"
}
]
},
{
"tissue": {
"name": "Rectum",
"namespace": "UBERON",
"id": "0001052",
"url": "http://purl.obolibrary.org/obo/UBERON_0001052"
},
"score": "80.17",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000101868",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000101868"
}
]
},
{
"tissue": {
"name": "Colon",
"namespace": "UBERON",
"id": "0001155",
"url": "http://purl.obolibrary.org/obo/UBERON_0001155"
},
"score": "57.45",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000101868",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000101868"
}
]
},
{
"tissue": {
"name": "Urinary bladder",
"namespace": "UBERON",
"id": "0001255",
"url": "http://purl.obolibrary.org/obo/UBERON_0001255"
},
"score": "77.07",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000101868",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000101868"
}
]
},
{
"tissue": {
"name": "Thyroid gland",
"namespace": "UBERON",
"id": "0002046",
"url": "http://purl.obolibrary.org/obo/UBERON_0002046"
},
"score": "71.66",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000101868",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000101868"
}
]
},
{
"tissue": {
"name": "Lung",
"namespace": "UBERON",
"id": "0002048",
"url": "http://purl.obolibrary.org/obo/UBERON_0002048"
},
"score": "61.45",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000101868",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000101868"
}
]
},
{
"tissue": {
"name": "Liver",
"namespace": "UBERON",
"id": "0002107",
"url": "http://purl.obolibrary.org/obo/UBERON_0002107"
},
"score": "72.47",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000101868",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000101868"
}
]
},
{
"tissue": {
"name": "Prostate gland",
"namespace": "UBERON",
"id": "0002367",
"url": "http://purl.obolibrary.org/obo/UBERON_0002367"
},
"score": "72.2",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000101868",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000101868"
}
]
},
{
"tissue": {
"name": "Thoracic mammary gland",
"namespace": "UBERON",
"id": "0005200",
"url": "http://purl.obolibrary.org/obo/UBERON_0005200"
},
"score": "76.22",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000101868",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000101868"
}
]
}
],
"expression_disease": [
{
"significant": "Yes",
"trend": "down",
"name": "Prostate cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10283",
"evidence": [
{
"database": "BioXpress",
"id": "P09884",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09884"
}
],
"disease": [
{
"disease_id": "DOID:10283",
"recommended_name": {
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer",
"description": "A male reproductive organ cancer that is located_in the prostate."
},
"synonyms": [
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "NGP - new growth of prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "malignant tumor of the prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "tumor of the prostate",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, type 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "HPC9",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "EHBP1 familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "familial prostate cancer caused by mutation in EHBP1",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, type 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "HPC12",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, type 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "HPC5",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, type 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, susceptibility to, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "HPC3",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, type 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, susceptibility to, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "HPC4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, on chromosome 7",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "MSMB familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "familial prostate cancer caused by mutation in MSMB",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, type 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "HPC13",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, type 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "HPC8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "predisposing for prostate cancer",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, type 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "HPC6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "HPC10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate carcinoma",
"description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate carcinoma",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, somatic",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, hereditary",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "HPC7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer aggressiveness",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "RNASEL familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "familial prostate cancer caused by mutation in RNASEL",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, type 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "HPC1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "Prca1",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "HPC11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "HPC14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "HPC15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "HPCX1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer susceptibility, X-linked",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "HPCX2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MIM:611868",
"resource": "MIM",
"url": "https://www.omim.org/entry/611868",
"name": "Prostate cancer, hereditary, 12",
"description": "Prostate cancer, hereditary, 12"
},
{
"id": "MIM:611928",
"resource": "MIM",
"url": "https://www.omim.org/entry/611928",
"name": "Prostate cancer, hereditary, 13",
"description": "Prostate cancer, hereditary, 13"
},
{
"id": "MIM:176807",
"resource": "MIM",
"url": "https://www.omim.org/entry/176807",
"name": "Prostate cancer",
"description": "Prostate cancer"
},
{
"id": "MIM:601518",
"resource": "MIM",
"url": "https://www.omim.org/entry/601518",
"name": "Prostate cancer, hereditary, 1",
"description": "Prostate cancer, hereditary, 1"
},
{
"id": "MIM:611955",
"resource": "MIM",
"url": "https://www.omim.org/entry/611955",
"name": "Prostate cancer, hereditary, 11",
"description": "Prostate cancer, hereditary, 11"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Stomach cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10534",
"evidence": [
{
"database": "BioXpress",
"id": "P09884",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09884"
}
],
"disease": [
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Urinary bladder cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11054",
"evidence": [
{
"database": "BioXpress",
"id": "P09884",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09884"
}
],
"disease": [
{
"disease_id": "DOID:11054",
"recommended_name": {
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "urinary bladder cancer",
"description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
},
"synonyms": [
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "bladder cancer",
"description": ""
},
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": "A primary or metastatic malignant neoplasm involving the bladder."
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "bladder cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "cancer of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumour",
"description": ""
},
{
"id": "MIM:109800",
"resource": "MIM",
"url": "https://www.omim.org/entry/109800",
"name": "Bladder cancer",
"description": "Bladder cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Head and neck cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11934",
"evidence": [
{
"database": "BioXpress",
"id": "P09884",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09884"
}
],
"disease": [
{
"disease_id": "DOID:11934",
"recommended_name": {
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck cancer",
"description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx."
},
"synonyms": [
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck tumours",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head/neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "tumor of head and neck",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Lung cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1324",
"evidence": [
{
"database": "BioXpress",
"id": "P09884",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09884"
}
],
"disease": [
{
"disease_id": "DOID:1324",
"recommended_name": {
"id": "DOID:1324",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1324",
"name": "lung cancer",
"description": "A respiratory system cancer that is located_in the lung."
},
"synonyms": [
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "LNCR1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "LNCR3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "adenocarcinoma of lung, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "LNCR4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "LNCR5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": "A malignant neoplasm involving the lung."
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "cancer of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung neoplasm",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumor",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumour",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "Nonsmall cell lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "alveolar cell carcinoma",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung neoplasm",
"description": ""
},
{
"id": "MIM:211980",
"resource": "MIM",
"url": "https://www.omim.org/entry/211980",
"name": "Lung cancer",
"description": "Lung cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Breast cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1612",
"evidence": [
{
"database": "BioXpress",
"id": "P09884",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09884"
}
],
"disease": [
{
"disease_id": "DOID:1612",
"recommended_name": {
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast cancer",
"description": "A thoracic cancer that originates in the mammary gland."
},
"synonyms": [
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant neoplasm of breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant tumor of the breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary cancer",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "primary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, lobular, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of the breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial Male",
"description": ""
},
{
"id": "MIM:114480",
"resource": "MIM",
"url": "https://www.omim.org/entry/114480",
"name": "Breast cancer",
"description": "Breast cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "down",
"name": "Thyroid cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1781",
"evidence": [
{
"database": "BioXpress",
"id": "P09884",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09884"
}
],
"disease": [
{
"disease_id": "DOID:1781",
"recommended_name": {
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid cancer",
"description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage."
},
"synonyms": [
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid gland cancer",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "Thyroid gland neoplasm",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant tumour of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Kidney cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:263",
"evidence": [
{
"database": "BioXpress",
"id": "P09884",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09884"
}
],
"disease": [
{
"disease_id": "DOID:263",
"recommended_name": {
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "kidney cancer",
"description": "A urinary system cancer that is located_in the kidney."
},
"synonyms": [
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant neoplasm of kidney except pelvis",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant tumour of kidney",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "renal cancer",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Liver cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:3571",
"evidence": [
{
"database": "BioXpress",
"id": "P09884",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09884"
}
],
"disease": [
{
"disease_id": "DOID:3571",
"recommended_name": {
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "liver cancer",
"description": "A hepatobiliary system cancer that is located_in the liver."
},
"synonyms": [
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Ca liver - primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Resectable malignant neoplasm of Liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant hepato-biliary neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant tumor of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "non-resectable primary hepatic malignant neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary liver cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "resectable malignant neoplasm of the liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, not specified as primary or secondary",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Uterine cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:363",
"evidence": [
{
"database": "BioXpress",
"id": "P09884",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09884"
}
],
"disease": [
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Esophageal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:5041",
"evidence": [
{
"database": "BioXpress",
"id": "P09884",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09884"
}
],
"disease": [
{
"disease_id": "DOID:5041",
"recommended_name": {
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophageal cancer",
"description": "A gastrointestinal system cancer that is located_in the esophagus."
},
"synonyms": [
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophagus cancer",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Distal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Proximal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of the middle Third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": "A primary or metastatic malignant neoplasm involving the esophagus."
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "oesophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the middle third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of abdominal oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the middle third of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Aerodigestive tract cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Escc, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "gastric cardia adenocarcinoma, susceptibility to",
"description": ""
},
{
"id": "MIM:133239",
"resource": "MIM",
"url": "https://www.omim.org/entry/133239",
"name": "Esophageal cancer",
"description": "Esophageal cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Colorectal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:9256",
"evidence": [
{
"database": "BioXpress",
"id": "P09884",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09884"
}
],
"disease": [
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
}
]
}
],
"species": [
{
"name": "Homo sapiens",
"taxid": 9606,
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"common_name": "Human"
}
],
"gene": [
{
"name": "POLA1",
"url": "https://www.uniprot.org/uniprot/P09884",
"locus": {
"chromosome": "X",
"start_pos": 24996986,
"end_pos": 24693873,
"strand": "-",
"evidence": [
{
"database": "Ensembl Gene",
"id": "ENSG00000101868",
"url": "https://www.ensembl.org/id/ENSG00000101868"
}
]
}
}
],
"crossref": [
{
"id": "ENSG00000101868",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000101868",
"database": "Bgee",
"categories": [
"Gene Expression"
]
},
{
"id": "P09884",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P09884",
"database": "BioMuta",
"categories": [
"Variation"
]
},
{
"id": "2.7.7.102",
"url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.7.7.102&UniProtAcc=P09884",
"database": "BRENDA",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "cd05532",
"url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05532",
"database": "CDD",
"categories": [
"Protein Classification"
]
},
{
"id": "cd05776",
"url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05776",
"database": "CDD",
"categories": [
"Protein Classification"
]
},
{
"id": "CHEMBL1828",
"url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1828",
"database": "ChEMBL",
"categories": [
"Other"
]
},
{
"id": "POLA1",
"url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=POLA1",
"database": "GeneCards",
"categories": [
"Gene Annotation",
"Organism-specific"
]
},
{
"id": "5422",
"url": "https://www.ncbi.nlm.nih.gov/gene/5422",
"database": "GeneID",
"categories": [
"Genome Annotation"
]
},
{
"id": "9173",
"url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=9173",
"database": "HGNC",
"categories": [
"Organism-specific"
]
},
{
"id": "A6NMQ1",
"url": "https://www.ebi.ac.uk/intact/interactors/id:A6NMQ1*",
"database": "IntAct",
"categories": [
"Other"
]
},
{
"id": "P09884",
"url": "https://www.ebi.ac.uk/intact/interactors/id:P09884*",
"database": "IntAct",
"categories": [
"Other"
]
},
{
"id": "IPR006133",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR006133",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR006134",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR006134",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR006172",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR006172",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR012337",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR012337",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR015088",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR015088",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR017964",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR017964",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR023211",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR023211",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR024647",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR024647",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR036397",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR036397",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR038256",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR038256",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR042087",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR042087",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR043502",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR043502",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR045846",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR045846",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "hsa:5422",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5422",
"database": "KEGG Pathway",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "301030",
"url": "http://www.omim.org/entry/301030",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "301220",
"url": "http://www.omim.org/entry/301220",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "312040",
"url": "http://www.omim.org/entry/312040",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "NX_P09884",
"url": "https://www.nextprot.org/entry/NX_P09884",
"database": "neXtProt",
"categories": [
"Protein",
"Organism-specific"
]
},
{
"id": "P09884",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09884",
"database": "O-GlcNAc Database",
"categories": [
"Glycoproteomics"
]
},
{
"id": "MTKMNVG",
"url": "https://omabrowser.org/oma/group/MTKMNVG/",
"database": "OMA",
"categories": [
"Protein Classification"
]
},
{
"id": "5477697at2759",
"url": "http://www.orthodb.org/?query=5477697at2759",
"database": "OrthoDB",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR45861",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45861",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR45861:SF1",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45861:SF1",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "1K0P",
"url": "https://www.rcsb.org/structure/1K0P",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1K18",
"url": "https://www.rcsb.org/structure/1K18",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1N5G",
"url": "https://www.rcsb.org/structure/1N5G",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4Q5V",
"url": "https://www.rcsb.org/structure/4Q5V",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4QCL",
"url": "https://www.rcsb.org/structure/4QCL",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4Y97",
"url": "https://www.rcsb.org/structure/4Y97",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5EXR",
"url": "https://www.rcsb.org/structure/5EXR",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5IUD",
"url": "https://www.rcsb.org/structure/5IUD",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6AS7",
"url": "https://www.rcsb.org/structure/6AS7",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7N2M",
"url": "https://www.rcsb.org/structure/7N2M",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7OPL",
"url": "https://www.rcsb.org/structure/7OPL",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7U5C",
"url": "https://www.rcsb.org/structure/7U5C",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8B9D",
"url": "https://www.rcsb.org/structure/8B9D",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8D0B",
"url": "https://www.rcsb.org/structure/8D0B",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8D0K",
"url": "https://www.rcsb.org/structure/8D0K",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8D96",
"url": "https://www.rcsb.org/structure/8D96",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8D9D",
"url": "https://www.rcsb.org/structure/8D9D",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "PF00136",
"url": "http://pfam.xfam.org/family/PF00136",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "PF03104",
"url": "http://pfam.xfam.org/family/PF03104",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "PF08996",
"url": "http://pfam.xfam.org/family/PF08996",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "PF12254",
"url": "http://pfam.xfam.org/family/PF12254",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "P09884",
"url": "https://pharos.nih.gov/targets/P09884",
"database": "PHAROS",
"categories": [
"Organism-specific"
]
},
{
"id": "PR_P09884",
"url": "http://purl.obolibrary.org/obo/PR_P09884",
"database": "PRO",
"categories": [
"Protein"
]
},
{
"id": "R-HSA-113501",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-113501",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-174411",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174411",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-174430",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174430",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-68952",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68952",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-68962",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68962",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-69091",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69091",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-69166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69166",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-69183",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69183",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-69205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9710421",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9710421",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "NP_058633",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_058633",
"database": "RefSeq",
"categories": [
"Protein"
]
},
{
"id": "22508",
"url": "https://www.rhea-db.org/rhea/22508",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "A0A5F9ZHW2",
"url": "https://www.uniprot.org/uniprot/A0A5F9ZHW2",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A5F9ZHW2-1",
"url": "https://www.uniprot.org/uniprot/A0A5F9ZHW2-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A7I2V2V3",
"url": "https://www.uniprot.org/uniprot/A0A7I2V2V3",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A7I2V2V3-1",
"url": "https://www.uniprot.org/uniprot/A0A7I2V2V3-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A6NMQ1",
"url": "https://www.uniprot.org/uniprot/A6NMQ1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A6NMQ1-1",
"url": "https://www.uniprot.org/uniprot/A6NMQ1-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P09884-1",
"url": "https://www.uniprot.org/uniprot/P09884-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
}
],
"sequence": {
"sequence": "MAPVHGDDSLSDSGSFVSSRARREKKSKKGRQEALERLKKAKAGEKYKYEVEDFTGVYEEVDEEQYSKLVQARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDADEKGKDGKARNKDKRNVKKLAVTKPNNIKSMFIACAGKKTADKAVDLSKDGLLGDILQDLNTETPQITPPPVMILKKKRSIGASPNPFSVHTATAVPSGKIASPVSRKEPPLTPVPLKRAEFAGDDVQVESTEEEQESGAMEFEDGDFDEPMEVEEVDLEPMAAKAWDKESEPAEEVKQEADSGKGTVSYLGSFLPDVSCWDIDQEGDSSFSVQEVQVDSSHLPLVKGADEEQVFHFYWLDAYEDQYNQPGVVFLFGKVWIESAETHVSCCVMVKNIERTLYFLPREMKIDLNTGKETGTPISMKDVYEEFDEKIATKYKIMKFKSKPVEKNYAFEIPDVPEKSEYLEVKYSAEMPQLPQDLKGETFSHVFGTNTSSLELFLMNRKIKGPCWLEVKSPQLLNQPVSWCKVEAMALKPDLVNVIKDVSPPPLVVMAFSMKTMQNAKNHQNEIIAMAALVHHSFALDKAAPKPPFQSHFCVVSKPKDCIFPYAFKEVIEKKNVKVEVAATERTLLGFFLAKVHKIDPDIIVGHNIYGFELEVLLQRINVCKAPHWSKIGRLKRSNMPKLGGRSGFGERNATCGRMICDVEISAKELIRCKSYHLSELVQQILKTERVVIPMENIQNMYSESSQLLYLLEHTWKDAKFILQIMCELNVLPLALQITNIAGNIMSRTLMGGRSERNEFLLLHAFYENNYIVPDKQIFRKPQQKLGDEDEEIDGDTNKYKKGRKKAAYAGGLVLDPKVGFYDKFILLLDFNSLYPSIIQEFNICFTTVQRVASEAQKVTEDGEQEQIPELPDPSLEMGILPREIRKLVERRKQVKQLMKQQDLNPDLILQYDIRQKALKLTANSMYGCLGFSYSRFYAKPLAALVTYKGREILMHTKEMVQKMNLEVIYGDTDSIMINTNSTNLEEVFKLGNKVKSEVNKLYKLLEIDIDGVFKSLLLLKKKKYAALVVEPTSDGNYVTKQELKGLDIVRRDWCDLAKDTGNFVIGQILSDQSRDTIVENIQKRLIEIGENVLNGSVPVSQFEINKALTKDPQDYPDKKSLPHVHVALWINSQGGRKVKAGDTVSYVICQDGSNLTASQRAYAPEQLQKQDNLTIDTQYYLAQQIHPVVARICEPIDGIDAVLIATWLGLDPTQFRVHHYHKDEENDALLGGPAQLTDEEKYRDCERFKCPCPTCGTENIYDNVFDGSGTDMEPSLYRCSNIDCKASPLTFTVQLSNKLIMDIRRFIKKYYDGWLICEEPTCRNRTRHLPLQFSRTGPLCPACMKATLQPEYSDKSLYTQLCFYRYIFDAECALEKLTTDHEKDKLKKQFFTPKVLQDYRKLKNTAEQFLSRSGYSEVNLSKLFAGCAVKS",
"length": 1462,
"header": "sp|P09884-1|DPOLA_HUMAN Isoform 1 of DNA polymerase alpha catalytic subunit OS=Homo sapiens OX=9606 GN=POLA1 PE=1 SV=2 CANONICAL=P09884-1"
},
"isoforms": [
{
"isoform_ac": "A0A5F9ZHW2-1",
"url": "",
"sequence": {
"sequence": "MAPVHGDDCEIGASALSDSGSFVSSRARREKKSKKGRQEALERLKKAKAGEKYKYEMVLAMWKMAERFLMMTLKMMPLMLMRKEKMVKHAIKTRGM",
"length": 96,
"header": "tr|A0A5F9ZHW2-1|A0A5F9ZHW2_HUMAN Computationally mapped isoform of DNA polymerase alpha 1, catalytic subunit OS=Homo sapiens OX=9606 GN=POLA1 PE=1 SV=1 CANONICAL=P09884-1"
},
"locus": {
"chromosome": "X",
"start_pos": 24714592,
"end_pos": 24693962,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000672178.1",
"url": "https://www.ensembl.org/id/ENST00000672178.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000500742.1",
"url": "https://www.ensembl.org/id/ENSP00000500742.1"
}
]
}
},
{
"isoform_ac": "A0A7I2V2V3-1",
"url": "",
"sequence": {
"sequence": "MAPVHGDDCEIGASALSDSGSFVSSRARREKKSKKGRQEALERLKKAKAGEKYKYEVEDFTGVYEEVDEEQYSKLVQARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDADEKGKDGKARNKDKRNVKKLAVTKPNNIKSMFIACAGKKTADKAVDLSKDGLLGDILQDLNTETPQITPPPVMILKKKRSIGASPNPFSVHTATAVPSGKIASPVSRKEPPLTPVPLKRAEFAGDDVQVESTEEEQESGAMEFEDGDFDEPMEVEEVDLEPMAAKAWDKESEPAEEVKQEADSGKGTVSYLGSFLPDVSCWDIDQEGDSSFSVQEVQVDSSHLPLVKGADEEQVFHFYWLDAYEDQYNQPGVVFLFGKVWIESAETHVSCCVMVKNIERTLYFLPREMKIDLNTGKETGTPISMKDVYEEFDEKIATKYKIMKFKSKPVEKNYAFEIPDVPEKSEYLEVKYSAEMPQLPQDLKGETFSHVFGTNTSSLELFLMNRKIKGPCWLEVKSPQLLNQPVSWCKVEAMALKPDLVNVIKDVSPPPLVVMAFSMKTMQNAKNHQNEV",
"length": 563,
"header": "tr|A0A7I2V2V3-1|A0A7I2V2V3_HUMAN Computationally mapped isoform of DNA polymerase alpha 1, catalytic subunit OS=Homo sapiens OX=9606 GN=POLA1 PE=1 SV=1 CANONICAL=P09884-1"
},
"locus": {
"chromosome": "X",
"start_pos": 24727939,
"end_pos": 24693962,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000677890.1",
"url": "https://www.ensembl.org/id/ENST00000677890.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000503099.1",
"url": "https://www.ensembl.org/id/ENSP00000503099.1"
}
]
}
},
{
"isoform_ac": "A6NMQ1-1",
"url": "",
"sequence": {
"sequence": "MAPVHGDDCEIGASALSDSGSFVSSRARREKKSKKGRQEALERLKKAKAGEKYKYEVEDFTGVYEEVDEEQYSKLVQARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDADEKGKDGKARNKDKRNVKKLAVTKPNNIKSMFIACAGKKTADKAVDLSKDGLLGDILQDLNTETPQITPPPVMILKKKRSIGASPNPFSVHTATAVPSGKIASPVSRKEPPLTPVPLKRAEFAGDDVQVESTEEEQESGAMEFEDGDFDEPMEVEEVDLEPMAAKAWDKESEPAEEVKQEADSGKGTVSYLGSFLPDVSCWDIDQEGDSSFSVQEVQVDSSHLPLVKGADEEQVFHFYWLDAYEDQYNQPGVVFLFGKVWIESAETHVSCCVMVKNIERTLYFLPREMKIDLNTGKETGTPISMKDVYEEFDEKIATKYKIMKFKSKPVEKNYAFEIPDVPEKSEYLEVKYSAEMPQLPQDLKGETFSHVFGTNTSSLELFLMNRKIKGPCWLEVKSPQLLNQPVSWCKVEAMALKPDLVNVIKDVSPPPLVVMAFSMKTMQNAKNHQNEIIAMAALVHHSFALDKAAPKPPFQSHFCVVSKPKDCIFPYAFKEVIEKKNVKVEVAATERTLLGFFLAKVHKIDPDIIVGHNIYGFELEVLLQRINVCKAPHWSKIGRLKRSNMPKLGGRSGFGERNATCGRMICDVEISAKELIRCKSYHLSELVQQILKTERVVIPMENIQNMYSESSQLLYLLEHTWKDAKFILQIMCELNVLPLALQITNIAGNIMSRTLMGGRSERNEFLLLHAFYENNYIVPDKQIFRKPQQKLGDEDEEIDGDTNKYKKGRKKAAYAGGLVLDPKVGFYDKFILLLDFNSLYPSIIQEFNICFTTVQRVASEAQKVTEDGEQEQIPELPDPSLEMGILPREIRKLVERRKQVKQLMKQQDLNPDLILQYDIRQKALKLTANSMYGCLGFSYSRFYAKPLAALVTYKGREILMHTKEMVQKMNLEVIYGDTDSIMINTNSTNLEEVFKLGNKVKSEVNKLYKLLEIDIDGVFKSLLLLKKKKYAALVVEPTSDGNYVTKQELKGLDIVRRDWCDLAKDTGNFVIGQILSDQSRDTIVENIQKRLIEIGENVLNGSVPVSQFEINKALTKDPQDYPDKKSLPHVHVALWINSQGGRKVKAGDTVSYVICQDGSNLTASQRAYAPEQLQKQDNLTIDTQYYLAQQIHPVVARICEPIDGIDAVLIATWLGLDPTQFRVHHYHKDEENDALLGGPAQLTDEEKYRDCERFKCPCPTCGTENIYDNVFDGSGTDMEPSLYRCSNIDCKASPLTFTVQLSNKLIMDIRRFIKKYYDGWLICEEPTCRNRTRHLPLQFSRTGPLCPACMKATLQPEYSDKSLYTQLCFYRYIFDAECALEKLTTDHEKDKLKKQFFTPKVLQDYRKLKNTAEQFLSRSGYSEVNLSKLFAGCAVKS",
"length": 1468,
"header": "tr|A6NMQ1-1|A6NMQ1_HUMAN Computationally mapped isoform of DNA polymerase OS=Homo sapiens OX=9606 GN=POLA1 PE=1 SV=1 CANONICAL=P09884-1"
},
"locus": {
"chromosome": "X",
"start_pos": 24995947,
"end_pos": 24693962,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000379068.8",
"url": "https://www.ensembl.org/id/ENST00000379068.8"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000368358.3",
"url": "https://www.ensembl.org/id/ENSP00000368358.3"
}
]
}
},
{
"isoform_ac": "P09884-1",
"url": "",
"sequence": {
"sequence": "MAPVHGDDSLSDSGSFVSSRARREKKSKKGRQEALERLKKAKAGEKYKYEVEDFTGVYEEVDEEQYSKLVQARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDADEKGKDGKARNKDKRNVKKLAVTKPNNIKSMFIACAGKKTADKAVDLSKDGLLGDILQDLNTETPQITPPPVMILKKKRSIGASPNPFSVHTATAVPSGKIASPVSRKEPPLTPVPLKRAEFAGDDVQVESTEEEQESGAMEFEDGDFDEPMEVEEVDLEPMAAKAWDKESEPAEEVKQEADSGKGTVSYLGSFLPDVSCWDIDQEGDSSFSVQEVQVDSSHLPLVKGADEEQVFHFYWLDAYEDQYNQPGVVFLFGKVWIESAETHVSCCVMVKNIERTLYFLPREMKIDLNTGKETGTPISMKDVYEEFDEKIATKYKIMKFKSKPVEKNYAFEIPDVPEKSEYLEVKYSAEMPQLPQDLKGETFSHVFGTNTSSLELFLMNRKIKGPCWLEVKSPQLLNQPVSWCKVEAMALKPDLVNVIKDVSPPPLVVMAFSMKTMQNAKNHQNEIIAMAALVHHSFALDKAAPKPPFQSHFCVVSKPKDCIFPYAFKEVIEKKNVKVEVAATERTLLGFFLAKVHKIDPDIIVGHNIYGFELEVLLQRINVCKAPHWSKIGRLKRSNMPKLGGRSGFGERNATCGRMICDVEISAKELIRCKSYHLSELVQQILKTERVVIPMENIQNMYSESSQLLYLLEHTWKDAKFILQIMCELNVLPLALQITNIAGNIMSRTLMGGRSERNEFLLLHAFYENNYIVPDKQIFRKPQQKLGDEDEEIDGDTNKYKKGRKKAAYAGGLVLDPKVGFYDKFILLLDFNSLYPSIIQEFNICFTTVQRVASEAQKVTEDGEQEQIPELPDPSLEMGILPREIRKLVERRKQVKQLMKQQDLNPDLILQYDIRQKALKLTANSMYGCLGFSYSRFYAKPLAALVTYKGREILMHTKEMVQKMNLEVIYGDTDSIMINTNSTNLEEVFKLGNKVKSEVNKLYKLLEIDIDGVFKSLLLLKKKKYAALVVEPTSDGNYVTKQELKGLDIVRRDWCDLAKDTGNFVIGQILSDQSRDTIVENIQKRLIEIGENVLNGSVPVSQFEINKALTKDPQDYPDKKSLPHVHVALWINSQGGRKVKAGDTVSYVICQDGSNLTASQRAYAPEQLQKQDNLTIDTQYYLAQQIHPVVARICEPIDGIDAVLIATWLGLDPTQFRVHHYHKDEENDALLGGPAQLTDEEKYRDCERFKCPCPTCGTENIYDNVFDGSGTDMEPSLYRCSNIDCKASPLTFTVQLSNKLIMDIRRFIKKYYDGWLICEEPTCRNRTRHLPLQFSRTGPLCPACMKATLQPEYSDKSLYTQLCFYRYIFDAECALEKLTTDHEKDKLKKQFFTPKVLQDYRKLKNTAEQFLSRSGYSEVNLSKLFAGCAVKS",
"length": 1462,
"header": "sp|P09884-1|DPOLA_HUMAN Isoform 1 of DNA polymerase alpha catalytic subunit OS=Homo sapiens OX=9606 GN=POLA1 PE=1 SV=2 CANONICAL=P09884-1"
},
"locus": {
"chromosome": "X",
"start_pos": 24995947,
"end_pos": 24693962,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000379059.7",
"url": "https://www.ensembl.org/id/ENST00000379059.7"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000368349.3",
"url": "https://www.ensembl.org/id/ENSP00000368349.3"
}
]
}
}
],
"glycosylation": [
{
"glytoucan_ac": "G49108TO",
"type": "O-linked",
"subtype": "O-GlcNAcylation",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "O-GlcNAcylation",
"evidence": [
{
"id": "P09884",
"database": "O-GlcNAc Database",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09884"
},
{
"id": "30379171",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30379171"
}
]
}
],
"phosphorylation": [
{
"start_pos": 129,
"end_pos": 129,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P09884",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09884"
},
{
"database": "PubMed",
"id": "19413330",
"url": "https://glygen.org/publication/PubMed/19413330"
}
],
"site_lbl": "Thr129"
},
{
"start_pos": 174,
"end_pos": 174,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "Phosphothreonine",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
},
{
"database": "PubMed",
"id": "20068231",
"url": "https://glygen.org/publication/PubMed/20068231"
},
{
"database": "PubMed",
"id": "19690332",
"url": "https://glygen.org/publication/PubMed/19690332"
},
{
"database": "iPTMnet",
"id": "P09884",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09884"
}
],
"site_lbl": "Thr174"
},
{
"start_pos": 186,
"end_pos": 186,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
},
{
"database": "PubMed",
"id": "18669648",
"url": "https://glygen.org/publication/PubMed/18669648"
},
{
"database": "PubMed",
"id": "20068231",
"url": "https://glygen.org/publication/PubMed/20068231"
},
{
"database": "PubMed",
"id": "23186163",
"url": "https://glygen.org/publication/PubMed/23186163"
},
{
"database": "PubMed",
"id": "21406692",
"url": "https://glygen.org/publication/PubMed/21406692"
},
{
"database": "PubMed",
"id": "19690332",
"url": "https://glygen.org/publication/PubMed/19690332"
},
{
"database": "iPTMnet",
"id": "P09884",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09884"
},
{
"database": "PubMed",
"id": "19651622",
"url": "https://glygen.org/publication/PubMed/19651622"
},
{
"database": "phospho.ELM",
"id": "P09884",
"url": "http://phospho.elm.eu.org/byAccession/P09884.html"
}
],
"site_lbl": "Ser186"
},
{
"start_pos": 190,
"end_pos": 190,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
},
{
"database": "PubMed",
"id": "18669648",
"url": "https://glygen.org/publication/PubMed/18669648"
},
{
"database": "PubMed",
"id": "20068231",
"url": "https://glygen.org/publication/PubMed/20068231"
},
{
"database": "PubMed",
"id": "23186163",
"url": "https://glygen.org/publication/PubMed/23186163"
},
{
"database": "iPTMnet",
"id": "P09884",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09884"
},
{
"database": "phospho.ELM",
"id": "P09884",
"url": "http://phospho.elm.eu.org/byAccession/P09884.html"
}
],
"site_lbl": "Ser190"
},
{
"start_pos": 195,
"end_pos": 195,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P09884",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09884"
},
{
"database": "PubMed",
"id": "20068231",
"url": "https://glygen.org/publication/PubMed/20068231"
}
],
"site_lbl": "Ser195"
},
{
"start_pos": 198,
"end_pos": 198,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P09884",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09884"
},
{
"database": "PubMed",
"id": "18669648",
"url": "https://glygen.org/publication/PubMed/18669648"
},
{
"database": "phospho.ELM",
"id": "P09884",
"url": "http://phospho.elm.eu.org/byAccession/P09884.html"
}
],
"site_lbl": "Thr198"
},
{
"start_pos": 209,
"end_pos": 209,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
},
{
"database": "PubMed",
"id": "18669648",
"url": "https://glygen.org/publication/PubMed/18669648"
},
{
"database": "PubMed",
"id": "20068231",
"url": "https://glygen.org/publication/PubMed/20068231"
},
{
"database": "PubMed",
"id": "23186163",
"url": "https://glygen.org/publication/PubMed/23186163"
},
{
"database": "PubMed",
"id": "21406692",
"url": "https://glygen.org/publication/PubMed/21406692"
},
{
"database": "iPTMnet",
"id": "P09884",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09884"
},
{
"database": "PubMed",
"id": "19007248",
"url": "https://glygen.org/publication/PubMed/19007248"
},
{
"database": "phospho.ELM",
"id": "P09884",
"url": "http://phospho.elm.eu.org/byAccession/P09884.html"
},
{
"database": "PubMed",
"id": "15302935",
"url": "https://glygen.org/publication/PubMed/15302935"
}
],
"site_lbl": "Ser209"
},
{
"start_pos": 212,
"end_pos": 212,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P09884",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09884"
},
{
"database": "PubMed",
"id": "20068231",
"url": "https://glygen.org/publication/PubMed/20068231"
}
],
"site_lbl": "Ser212"
},
{
"start_pos": 219,
"end_pos": 219,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P09884",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09884"
},
{
"database": "PubMed",
"id": "19413330",
"url": "https://glygen.org/publication/PubMed/19413330"
},
{
"database": "PubMed",
"id": "20068231",
"url": "https://glygen.org/publication/PubMed/20068231"
}
],
"site_lbl": "Thr219"
},
{
"start_pos": 406,
"end_pos": 406,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "Phosphothreonine",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
},
{
"database": "PubMed",
"id": "23186163",
"url": "https://glygen.org/publication/PubMed/23186163"
},
{
"database": "iPTMnet",
"id": "P09884",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09884"
}
],
"site_lbl": "Thr406"
}
],
"glycation": [],
"keywords": [
"enzyme",
"glycoprotein",
"glycoprotein_reported_with_glycan"
],
"publication": [
{
"title": "E2F mediates developmental and cell cycle regulation of ORC1 in Drosophila.",
"journal": "The EMBO journal",
"date": "1999",
"authors": "Asano M, Wharton RP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205"
}
],
"reference": [
{
"type": "PubMed",
"id": "10228158",
"url": "https://glygen.org/publication/PubMed/10228158"
}
]
},
{
"title": "Characterization of telomere-binding activity of replication factor C large subunit p140.",
"journal": "Biochemical and biophysical research communications",
"date": "1999",
"authors": "Uchiumi F, Watanabe M, Tanuma Si",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-174411",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174411"
}
],
"reference": [
{
"type": "PubMed",
"id": "10329413",
"url": "https://glygen.org/publication/PubMed/10329413"
}
]
},
{
"title": "A novel growth- and cell cycle-regulated protein, ASK, activates human Cdc7-related kinase and is essential for G1/S transition in mammalian cells.",
"journal": "Molecular and cellular biology",
"date": "1999",
"authors": "Kumagai H, Sato N, Yamada M, Mahony D, Seghezzi W, Lees E, Arai K, Masai H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-68962",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68962"
}
],
"reference": [
{
"type": "PubMed",
"id": "10373557",
"url": "https://glygen.org/publication/PubMed/10373557"
}
]
},
{
"title": "CDC25A phosphatase is a target of E2F and is required for efficient E2F-induced S phase.",
"journal": "Molecular and cellular biology",
"date": "1999",
"authors": "Vigo E, Muller H, Prosperini E, Hateboer G, Cartwright P, Moroni MC, Helin K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205"
}
],
"reference": [
{
"type": "PubMed",
"id": "10454584",
"url": "https://glygen.org/publication/PubMed/10454584"
}
]
},
{
"title": "Human CDC45 protein binds to minichromosome maintenance 7 protein and the p70 subunit of DNA polymerase alpha.",
"journal": "European journal of biochemistry",
"date": "1999",
"authors": "Kukimoto I, Igaki H, Kanda T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-68962",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68962"
}
],
"reference": [
{
"type": "PubMed",
"id": "10518787",
"url": "https://glygen.org/publication/PubMed/10518787"
}
]
},
{
"title": "Mammalian Cdc7-Dbf4 protein kinase complex is essential for initiation of DNA replication.",
"journal": "The EMBO journal",
"date": "1999",
"authors": "Jiang W, McDonald D, Hope TJ, Hunter T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-68962",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68962"
}
],
"reference": [
{
"type": "PubMed",
"id": "10523313",
"url": "https://glygen.org/publication/PubMed/10523313"
}
]
},
{
"title": "Association of Pur alpha and E2F-1 suppresses transcriptional activity of E2F-1.",
"journal": "Oncogene",
"date": "1999",
"authors": "Darbinian N, Gallia GL, Kundu M, Shcherbik N, Tretiakova A, Giordano A, Khalili K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205"
}
],
"reference": [
{
"type": "PubMed",
"id": "10597240",
"url": "https://glygen.org/publication/PubMed/10597240"
}
]
},
{
"title": "DNA polymerase switching: I. Replication factor C displaces DNA polymerase alpha prior to PCNA loading.",
"journal": "Journal of molecular biology",
"date": "2000",
"authors": "Maga G, Stucki M, Spadari S, Hubscher U",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69091",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69091"
}
],
"reference": [
{
"type": "PubMed",
"id": "10656791",
"url": "https://glygen.org/publication/PubMed/10656791"
}
]
},
{
"title": "DNA polymerase switching: II. Replication factor C abrogates primer synthesis by DNA polymerase alpha at a critical length.",
"journal": "Journal of molecular biology",
"date": "2000",
"authors": "Mossi R, Keller RC, Ferrari E, Hubscher U",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69091",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69091"
}
],
"reference": [
{
"type": "PubMed",
"id": "10656792",
"url": "https://glygen.org/publication/PubMed/10656792"
}
]
},
{
"title": "Cdk2-dependent and -independent pathways in E2F-mediated S phase induction.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Arata Y, Fujita M, Ohtani K, Kijima S, Kato JY",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205"
}
],
"reference": [
{
"type": "PubMed",
"id": "10692433",
"url": "https://glygen.org/publication/PubMed/10692433"
}
]
},
{
"title": "Identification of a fourth subunit of mammalian DNA polymerase delta.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Liu L, Mo J, Rodriguez-Belmonte EM, Lee MY",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69091",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69091"
}
],
"reference": [
{
"type": "PubMed",
"id": "10751307",
"url": "https://glygen.org/publication/PubMed/10751307"
}
]
},
{
"title": "Assembly of a complex containing Cdc45p, replication protein A, and Mcm2p at replication origins controlled by S-phase cyclin-dependent kinases and Cdc7p-Dbf4p kinase.",
"journal": "Molecular and cellular biology",
"date": "2000",
"authors": "Zou L, Stillman B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-68962",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68962"
}
],
"reference": [
{
"type": "PubMed",
"id": "10757793",
"url": "https://glygen.org/publication/PubMed/10757793"
}
]
},
{
"title": "Human Cdc7-related kinase complex. In vitro phosphorylation of MCM by concerted actions of Cdks and Cdc7 and that of a criticial threonine residue of Cdc7 bY Cdks.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Masai H, Matsui E, You Z, Ishimi Y, Tamai K, Arai K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-68962",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68962"
}
],
"reference": [
{
"type": "PubMed",
"id": "10846177",
"url": "https://glygen.org/publication/PubMed/10846177"
}
]
},
{
"title": "Initiation of eukaryotic DNA replication: origin unwinding and sequential chromatin association of Cdc45, RPA, and DNA polymerase alpha.",
"journal": "Molecular cell",
"date": "2000",
"authors": "Walter J, Newport J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-68962",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68962"
}
],
"reference": [
{
"type": "PubMed",
"id": "10882098",
"url": "https://glygen.org/publication/PubMed/10882098"
}
]
},
{
"title": "RB-dependent S-phase response to DNA damage.",
"journal": "Molecular and cellular biology",
"date": "2000",
"authors": "Knudsen KE, Booth D, Naderi S, Sever-Chroneos Z, Fribourg AF, Hunton IC, Feramisco JR, Wang JY, Knudsen ES",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-113501",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-113501"
}
],
"reference": [
{
"type": "PubMed",
"id": "11003670",
"url": "https://glygen.org/publication/PubMed/11003670"
}
]
},
{
"title": "The human homolog of Saccharomyces cerevisiae Mcm10 interacts with replication factors and dissociates from nuclease-resistant nuclear structures in G(2) phase.",
"journal": "Nucleic acids research",
"date": "2000",
"authors": "Izumi M, Yanagi K, Mizuno T, Yokoi M, Kawasaki Y, Moon KY, Hurwitz J, Yatagai F, Hanaoka F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-68962",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68962"
}
],
"reference": [
{
"type": "PubMed",
"id": "11095689",
"url": "https://glygen.org/publication/PubMed/11095689"
}
]
},
{
"title": "Inhibition of eukaryotic DNA replication by geminin binding to Cdt1.",
"journal": "Science (New York, N.Y.)",
"date": "2000",
"authors": "Wohlschlegel JA, Dwyer BT, Dhar SK, Cvetic C, Walter JC, Dutta A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-68962",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68962"
}
],
"reference": [
{
"type": "PubMed",
"id": "11125146",
"url": "https://glygen.org/publication/PubMed/11125146"
}
]
},
{
"title": "RPA governs endonuclease switching during processing of Okazaki fragments in eukaryotes.",
"journal": "Nature",
"date": "2001",
"authors": "Bae SH, Bae KH, Kim JA, Seo YS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69166"
}
],
"reference": [
{
"type": "PubMed",
"id": "11473323",
"url": "https://glygen.org/publication/PubMed/11473323"
}
]
},
{
"title": "Okazaki fragment processing: modulation of the strand displacement activity of DNA polymerase delta by the concerted action of replication protein A, proliferating cell nuclear antigen, and flap endonuclease-1.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2001",
"authors": "Maga G, Villani G, Tillement V, Stucki M, Locatelli GA, Frouin I, Spadari S, Hubscher U",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69166"
}
],
"reference": [
{
"type": "PubMed",
"id": "11724925",
"url": "https://glygen.org/publication/PubMed/11724925"
}
]
},
{
"title": "E2F mediates cell cycle-dependent transcriptional repression in vivo by recruitment of an HDAC1/mSin3B corepressor complex.",
"journal": "Genes & development",
"date": "2002",
"authors": "Rayman JB, Takahashi Y, Indjeian VB, Dannenberg JH, Catchpole S, Watson RJ, te Riele H, Dynlacht BD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205"
}
],
"reference": [
{
"type": "PubMed",
"id": "11959842",
"url": "https://glygen.org/publication/PubMed/11959842"
}
]
},
{
"title": "E2F-dependent accumulation of hEmi1 regulates S phase entry by inhibiting APC(Cdh1).",
"journal": "Nature cell biology",
"date": "2002",
"authors": "Hsu JY, Reimann JD, Sorensen CS, Lukas J, Jackson PK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205"
}
],
"reference": [
{
"type": "PubMed",
"id": "11988738",
"url": "https://glygen.org/publication/PubMed/11988738"
}
]
},
{
"title": "DNA replication in eukaryotic cells.",
"journal": "Annual review of biochemistry",
"date": "2002",
"authors": "Bell SP, Dutta A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-68962",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68962"
}
],
"reference": [
{
"type": "PubMed",
"id": "12045100",
"url": "https://glygen.org/publication/PubMed/12045100"
}
]
},
{
"title": "Cloning and characterization of hCTF18, hCTF8, and hDCC1. Human homologs of a Saccharomyces cerevisiae complex involved in sister chromatid cohesion establishment.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Merkle CJ, Karnitz LM, Henry-Sanchez JT, Chen J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-174411",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174411"
}
],
"reference": [
{
"type": "PubMed",
"id": "12766176",
"url": "https://glygen.org/publication/PubMed/12766176"
}
]
},
{
"title": "An E2F site in the 5'-promoter region contributes to serum-dependent up-regulation of the human proliferating cell nuclear antigen gene.",
"journal": "FEBS letters",
"date": "2003",
"authors": "Li YY, Wang L, Lu CD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205"
}
],
"reference": [
{
"type": "PubMed",
"id": "12782299",
"url": "https://glygen.org/publication/PubMed/12782299"
}
]
},
{
"title": "The alternative Ctf18-Dcc1-Ctf8-replication factor C complex required for sister chromatid cohesion loads proliferating cell nuclear antigen onto DNA.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2003",
"authors": "Bermudez VP, Maniwa Y, Tappin I, Ozato K, Yokomori K, Hurwitz J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-174411",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174411"
}
],
"reference": [
{
"type": "PubMed",
"id": "12930902",
"url": "https://glygen.org/publication/PubMed/12930902"
}
]
},
{
"title": "Assembly of simian virus 40 Okazaki pieces from DNA primers is reversibly arrested by ATP depletion.",
"journal": "Journal of virology",
"date": "1992",
"authors": "Nethanel T, Zlotkin T, Kaufmann G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69183",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69183"
}
],
"reference": [
{
"type": "PubMed",
"id": "1328683",
"url": "https://glygen.org/publication/PubMed/1328683"
}
]
},
{
"title": "Nuclear magnetic resonance structures of the zinc finger domain of human DNA polymerase-alpha.",
"journal": "Biochim. Biophys. Acta",
"date": "2003",
"authors": "Evanics Ferenc, Maurmann Leila, Yang Wei Wen, Bose Rathindra N",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"reference": [
{
"type": "PubMed",
"id": "14499601",
"url": "https://glygen.org/publication/PubMed/14499601"
}
]
},
{
"title": "Active localization of the retinoblastoma protein in chromatin and its response to S phase DNA damage.",
"journal": "Molecular cell",
"date": "2003",
"authors": "Avni D, Yang H, Martelli F, Hofmann F, ElShamy WM, Ganesan S, Scully R, Livingston DM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-113501",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-113501"
}
],
"reference": [
{
"type": "PubMed",
"id": "14527418",
"url": "https://glygen.org/publication/PubMed/14527418"
}
]
},
{
"title": "Primer utilization by DNA polymerase alpha-primase is influenced by its interaction with Mcm10p.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Fien K, Cho YS, Lee JK, Raychaudhuri S, Tappin I, Hurwitz J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-113501",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-113501"
}
],
"reference": [
{
"type": "PubMed",
"id": "14766746",
"url": "https://glygen.org/publication/PubMed/14766746"
}
]
},
{
"title": "Regulation of Geminin and Cdt1 expression by E2F transcription factors.",
"journal": "Oncogene",
"date": "2004",
"authors": "Yoshida K, Inoue I",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205"
}
],
"reference": [
{
"type": "PubMed",
"id": "14990995",
"url": "https://glygen.org/publication/PubMed/14990995"
}
]
},
{
"title": "Combinatorial gene control involving E2F and E Box family members.",
"journal": "The EMBO journal",
"date": "2004",
"authors": "Giangrande PH, Zhu W, Rempel RE, Laakso N, Nevins JR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205"
}
],
"reference": [
{
"type": "PubMed",
"id": "15014447",
"url": "https://glygen.org/publication/PubMed/15014447"
}
]
},
{
"title": "The reconstituted human Chl12-RFC complex functions as a second PCNA loader.",
"journal": "Genes to cells : devoted to molecular & cellular mechanisms",
"date": "2004",
"authors": "Shiomi Y, Shinozaki A, Sugimoto K, Usukura J, Obuse C, Tsurimoto T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-174411",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174411"
}
],
"reference": [
{
"type": "PubMed",
"id": "15066120",
"url": "https://glygen.org/publication/PubMed/15066120"
}
]
},
{
"title": "Large-scale characterization of HeLa cell nuclear phosphoproteins.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2004",
"authors": "Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP",
"evidence": [
{
"database": "iPTMnet",
"id": "P09884",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09884"
}
],
"reference": [
{
"type": "PubMed",
"id": "15302935",
"url": "https://glygen.org/publication/PubMed/15302935"
}
]
},
{
"title": "E2Fs link the control of G1/S and G2/M transcription.",
"journal": "The EMBO journal",
"date": "2004",
"authors": "Zhu W, Giangrande PH, Nevins JR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205"
}
],
"reference": [
{
"type": "PubMed",
"id": "15510213",
"url": "https://glygen.org/publication/PubMed/15510213"
}
]
},
{
"title": "Alterations of DNA and chromatin structures at telomeres and genetic instability in mouse cells defective in DNA polymerase alpha.",
"journal": "Molecular and cellular biology",
"date": "2005",
"authors": "Nakamura M, Nabetani A, Mizuno T, Hanaoka F, Ishikawa F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-174430",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174430"
}
],
"reference": [
{
"type": "PubMed",
"id": "16314528",
"url": "https://glygen.org/publication/PubMed/16314528"
}
]
},
{
"title": "Replication factors required for SV40 DNA replication in vitro. II. Switching of DNA polymerase alpha and delta during initiation of leading and lagging strand synthesis.",
"journal": "The Journal of biological chemistry",
"date": "1991",
"authors": "Tsurimoto T, Stillman B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69091",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69091"
}
],
"reference": [
{
"type": "PubMed",
"id": "1671046",
"url": "https://glygen.org/publication/PubMed/1671046"
}
]
},
{
"title": "Saccharomyces cerevisiae replication factor C. II. Formation and activity of complexes with the proliferating cell nuclear antigen and with DNA polymerases delta and epsilon.",
"journal": "The Journal of biological chemistry",
"date": "1991",
"authors": "Burgers PM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69091",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69091"
}
],
"reference": [
{
"type": "PubMed",
"id": "1682322",
"url": "https://glygen.org/publication/PubMed/1682322"
}
]
},
{
"title": "Human Mcm10 regulates the catalytic subunit of DNA polymerase-alpha and prevents DNA damage during replication.",
"journal": "Molecular biology of the cell",
"date": "2007",
"authors": "Chattopadhyay S, Bielinsky AK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-113501",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-113501"
}
],
"reference": [
{
"type": "PubMed",
"id": "17699597",
"url": "https://glygen.org/publication/PubMed/17699597"
}
]
},
{
"title": "Protein phosphatase 2A subunit PR70 interacts with pRb and mediates its dephosphorylation.",
"journal": "Molecular and cellular biology",
"date": "2008",
"authors": "Magenta A, Fasanaro P, Romani S, Di Stefano V, Capogrossi MC, Martelli F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-113501",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-113501"
}
],
"reference": [
{
"type": "PubMed",
"id": "17991896",
"url": "https://glygen.org/publication/PubMed/17991896"
}
]
},
{
"title": "Aberrant promoter methylation and tumor suppressive activity of the DFNA5 gene in colorectal carcinoma.",
"journal": "Oncogene",
"date": "2008",
"authors": "Kim MS, Chang X, Yamashita K, Nagpal JK, Baek JH, Wu G, Trink B, Ratovitski EA, Mori M, Sidransky D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9710421",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9710421"
}
],
"reference": [
{
"type": "PubMed",
"id": "18223688",
"url": "https://glygen.org/publication/PubMed/18223688"
}
]
},
{
"title": "Methylation of the DFNA5 increases risk of lymph node metastasis in human breast cancer.",
"journal": "Biochemical and biophysical research communications",
"date": "2008",
"authors": "Kim MS, Lebron C, Nagpal JK, Chae YK, Chang X, Huang Y, Chuang T, Yamashita K, Trink B, Ratovitski EA, Califano JA, Sidransky D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9710421",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9710421"
}
],
"reference": [
{
"type": "PubMed",
"id": "18346456",
"url": "https://glygen.org/publication/PubMed/18346456"
}
]
},
{
"title": "A quantitative atlas of mitotic phosphorylation.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2008",
"authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
},
{
"database": "iPTMnet",
"id": "P09884",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09884"
}
],
"reference": [
{
"type": "PubMed",
"id": "18669648",
"url": "https://glygen.org/publication/PubMed/18669648"
}
]
},
{
"title": "Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis.",
"journal": "Analytical chemistry",
"date": "2008",
"authors": "Wang B, Malik R, Nigg EA, Korner R",
"evidence": [
{
"database": "iPTMnet",
"id": "P09884",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09884"
}
],
"reference": [
{
"type": "PubMed",
"id": "19007248",
"url": "https://glygen.org/publication/PubMed/19007248"
}
]
},
{
"title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.",
"journal": "Analytical chemistry",
"date": "2009",
"authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S",
"evidence": [
{
"database": "iPTMnet",
"id": "P09884",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09884"
}
],
"reference": [
{
"type": "PubMed",
"id": "19413330",
"url": "https://glygen.org/publication/PubMed/19413330"
}
]
},
{
"title": "Physical interactions between Mcm10, DNA, and DNA polymerase alpha.",
"journal": "J. Biol. Chem.",
"date": "2009",
"authors": "Warren Eric M, Huang Hao, Fanning Ellen, Chazin Walter J, Eichman Brandt F",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"reference": [
{
"type": "PubMed",
"id": "19608746",
"url": "https://glygen.org/publication/PubMed/19608746"
}
]
},
{
"title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.",
"journal": "Molecular & cellular proteomics : MCP",
"date": "2009",
"authors": "Pan C, Olsen JV, Daub H, Mann M",
"evidence": [
{
"database": "iPTMnet",
"id": "P09884",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09884"
}
],
"reference": [
{
"type": "PubMed",
"id": "19651622",
"url": "https://glygen.org/publication/PubMed/19651622"
}
]
},
{
"title": "A key role for Ctf4 in coupling the MCM2-7 helicase to DNA polymerase alpha within the eukaryotic replisome.",
"journal": "The EMBO journal",
"date": "2009",
"authors": "Gambus A, van Deursen F, Polychronopoulos D, Foltman M, Jones RC, Edmondson RD, Calzada A, Labib K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-113501",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-113501"
}
],
"reference": [
{
"type": "PubMed",
"id": "19661920",
"url": "https://glygen.org/publication/PubMed/19661920"
}
]
},
{
"title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.",
"journal": "Science signaling",
"date": "2009",
"authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
},
{
"database": "iPTMnet",
"id": "P09884",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09884"
}
],
"reference": [
{
"type": "PubMed",
"id": "19690332",
"url": "https://glygen.org/publication/PubMed/19690332"
}
]
},
{
"title": "Mechanism of elongation of primed DNA by DNA polymerase delta, proliferating cell nuclear antigen, and activator 1.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1990",
"authors": "Lee SH, Hurwitz J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-174411",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174411"
}
],
"reference": [
{
"type": "PubMed",
"id": "1974050",
"url": "https://glygen.org/publication/PubMed/1974050"
}
]
},
{
"title": "RPA-like mammalian Ctc1-Stn1-Ten1 complex binds to single-stranded DNA and protects telomeres independently of the Pot1 pathway.",
"journal": "Molecular cell",
"date": "2009",
"authors": "Miyake Y, Nakamura M, Nabetani A, Shimamura S, Tamura M, Yonehara S, Saito M, Ishikawa F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-174430",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174430"
}
],
"reference": [
{
"type": "PubMed",
"id": "19854130",
"url": "https://glygen.org/publication/PubMed/19854130"
}
]
},
{
"title": "Concerted loading of Mcm2-7 double hexamers around DNA during DNA replication origin licensing.",
"journal": "Cell",
"date": "2009",
"authors": "Remus D, Beuron F, Tolun G, Griffith JD, Morris EP, Diffley JF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-113501",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-113501"
}
],
"reference": [
{
"type": "PubMed",
"id": "19896182",
"url": "https://glygen.org/publication/PubMed/19896182"
}
]
},
{
"title": "Human DNA polymerase alpha gene: sequences controlling expression in cycling and serum-stimulated cells.",
"journal": "Mol. Cell. Biol.",
"date": "1991",
"authors": "Pearson B E, Nasheuer H P, Wang T S",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"reference": [
{
"type": "PubMed",
"id": "2005899",
"url": "https://glygen.org/publication/PubMed/2005899"
}
]
},
{
"title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.",
"journal": "Science signaling",
"date": "2010",
"authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
},
{
"database": "iPTMnet",
"id": "P09884",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09884"
}
],
"reference": [
{
"type": "PubMed",
"id": "20068231",
"url": "https://glygen.org/publication/PubMed/20068231"
}
]
},
{
"title": "Molecular steps of G-overhang generation at human telomeres and its function in chromosome end protection.",
"journal": "The EMBO journal",
"date": "2010",
"authors": "Dai X, Huang C, Bhusari A, Sampathi S, Schubert K, Chai W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-174430",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174430"
}
],
"reference": [
{
"type": "PubMed",
"id": "20639858",
"url": "https://glygen.org/publication/PubMed/20639858"
}
]
},
{
"title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.",
"journal": "Science signaling",
"date": "2011",
"authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
},
{
"database": "iPTMnet",
"id": "P09884",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09884"
}
],
"reference": [
{
"type": "PubMed",
"id": "21406692",
"url": "https://glygen.org/publication/PubMed/21406692"
}
]
},
{
"title": "Sequential initiation of lagging and leading strand synthesis by two different polymerase complexes at the SV40 DNA replication origin.",
"journal": "Nature",
"date": "1990",
"authors": "Tsurimoto T, Melendy T, Stillman B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69091",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69091"
}
],
"reference": [
{
"type": "PubMed",
"id": "2165567",
"url": "https://glygen.org/publication/PubMed/2165567"
}
]
},
{
"title": "Human DNA polymerase alpha catalytic polypeptide binds ConA and RCA and contains a specific labile site in the N-terminus.",
"journal": "Nucleic acids research",
"date": "1990",
"authors": "Hsi KL, Copeland WC, Wang TS",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"reference": [
{
"type": "PubMed",
"id": "2243771",
"url": "https://glygen.org/publication/PubMed/2243771"
}
]
},
{
"title": "CDK1 differentially regulates G-overhang generation at leading- and lagging-strand telomeres in telomerase-negative cells in G2 phase.",
"journal": "Cell cycle (Georgetown, Tex.)",
"date": "2012",
"authors": "Dai X, Huang C, Chai W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-174430",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174430"
}
],
"reference": [
{
"type": "PubMed",
"id": "22871736",
"url": "https://glygen.org/publication/PubMed/22871736"
}
]
},
{
"title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.",
"journal": "Journal of proteome research",
"date": "2013",
"authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
},
{
"database": "iPTMnet",
"id": "P09884",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09884"
}
],
"reference": [
{
"type": "PubMed",
"id": "23186163",
"url": "https://glygen.org/publication/PubMed/23186163"
}
]
},
{
"title": "DNA polymerase delta stalls on telomeric lagging strand templates independently from G-quadruplex formation.",
"journal": "Nucleic acids research",
"date": "2013",
"authors": "Lormand JD, Buncher N, Murphy CT, Kaur P, Lee MY, Burgers P, Wang H, Kunkel TA, Opresko PL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-174411",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174411"
}
],
"reference": [
{
"type": "PubMed",
"id": "24038470",
"url": "https://glygen.org/publication/PubMed/24038470"
}
]
},
{
"title": "RTEL1 is a replisome-associated helicase that promotes telomere and genome-wide replication.",
"journal": "Science (New York, N.Y.)",
"date": "2013",
"authors": "Vannier JB, Sandhu S, Petalcorin MI, Wu X, Nabi Z, Ding H, Boulton SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-174411",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174411"
}
],
"reference": [
{
"type": "PubMed",
"id": "24115439",
"url": "https://glygen.org/publication/PubMed/24115439"
}
]
},
{
"title": "Geminin inhibits a late step in the formation of human pre-replicative complexes.",
"journal": "The Journal of biological chemistry",
"date": "2014",
"authors": "Wu M, Lu W, Santos RE, Frattini MG, Kelly TJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-68962",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68962"
}
],
"reference": [
{
"type": "PubMed",
"id": "25231993",
"url": "https://glygen.org/publication/PubMed/25231993"
}
]
},
{
"title": "Mechanism of Concerted RNA-DNA Primer Synthesis by the Human Primosome.",
"journal": "The Journal of biological chemistry",
"date": "2016",
"authors": "Baranovskiy AG, Babayeva ND, Zhang Y, Gu J, Suwa Y, Pavlov YI, Tahirov TH",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"reference": [
{
"type": "PubMed",
"id": "26975377",
"url": "https://glygen.org/publication/PubMed/26975377"
}
]
},
{
"title": "DNA polymerase-alpha regulates the activation of type I interferons through cytosolic RNA:DNA synthesis.",
"journal": "Nature immunology",
"date": "2016",
"authors": "Starokadomskyy P, Gemelli T, Rios JJ, Xing C, Wang RC, Li H, Pokatayev V, Dozmorov I, Khan S, Miyata N, Fraile G, Raj P, Xu Z, Xu Z, Ma L, Lin Z, Wang H, Yang Y, Ben-Amitai D, Orenstein N, Mussaffi H, Baselga E, Tadini G, Grunebaum E, Sarajlija A, Krzewski K, Wakeland EK, Yan N, de la Morena MT, Zinn AR, Burstein E",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"reference": [
{
"type": "PubMed",
"id": "27019227",
"url": "https://glygen.org/publication/PubMed/27019227"
}
]
},
{
"title": "CTC1-mediated C-strand fill-in is an essential step in telomere length maintenance.",
"journal": "Nucleic acids research",
"date": "2017",
"authors": "Feng X, Hsu SJ, Kasbek C, Chaiken M, Price CM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-174430",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174430"
}
],
"reference": [
{
"type": "PubMed",
"id": "28334750",
"url": "https://glygen.org/publication/PubMed/28334750"
}
]
},
{
"title": "Functional monosomy of 6q27-qter and functional disomy of Xpter-p22.11 due to X;6 translocation with an atypical X-inactivation pattern.",
"journal": "American journal of medical genetics. Part A",
"date": "2017",
"authors": "Podolska A, Kobelt A, Fuchs S, Hackmann K, Rump A, Schrock E, Kutsche K, Di Donato N",
"evidence": [
{
"database": "RefSeq",
"id": "NP_058633",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_058633"
}
],
"reference": [
{
"type": "PubMed",
"id": "28371302",
"url": "https://glygen.org/publication/PubMed/28371302"
}
]
},
{
"title": "DFNA5 promoter methylation a marker for breast tumorigenesis.",
"journal": "Oncotarget",
"date": "2017",
"authors": "Croes L, de Beeck KO, Pauwels P, Vanden Berghe W, Peeters M, Fransen E, Van Camp G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9710421",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9710421"
}
],
"reference": [
{
"type": "PubMed",
"id": "28404884",
"url": "https://glygen.org/publication/PubMed/28404884"
}
]
},
{
"title": "Activity and fidelity of human DNA polymerase alpha depend on primer structure.",
"journal": "The Journal of biological chemistry",
"date": "2018",
"authors": "Baranovskiy AG, Duong VN, Babayeva ND, Zhang Y, Pavlov YI, Anderson KS, Tahirov TH",
"evidence": [
{
"database": "RefSeq",
"id": "NP_058633",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_058633"
}
],
"reference": [
{
"type": "PubMed",
"id": "29555682",
"url": "https://glygen.org/publication/PubMed/29555682"
}
]
},
{
"title": "CTC1-STN1 coordinates G- and C-strand synthesis to regulate telomere length.",
"journal": "Aging cell",
"date": "2018",
"authors": "Gu P, Jia S, Takasugi T, Smith E, Nandakumar J, Hendrickson E, Chang S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-174430",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174430"
}
],
"reference": [
{
"type": "PubMed",
"id": "29774655",
"url": "https://glygen.org/publication/PubMed/29774655"
}
]
},
{
"title": "CTC1-STN1 terminates telomerase while STN1-TEN1 enables C-strand synthesis during telomere replication in colon cancer cells.",
"journal": "Nature communications",
"date": "2018",
"authors": "Feng X, Hsu SJ, Bhattacharjee A, Wang Y, Diao J, Price CM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-174430",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174430"
}
],
"reference": [
{
"type": "PubMed",
"id": "30026550",
"url": "https://glygen.org/publication/PubMed/30026550"
}
]
},
{
"title": "T-antigen-DNA polymerase alpha complex implicated in simian virus 40 DNA replication.",
"journal": "Mol. Cell. Biol.",
"date": "1986",
"authors": "Smale S T, Tjian R",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"reference": [
{
"type": "PubMed",
"id": "3025630",
"url": "https://glygen.org/publication/PubMed/3025630"
}
]
},
{
"title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.",
"journal": "Chemical communications (Cambridge, England)",
"date": "2018",
"authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P09884",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09884"
}
],
"reference": [
{
"type": "PubMed",
"id": "30379171",
"url": "https://glygen.org/publication/PubMed/30379171"
}
]
},
{
"title": "Methylation analysis of Gasdermin E shows great promise as a biomarker for colorectal cancer.",
"journal": "Cancer medicine",
"date": "2019",
"authors": "Ibrahim J, Op de Beeck K, Fransen E, Croes L, Beyens M, Suls A, Vanden Berghe W, Peeters M, Van Camp G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9710421",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9710421"
}
],
"reference": [
{
"type": "PubMed",
"id": "30993897",
"url": "https://glygen.org/publication/PubMed/30993897"
}
]
},
{
"title": "Defective DNA Polymerase alpha-Primase Leads to X-Linked Intellectual Disability Associated with Severe Growth Retardation, Microcephaly, and Hypogonadism.",
"journal": "American journal of human genetics",
"date": "2019",
"authors": "Van Esch H, Colnaghi R, Freson K, Starokadomskyy P, Zankl A, Backx L, Abramowicz I, Outwin E, Rohena L, Faulkner C, Leong GM, Newbury-Ecob RA, Challis RC, Ounap K, Jaeken J, Seuntjens E, Devriendt K, Burstein E, Low KJ, O'Driscoll M",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
},
{
"database": "RefSeq",
"id": "NP_058633",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_058633"
}
],
"reference": [
{
"type": "PubMed",
"id": "31006512",
"url": "https://glygen.org/publication/PubMed/31006512"
}
]
},
{
"title": "Gasdermin E suppresses tumour growth by activating anti-tumour immunity.",
"journal": "Nature",
"date": "2020",
"authors": "Zhang Z, Zhang Y, Xia S, Kong Q, Li S, Liu X, Junqueira C, Meza-Sosa KF, Mok TMY, Ansara J, Sengupta S, Yao Y, Wu H, Lieberman J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9710421",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9710421"
}
],
"reference": [
{
"type": "PubMed",
"id": "32188940",
"url": "https://glygen.org/publication/PubMed/32188940"
}
]
},
{
"title": "Human DNA polymerase alpha gene expression is cell proliferation dependent and its primary structure is similar to both prokaryotic and eukaryotic replicative DNA polymerases.",
"journal": "EMBO J.",
"date": "1988",
"authors": "Wong S W, Wahl A F, Yuan P M, Arai N, Pearson B E, Arai K, Korn D, Hunkapiller M W, Wang T S",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"reference": [
{
"type": "PubMed",
"id": "3359994",
"url": "https://glygen.org/publication/PubMed/3359994"
}
]
},
{
"title": "Pol alpha-primase dependent nuclear localization of the mammalian CST complex.",
"journal": "Communications biology",
"date": "2021",
"authors": "Kelich JM, Papaioannou H, Skordalakes E",
"evidence": [
{
"database": "RefSeq",
"id": "NP_058633",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_058633"
}
],
"reference": [
{
"type": "PubMed",
"id": "33731801",
"url": "https://glygen.org/publication/PubMed/33731801"
}
]
},
{
"title": "Small tandem DNA duplications result from CST-guided Pol alpha-primase action at DNA break termini.",
"journal": "Nature communications",
"date": "2021",
"authors": "Schimmel J, Munoz-Subirana N, Kool H, van Schendel R, Tijsterman M",
"evidence": [
{
"database": "RefSeq",
"id": "NP_058633",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_058633"
}
],
"reference": [
{
"type": "PubMed",
"id": "34376693",
"url": "https://glygen.org/publication/PubMed/34376693"
}
]
},
{
"title": "Purification of a DNA polymerase-DNA primase complex from calf thymus glands.",
"journal": "The Journal of biological chemistry",
"date": "1984",
"authors": "Chang LM, Rafter E, Augl C, Bollum FJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-68952",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68952"
}
],
"reference": [
{
"type": "PubMed",
"id": "6094569",
"url": "https://glygen.org/publication/PubMed/6094569"
}
]
},
{
"title": "DNA primase from KB cells. Characterization of a primase activity tightly associated with immunoaffinity-purified DNA polymerase-alpha.",
"journal": "The Journal of biological chemistry",
"date": "1984",
"authors": "Wang TS, Hu SZ, Korn D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-174430",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174430"
}
],
"reference": [
{
"type": "PubMed",
"id": "6693436",
"url": "https://glygen.org/publication/PubMed/6693436"
}
]
},
{
"title": "Purification of deoxyribonucleic acid polymerase delta from calf thymus: partial characterization of physical properties.",
"journal": "Biochemistry",
"date": "1980",
"authors": "Lee MY, Tan CK, So AG, Downey KM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69091",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69091"
}
],
"reference": [
{
"type": "PubMed",
"id": "7378348",
"url": "https://glygen.org/publication/PubMed/7378348"
}
]
},
{
"title": "Cellular targets for activation by the E2F1 transcription factor include DNA synthesis- and G1/S-regulatory genes.",
"journal": "Molecular and cellular biology",
"date": "1995",
"authors": "DeGregori J, Kowalik T, Nevins JR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205"
}
],
"reference": [
{
"type": "PubMed",
"id": "7623816",
"url": "https://glygen.org/publication/PubMed/7623816"
}
]
},
{
"title": "Interaction of herpes simplex virus 1 origin-binding protein with DNA polymerase alpha.",
"journal": "Proc. Natl. Acad. Sci. U.S.A.",
"date": "1995",
"authors": "Lee S S, Dong Q, Wang T S, Lehman I R",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"reference": [
{
"type": "PubMed",
"id": "7644508",
"url": "https://glygen.org/publication/PubMed/7644508"
}
]
},
{
"title": "DNA polymerase delta holoenzyme: action on single-stranded DNA and on double-stranded DNA in the presence of replicative DNA helicases.",
"journal": "Biochemistry",
"date": "1995",
"authors": "Podust VN, Podust LM, Muller F, Hubscher U",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69166"
}
],
"reference": [
{
"type": "PubMed",
"id": "7711022",
"url": "https://glygen.org/publication/PubMed/7711022"
}
]
},
{
"title": "A conserved region in the amino terminus of DNA polymerase delta is involved in proliferating cell nuclear antigen binding.",
"journal": "The Journal of biological chemistry",
"date": "1995",
"authors": "Zhang SJ, Zeng XR, Zhang P, Toomey NL, Chuang RY, Chang LS, Lee MY",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69091",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69091"
}
],
"reference": [
{
"type": "PubMed",
"id": "7713898",
"url": "https://glygen.org/publication/PubMed/7713898"
}
]
},
{
"title": "DNA structural elements required for FEN-1 binding.",
"journal": "The Journal of biological chemistry",
"date": "1995",
"authors": "Harrington JJ, Lieber MR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69166"
}
],
"reference": [
{
"type": "PubMed",
"id": "7876218",
"url": "https://glygen.org/publication/PubMed/7876218"
}
]
},
{
"title": "The role of cellular transcription factor E2F in the regulation of cdc2 mRNA expression and cell cycle control of human hematopoietic cells.",
"journal": "The Journal of biological chemistry",
"date": "1994",
"authors": "Furukawa Y, Terui Y, Sakoe K, Ohta M, Saito M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205"
}
],
"reference": [
{
"type": "PubMed",
"id": "7929342",
"url": "https://glygen.org/publication/PubMed/7929342"
}
]
},
{
"title": "Interaction of proliferating cell nuclear antigen with yeast DNA polymerase delta.",
"journal": "The Journal of biological chemistry",
"date": "1993",
"authors": "Brown WC, Campbell JL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69091",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69091"
}
],
"reference": [
{
"type": "PubMed",
"id": "8104944",
"url": "https://glygen.org/publication/PubMed/8104944"
}
]
},
{
"title": "Functional properties of a Drosophila homolog of the E2F1 gene.",
"journal": "Molecular and cellular biology",
"date": "1994",
"authors": "Ohtani K, Nevins JR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205"
}
],
"reference": [
{
"type": "PubMed",
"id": "8114698",
"url": "https://glygen.org/publication/PubMed/8114698"
}
]
},
{
"title": "The characterization of a mammalian DNA structure-specific endonuclease.",
"journal": "The EMBO journal",
"date": "1994",
"authors": "Harrington JJ, Lieber MR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69166"
}
],
"reference": [
{
"type": "PubMed",
"id": "8131753",
"url": "https://glygen.org/publication/PubMed/8131753"
}
]
},
{
"title": "Reconstitution of complete SV40 DNA replication with purified replication factors.",
"journal": "The Journal of biological chemistry",
"date": "1994",
"authors": "Waga S, Bauer G, Stillman B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69183",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69183"
}
],
"reference": [
{
"type": "PubMed",
"id": "8144677",
"url": "https://glygen.org/publication/PubMed/8144677"
}
]
},
{
"title": "G1/S-regulated E2F-containing protein complexes bind to the mouse thymidine kinase gene promoter.",
"journal": "The Journal of biological chemistry",
"date": "1994",
"authors": "Dou QP, Zhao S, Levin AH, Wang J, Helin K, Pardee AB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205"
}
],
"reference": [
{
"type": "PubMed",
"id": "8288595",
"url": "https://glygen.org/publication/PubMed/8288595"
}
]
},
{
"title": "Regulation of the cyclin E gene by transcription factor E2F1.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1995",
"authors": "Ohtani K, DeGregori J, Nevins JR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205"
}
],
"reference": [
{
"type": "PubMed",
"id": "8618861",
"url": "https://glygen.org/publication/PubMed/8618861"
}
]
},
{
"title": "DNA polymerase-alpha. Purification and structural characterization of the near homogeneous enzyme from human KB cells.",
"journal": "J. Biol. Chem.",
"date": "1977",
"authors": "Fisher PA, Korn D",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"reference": [
{
"type": "PubMed",
"id": "893425",
"url": "https://glygen.org/publication/PubMed/893425"
}
]
},
{
"title": "Expression of the HsOrc1 gene, a human ORC1 homolog, is regulated by cell proliferation via the E2F transcription factor.",
"journal": "Molecular and cellular biology",
"date": "1996",
"authors": "Ohtani K, DeGregori J, Leone G, Herendeen DR, Kelly TJ, Nevins JR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205"
}
],
"reference": [
{
"type": "PubMed",
"id": "8943353",
"url": "https://glygen.org/publication/PubMed/8943353"
}
]
},
{
"title": "Replication factor C recognizes 5'-phosphate ends of telomeres.",
"journal": "Biochemical and biophysical research communications",
"date": "1996",
"authors": "Uchiumi F, Ohta T, Tanuma S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-174411",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174411"
}
],
"reference": [
{
"type": "PubMed",
"id": "8954124",
"url": "https://glygen.org/publication/PubMed/8954124"
}
]
},
{
"title": "Accumulation of E2F-4.DP-1 DNA binding complexes correlates with induction of dhfr gene expression during the G1 to S phase transition.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Wells JM, Illenye S, Magae J, Wu CL, Heintz NH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205"
}
],
"reference": [
{
"type": "PubMed",
"id": "9020173",
"url": "https://glygen.org/publication/PubMed/9020173"
}
]
},
{
"title": "Enzymes and reactions at the eukaryotic DNA replication fork.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Bambara RA, Murante RS, Henricksen LA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69183",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69183"
}
],
"reference": [
{
"type": "PubMed",
"id": "9081985",
"url": "https://glygen.org/publication/PubMed/9081985"
}
]
},
{
"title": "DNA polymerase delta, an essential enzyme for DNA transactions.",
"journal": "Biological chemistry",
"date": "1997",
"authors": "Hindges R, Hubscher U",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69091",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69091"
}
],
"reference": [
{
"type": "PubMed",
"id": "9191022",
"url": "https://glygen.org/publication/PubMed/9191022"
}
]
},
{
"title": "Role of protein-protein interactions in the function of replication protein A (RPA): RPA modulates the activity of DNA polymerase alpha by multiple mechanisms.",
"journal": "Biochemistry",
"date": "1997",
"authors": "Braun K A, Lao Y, He Z, Ingles C J, Wold M S",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"reference": [
{
"type": "PubMed",
"id": "9214288",
"url": "https://glygen.org/publication/PubMed/9214288"
}
]
},
{
"title": "Functional association of poly(ADP-ribose) polymerase with DNA polymerase alpha-primase complex: a link between DNA strand break detection and DNA replication.",
"journal": "Nucleic acids research",
"date": "1998-04-15",
"authors": "Dantzer F, Nasheuer H P, Vonesch J L, de Murcia G, M\u00e9nissier-de Murcia J",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"reference": [
{
"type": "PubMed",
"id": "9518481",
"url": "https://glygen.org/publication/PubMed/9518481"
}
]
},
{
"title": "Cdc6 is regulated by E2F and is essential for DNA replication in mammalian cells.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1998",
"authors": "Yan Z, DeGregori J, Shohet R, Leone G, Stillman B, Nevins JR, Williams RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205"
}
],
"reference": [
{
"type": "PubMed",
"id": "9520412",
"url": "https://glygen.org/publication/PubMed/9520412"
}
]
},
{
"title": "Clamping down on clamps and clamp loaders--the eukaryotic replication factor C.",
"journal": "European journal of biochemistry",
"date": "1998",
"authors": "Mossi R, Hubscher U",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69091",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69091"
}
],
"reference": [
{
"type": "PubMed",
"id": "9660172",
"url": "https://glygen.org/publication/PubMed/9660172"
}
]
},
{
"title": "The human homolog of Saccharomyces cerevisiae CDC45.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Saha P, Thome KC, Yamaguchi R, Hou Z, Weremowicz S, Dutta A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-68962",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68962"
}
],
"reference": [
{
"type": "PubMed",
"id": "9660782",
"url": "https://glygen.org/publication/PubMed/9660782"
}
]
},
{
"title": "A new model of cell cycle-regulated transcription: repression of the cyclin A promoter by CDF-1 and anti-repression by E2F.",
"journal": "Oncogene",
"date": "1998",
"authors": "Liu N, Lucibello FC, Engeland K, Muller R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205"
}
],
"reference": [
{
"type": "PubMed",
"id": "9662327",
"url": "https://glygen.org/publication/PubMed/9662327"
}
]
},
{
"title": "Primase activity of human DNA polymerase alpha-primase. Divalent cations stabilize the enzyme activity of the p48 subunit.",
"journal": "J. Biol. Chem.",
"date": "1998",
"authors": "Schneider A, Smith RW, Kautz AR, Weisshart K, Grosse F, Nasheuer HP",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"reference": [
{
"type": "PubMed",
"id": "9705292",
"url": "https://glygen.org/publication/PubMed/9705292"
}
]
},
{
"title": "Regulation of cell growth-dependent expression of mammalian CDC6 gene by the cell cycle transcription factor E2F.",
"journal": "Oncogene",
"date": "1998",
"authors": "Ohtani K, Tsujimoto A, Ikeda M, Nakamura M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-69205",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205"
}
],
"reference": [
{
"type": "PubMed",
"id": "9778043",
"url": "https://glygen.org/publication/PubMed/9778043"
}
]
},
{
"title": "Replication factor C disengages from proliferating cell nuclear antigen (PCNA) upon sliding clamp formation, and PCNA itself tethers DNA polymerase delta to DNA.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Podust VN, Tiwari N, Stephan S, Fanning E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-174411",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174411"
}
],
"reference": [
{
"type": "PubMed",
"id": "9822671",
"url": "https://glygen.org/publication/PubMed/9822671"
}
]
}
],
"pathway": [
{
"id": "hsa:5422",
"name": "",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5422",
"resource": "KEGG Pathway"
},
{
"id": "R-HSA-113501",
"name": "Inhibition of replication initiation of damaged DNA by RB1/E2F1",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-113501",
"resource": "Reactome",
"description": "Inhibition of replication initiation of damaged DNA by RB1/E2F1"
},
{
"id": "R-HSA-174411",
"name": "Polymerase switching on the C-strand of the telomere",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174411",
"resource": "Reactome",
"description": "Polymerase switching on the C-strand of the telomere"
},
{
"id": "R-HSA-174430",
"name": "Telomere C-strand synthesis initiation",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174430",
"resource": "Reactome",
"description": "Telomere C-strand synthesis initiation"
},
{
"id": "R-HSA-68952",
"name": "DNA replication initiation",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68952",
"resource": "Reactome",
"description": "DNA replication initiation"
},
{
"id": "R-HSA-68962",
"name": "Activation of the pre-replicative complex",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68962",
"resource": "Reactome",
"description": "Activation of the pre-replicative complex"
},
{
"id": "R-HSA-69091",
"name": "Polymerase switching",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69091",
"resource": "Reactome",
"description": "Polymerase switching"
},
{
"id": "R-HSA-69166",
"name": "Removal of the Flap Intermediate",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69166",
"resource": "Reactome",
"description": "Removal of the Flap Intermediate"
},
{
"id": "R-HSA-69183",
"name": "Processive synthesis on the lagging strand",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69183",
"resource": "Reactome",
"description": "Processive synthesis on the lagging strand"
},
{
"id": "R-HSA-69205",
"name": "G1/S-Specific Transcription",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69205",
"resource": "Reactome",
"description": "G1/S-Specific Transcription"
},
{
"id": "R-HSA-9710421",
"name": "Defective pyroptosis",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9710421",
"resource": "Reactome",
"description": "Defective pyroptosis"
}
],
"orthologs": [
{
"uniprot_canonical_ac": "O89042-1",
"protein_name": "DNA polymerase alpha catalytic subunit",
"gene_name": "Pola1",
"tax_id": 10116,
"organism": "Rattus norvegicus",
"sequence": {
"sequence": "MAPVHGDDCKLETSAVSDSGSFVASRARREKKSKKGRQEALERLKKAKAGEKYKYEVEDLTSVYEEVDEEQYSKLVQARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDTCGEGSDGKAHRKDRKDVKKPSVTKPNNIKAMFIASAGKKTTDKTVDLSKDDLLGDILQDLNTETPQIAPPPVLIPKKKRSTGASPNPFSVHTATAVPSGKIASPVSRKEPPLTPVPLKRAEFAGDLAQPECPEDEQESGVIEFEDGDFDEPMDTEEVDEEEPVTAKIWDQESEPVEGVKHEADPETGTTSFLDSFLPDVSCWDIDQKDENSFLLQEVQVDSNHLPLVKGADDEQVFQFYWLDAYEDPYNQPGVVFLFGKVWVESAKTHVSCCVMVKNIERTLYFLPREMKIDLNTGKETATPITMKDVYEEFDSKISAKYKIMKFKSKIVEKNYAFEIPDVPEKSEYLEVRYSAEVPQLPQNLKGETFSHVFGTNTSSLELFLMNRKIKGPCWLEVKNPQLLNQPISWCKFEAMALKPDLVNVIKDVSPPPLVVMSFSMKTMQNVQNHQHEIIAMAALVHHNFPLDKAPPKPPFQTHFCVVSKPKDCIFPCAFKEVIKKKNMEVEVAATERTLLGFFLAKVHKLDPDILVGHNICGFELEVLLQRINECKVPFWSKIGRLRRSNMPKLGSRSGFGERNATCGRMICDVEISVKELIHCKSYHLSELVQQILKTERIVIPTENIRNMYSEPSHLLYLLEHIWKDARFILQIMCELNVLPLALQITNIAGNIMSRTLMGGRSERNEFLLLHAFYENNYIVPDKQIFRKPQQKPGDEDEEIDGDTNKYKKGRKKAAYAGGLVLDPKVGFYDKFILLLDFNSLYPSIIQEFNICFTTVQRVASETLKATEDEEQEQIPELPDPNLDMGILPREIRKLVERRKQVKQLMKQQDLNPDLVLQYDIRQKALKLTANSMYGCLGFSYSRFYAKPLAALVTYKGREILMHTKEMVQKMNLEVIYGDTDSIMINTNSTNLEEVFKLGNKVKNEVNKLYKLLEIDIDGVFKSLLLLKKKKYAALVVEPTSDGNYITKQELKGLDIVRRDWCDLAKDTGNFVIGQILSDQSRDTIVENIQKRLIEIGENVLNGSVPVSQFEINKALTKDPQDYPDKKSLPHVHVALWINSQGGRKVKAGDTVSYVICQDGSNLPATQRAYAPEQLQKQDNLAIDTQYYLAQQIHPVVARICEPIDGIDAVLIALWLGLDSTQFRVHQYHKDEENDALLGGPAQLTDEEKYKDCEKFKCLCPSCGTENIYDNVFEGSGMDMEPSLNRCSNIDCKASPATFMVQLSNKLIMDIRRCIKKYYDGWLICEEPTCRNRIRRLPLHFSRNGPLCPACMKAVLRPEYSDKSLYTQLCFYRYIFDADCALEKLPEHEKDKLKKQFFTPRVLQDYRKVKNIAEHFLSWSG",
"length": 1451
},
"evidence": [
{
"id": "45918783",
"url": "http://www.informatics.jax.org/homology/45918783",
"database": "MGI"
}
],
"common_name": "Rat"
},
{
"uniprot_canonical_ac": "P33609-1",
"protein_name": "DNA polymerase alpha catalytic subunit",
"gene_name": "Pola1",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MAPMHEEDCKLEASAVSDSGSFAASRARREKKSKKGRQEALERLKKAKAGEKYKYEVEDLTSVYEEVDEEQYSKLVQARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDTCGKGSDGKAHRKDRKDVKKPSVTKPNNIKAMFIASAGKKTTDKAVDLSKDDLLGDILQDLNTETAQITPPPVLIPKKKRSTGALLNPFSVHTPKAIPSGKPASPVLRNEPLLTPIPLKRAELAGELAQPECPEDEQELGVMEFEDGDFDESMDTEKVDEKPVTAKTWDQETEPVERVEHEADPERGTTSYLENFLPDVSCWDIDQDDESIPQEVQVDSSNLPLVKGADDEQVFQFYWLDAYEDPYNQPGVVFLFGKVWIESVKTHVSCCVMVKNIERTLYFLPREMKFDLNTGKETAIPVTMKDVYEEFDSKISAKYKIMKFKSKIVEKNYAFEIPDVPEKSEYLEVRYSAEVPQLPQNLKGETFSHVFGTNTSSLELFLMNRKIKGPCWLEVKNPQLLNQPISWCKFEVMALKPDLVNVIKDVSPPPLVVMSFSMKTMQNVQNHQHEIIAMAALVHHSFALDKAPPEPPFQTHFCVVSKPKDCIFPCDFKEVISKKNMKVEIAATERTLIGFFLAKVHKIDPDILVGHNICSFELEVLLQRINECKVPYWSKIGRLRRSNMPKLGSRSGFGERNATCGRMICDVEISAKELIHCKSYHLSELVQQILKTERIVIPTENIRNMYSESSYLLYLLEHIWKDARFILQIMCELNVLPLALQITNIAGNIMSRTLMGGRSERNEFLLLHAFYENNYIVPDKQIFRKPQQKLGDEDEEIDGDTNKYKKGRKKATYAGGLVLDPKVGFYDKFILLLDFNSLYPSIIQEFNICFTTVQRVTSEVQKATEDEEQEQIPELPDPNLEMGILPREIRKLVERRKQVKQLMKQQDLNPDLVLQYDIRQKALKLTANSMYGCLGFSYSRFYAKPLAALVTYKGREILMHTKDMVQKMNLEVIYGDTDSIMINTNSTNLEEVFKLGNKVKSEVNKLYKLLEIDIDAVFKSLLLLKKKKYAALVVEPTSDGNYITKQELKGLDIVRRDWCDLAKDTGNFVIGQILSDQSRDTIVENIQKRLIEIGENVLNGSVPVSQFEINKALTKDPQDYPDRKSLPHVHVALWINSQGGRKVKAGDTVSYVICQDGSNLTATQRAYAPEQLQKLDNLAIDTQYYLAQQIHPVVARICEPIDGIDAVLIALWLGLDSTQFRVHQYHKDEENDALLGGPAQLTDEEKYKDCEKFKCLCPSCGTENIYDNVFEGSGLDMEPSLYRCSNVDCKVSPLTFMVQLSNKLIMDIRRCIKKYYDGWLICEEPTCCSRLRRLPLHFSRNGPLCPVCMKAVLRPEYSDKSLYTQLCFYRYIFDADCALEKLTEHEKDKLKKQFFPLRVLQDYRKVKNIAEQFLSWSGYSEVNLSKLFANYAGKS",
"length": 1465
},
"evidence": [
{
"id": "45918783",
"url": "http://www.informatics.jax.org/homology/45918783",
"database": "MGI"
}
],
"common_name": "Mouse"
}
],
"go_annotation": {
"categories": [
{
"name": "Molecular Function",
"total": 8,
"go_terms": [
{
"name": "DNA replication origin binding",
"id": "GO:0003688",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003688",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"pmid": ""
},
{
"name": "DNA-directed DNA polymerase activity",
"id": "GO:0003887",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003887",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"pmid": ""
},
{
"name": "DNA binding",
"id": "GO:0003677",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"pmid": ""
},
{
"name": "chromatin binding",
"id": "GO:0003682",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003682",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"pmid": ""
},
{
"name": "zinc ion binding",
"id": "GO:0008270",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"pmid": ""
},
{
"name": "protein kinase binding",
"id": "GO:0019901",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019901",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"pmid": ""
},
{
"name": "nucleotide binding",
"id": "GO:0000166",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000166",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"pmid": ""
},
{
"name": "single-stranded DNA binding",
"id": "GO:0003697",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003697",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"pmid": ""
}
]
},
{
"name": "Cellular Component",
"total": 8,
"go_terms": [
{
"name": "alpha DNA polymerase:primase complex",
"id": "GO:0005658",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005658",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"pmid": ""
},
{
"name": "nucleus",
"id": "GO:0005634",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"pmid": ""
},
{
"name": "nuclear envelope",
"id": "GO:0005635",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005635",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"pmid": ""
},
{
"name": "nucleoplasm",
"id": "GO:0005654",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"pmid": ""
},
{
"name": "nucleolus",
"id": "GO:0005730",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"pmid": ""
},
{
"name": "cytosol",
"id": "GO:0005829",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"pmid": ""
},
{
"name": "nuclear matrix",
"id": "GO:0016363",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016363",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"pmid": ""
},
{
"name": "chromatin",
"id": "GO:0000785",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"pmid": ""
}
]
},
{
"name": "Biological Process",
"total": 11,
"go_terms": [
{
"name": "DNA strand elongation involved in DNA replication",
"id": "GO:0006271",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006271",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"pmid": ""
},
{
"name": "leading strand elongation",
"id": "GO:0006272",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006272",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"pmid": ""
},
{
"name": "lagging strand elongation",
"id": "GO:0006273",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006273",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"pmid": ""
},
{
"name": "DNA repair",
"id": "GO:0006281",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006281",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"pmid": ""
},
{
"name": "DNA replication",
"id": "GO:0006260",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006260",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"pmid": ""
},
{
"name": "double-strand break repair via nonhomologous end joining",
"id": "GO:0006303",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006303",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"pmid": ""
},
{
"name": "DNA replication initiation",
"id": "GO:0006270",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006270",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"pmid": ""
},
{
"name": "DNA replication, synthesis of RNA primer",
"id": "GO:0006269",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006269",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"pmid": ""
},
{
"name": "mitotic DNA replication initiation",
"id": "GO:1902975",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902975",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"pmid": ""
},
{
"name": "DNA synthesis involved in DNA repair",
"id": "GO:0000731",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000731",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"pmid": ""
},
{
"name": "regulation of type I interferon production",
"id": "GO:0032479",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032479",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
}
],
"pmid": ""
}
]
}
]
},
"pro_annotation": [],
"site_annotation": [
{
"start_pos": 1011,
"end_pos": 1013,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 1125,
"end_pos": 1127,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 1185,
"end_pos": 1187,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 1203,
"end_pos": 1205,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 1355,
"end_pos": 1357,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 1450,
"end_pos": 1452,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 480,
"end_pos": 482,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 683,
"end_pos": 685,
"annotation": "n_glycosylation_sequon"
}
],
"ptm_annotation": [
{
"annotation": "A 165 kDa form is probably produced by proteolytic cleavage at Lys-124.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09884",
"url": "https://www.uniprot.org/uniprot/P09884"
},
{
"database": "PubMed",
"id": "2243771",
"url": "https://glygen.org/publication/PubMed/2243771"
}
]
}
],
"interactions": [],
"reactions": [
{
"id": "22508",
"name": "",
"equation": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1)",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q673L6-1",
"Q5RKI3-1",
"O54747-1",
"O89042-1",
"P06766-1",
"Q9QYV8-1",
"D3Z8X4-1",
"E9PT58-1",
"F1M8G6-1",
"F7F6Z7-1",
"Q07864-1",
"P28340-1",
"P06746-1",
"Q9UGP5-1",
"P54098-1",
"Q9NP87-1",
"P09884-1",
"Q7Z5Q5-1",
"O75417-1",
"O00370-1",
"Q9WJR5-1",
"Q9UBT6-1",
"O60673-1",
"Q9UNA4-1",
"Q9Y253-1",
"P63135-1",
"P10266-1",
"P63132-1",
"P63133-1",
"P63136-1",
"Q9UQG0-1",
"Q9QC07-1",
"P63128-1",
"Q9BXR3-1",
"P04053-1",
"O14746-1",
"P10400-1",
"P11369-1",
"P52431-1",
"Q7TQ07-1",
"Q9JIW4-1",
"P54099-1",
"Q8K409-1",
"P33609-1",
"Q9WVF7-1",
"Q9QXE2-1",
"Q8CGS6-1",
"Q61493-1",
"O70372-1",
"P09838-2",
"Q6R3M4-1",
"Q9JJN0-1",
"Q9QUG2-1",
"P13382-1",
"P14284-1",
"P15436-1",
"P15801-1",
"P21951-1",
"P25384-1",
"P25615-1",
"P46957-1",
"Q04049-1",
"Q06163-1",
"A0A0B7P3V8-1",
"O13527-1",
"O13535-1",
"P0C2I2-1",
"P0C2I3-1",
"P0C2I5-1",
"P0C2I6-1",
"P0C2I9-1",
"P0C2J0-1",
"P0C2J1-1",
"P0C2J3-1",
"P0C2J7-1",
"P0CX63-1",
"P0CX64-1",
"Q99231-1",
"P39985-1",
"P47024-1",
"P47098-1",
"P47100-1",
"Q12472-1",
"Q03434-1",
"Q03494-1",
"Q03612-1",
"Q03619-1",
"Q03855-1",
"Q04214-1",
"Q04670-1",
"Q04711-1",
"Q07791-1",
"Q07793-1",
"Q12088-1",
"Q12112-1",
"Q12113-1",
"Q12141-1",
"Q12193-1",
"Q12269-1",
"Q12273-1",
"Q12316-1",
"Q12414-1",
"Q12490-1",
"Q12491-1",
"Q12501-1",
"Q7LHG5-1",
"Q92393-1",
"Q99315-1",
"Q99337-1",
"Q55AZ3-1",
"Q1ZXF2-1",
"Q54B44-1",
"Q54N97-1",
"Q54RD4-1",
"Q54SV8-1",
"Q9GSR1-1",
"Q9VHV1-1",
"Q9VNX1-1",
"Q9VCN1-1",
"P26019-1",
"P54358-1",
"Q27607-1",
"O18475-1"
],
"evidence": [
{
"id": "22508",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/22508"
}
]
},
{
"id": "R-HSA-113504",
"name": "Detection of damage during initiation of DNA synthesis in S-phase",
"equation": "",
"summary": "At the beginning of this reaction, 1 molecule of 'RNA primer-DNA primer:origin duplex' is present. At the end of this reaction, 1 molecule of 'DNA polymerase alpha:primase', and 1 molecule of 'RNA primer-DNA primer:origin duplex with DNA damage' are present.
This reaction takes place in the 'nucleus' (Gambus et al. 2009, Remus et al. 2009, Chattopadhyay et al.2007, Fien et al. 2004).",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09884-1",
"P49642-1"
],
"evidence": [
{
"id": "R-HSA-113504",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-113504"
}
]
},
{
"id": "R-HSA-174425",
"name": "The primase component of DNA polymerase:primase synthesizes a 6-10 nucleotide RNA primer on the G strand of the telomere",
"equation": "",
"summary": "The complementary C-strand at telomeres is synthesized by the DNA polymerase alpha:primase complex (Nakamura et al. 2005) using conventional RNA priming (Wang et al. 1984). Interaction of the DNA polymerase alpha complex with the G-strand-bound CST complex is needed for successful priming of the C-strand (Feng et al. 2018).",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09884-1",
"P49642-1"
],
"evidence": [
{
"id": "R-HSA-174425",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174425"
}
]
},
{
"id": "R-HSA-174427",
"name": "The polymerase component of DNA polymerase alpha:primase synthesizes a 20-nucleotide primer on the G strand of the telomere",
"equation": "",
"summary": "The complementary C-strand at telomeres is synthesized by the polymerase alpha:primase complex using conventional RNA priming (Nakamura et al. 2005, Dai et al. 2010). This process is regulated by the CST complex (Dai et al. 2010, Feng et al. 2017, Feng et al. 2018) and CDK1 (Dai et al. 2010, Dai et al. 2012).",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09884-1",
"P49642-1"
],
"evidence": [
{
"id": "R-HSA-174427",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174427"
}
]
},
{
"id": "R-HSA-174452",
"name": "RFC binding displaces Pol Alpha on the C-strand of the telomere",
"equation": "",
"summary": "Once the RNA-DNA primer is synthesized, replication factor C (RFC) initiates a reaction called \\polymerase switching\\; pol delta, the processive enzyme, replaces pol alpha, the priming enzyme. RFC binds to the 3'-end of the RNA-DNA primer on the Primosome, to displace the pol alpha primase complex. The binding of RFC triggers the binding of the primer recognition complex (Tsurimoto and Stillman 1991, Maga et al. 2000, Mossi et al. 2000). RFC is recruited to telomeres via interaction with 5'-phosphate ends of a telomere repeat sequence (Uchiumi et al. 1996, Uchiumi et al. 1999). In budding yeast, the alternative evolutionarily conserved RFC complex in which the RFC1 subunit is substituted with the CTF18 complex (composed of CHTF18, CHTF8 and DSCC1) plays a critical role in telomere maintenance (Hiraga et al. 2006, Gao et al. 2014). The CTF18-RFC complex is also implicated in telomere maintenance in fission yeast (Khair et al. 2010). It was shown that the human CTF18-RFC complex has a redundant function with the RFC pentamer in PCNA loading and DNA replication (Bermudez et al. 2003), but its role in human telomere maintenance has not been studied. Mouse CFT18 complex is necessary for proper development of germ cells (Berkowitz et al. 2012).",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09884-1",
"P49642-1"
],
"evidence": [
{
"id": "R-HSA-174452",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174452"
}
]
},
{
"id": "R-HSA-68913",
"name": "The primase component of DNA polymerase:primase synthesizes a 6-10 nucleotide RNA primer at the origin",
"equation": "",
"summary": "At the beginning of this reaction, 1 molecule of 'DNA polymerase alpha:primase:DNA polymerase alpha:origin complex', and 1 molecule of 'NTP' are present. At the end of this reaction, 1 molecule of 'DNA polymerase epsilon', and 1 molecule of 'RNA primer:origin duplex:DNA polymerase alpha:primase complex' are present.
This reaction takes place in the 'nucleus' and is mediated by the 'DNA-directed RNA polymerase activity' of 'DNA polymerase alpha:primase'.
",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [
"R-HSA-68483"
],
"enzyme_list": [
"P09884-1",
"Q07864-1",
"P49642-1"
],
"evidence": [
{
"id": "R-HSA-68913",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68913"
}
]
},
{
"id": "R-HSA-68914",
"name": "DNA polymerase alpha:primase binds at the origin",
"equation": "",
"summary": "DNA polymerase alpha:primase is comprised of four subunits, p180, p70, p58, and p49. The two primase subunits, p58 and p49, form a tight complex. The p49 subunit contains the DNA primase activity and one role of p58 appears to be tethering p49 to p180, the DNA polymerase catalytic subunit. The fourth subunit, p70, binds p180 and may tether the DNA polymerase alpha:primase complex to Cdc45.",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09884-1",
"Q07864-1",
"P49642-1",
"P49736-1",
"Q14566-1",
"P33993-1",
"P25205-1",
"P33992-1",
"O00311-1",
"P24941-1",
"P33991-1",
"Q9UJA3-1"
],
"evidence": [
{
"id": "R-HSA-68914",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68914"
}
]
},
{
"id": "R-HSA-68950",
"name": "The polymerase component of DNA polymerase alpha:primase synthesizes a 20-nucleotide primer at the origin",
"equation": "",
"summary": "At the beginning of this reaction, 1 molecule of 'dTTP', 1 molecule of 'dGTP', 1 molecule of 'dATP', 1 molecule of 'RNA primer:origin duplex:DNA polymerase alpha:primase complex', and 1 molecule of 'dCTP' are present. At the end of this reaction, 1 molecule of 'RNA primer-DNA primer:origin duplex' is present.
This reaction takes place in the 'nucleus' and is mediated by the 'DNA-directed DNA polymerase activity' of 'DNA polymerase alpha:primase'.
",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09884-1",
"P49642-1"
],
"evidence": [
{
"id": "R-HSA-68950",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68950"
}
]
},
{
"id": "R-HSA-69053",
"name": "RFC binding displaces Pol Alpha",
"equation": "",
"summary": "Once the RNA-DNA primer is synthesized, replication factor C (RFC) initiates a reaction called \\polymerase switching\\; pol delta, the processive enzyme, replaces pol alpha, the priming enzyme. RFC binds to the 3'-end of the RNA-DNA primer on the Primosome, to displace the pol alpha primase complex. The binding of RFC triggers the binding of the primer recognition complex (Tsurimoto and Stillman 1991, Maga et al. 2000, Mossi et al. 2000). RFC is recruited to telomeres via interaction with 5'-phosphate ends of a telomere repeat sequence (Uchiumi et al. 1996, Uchiumi et al. 1999). In budding yeast, the alternative evolutionarily conserved RFC complex in which the RFC1 subunit is substituted with the CTF18 complex (composed of CHTF18, CHTF8 and DSCC1) plays a critical role in telomere maintenance (Hiraga et al. 2006, Gao et al. 2014). The CTF18-RFC complex is also implicated in telomere maintenance in fission yeast (Khair et al. 2010). It was shown that the human CTF18-RFC complex has a redundant function with the RFC pentamer in PCNA loading and DNA replication (Bermudez et al. 2003), but its role in human telomere maintenance has not been studied. Mouse CFT18 complex is necessary for proper development of germ cells (Berkowitz et al. 2012).",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09884-1",
"P49642-1"
],
"evidence": [
{
"id": "R-HSA-69053",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69053"
}
]
},
{
"id": "R-HSA-69063",
"name": "Loading of PCNA - Sliding Clamp Formation",
"equation": "",
"summary": "The binding of the primer recognition complex involves the loading of the proliferating cell nuclear antigen (PCNA). Replication Factor C (RFC) transiently opens the PCNA toroid in an ATP-dependent reaction, and then allows PCNA to re-close around the double helix adjacent to the primer terminus. This leads to the formation of the \\sliding clamp\\ (Tsurimoto et al. 1990, Mossi and Hubscher 1998). In a human telomere replication model, RFC-mediated PCNA loading increases the processivity of telomeric C-strand synthesis, but does not eliminate polymerase delta stalling on the G-rich template (Lormand et al. 2013).
Interaction of RTEL1 with PCNA is needed for telomere replication and maintenance of telomere integrity (Vannier et al. 2013).",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09884-1",
"P49642-1"
],
"evidence": [
{
"id": "R-HSA-69063",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69063"
}
]
},
{
"id": "R-HSA-69068",
"name": "RFC dissociates after sliding clamp formation",
"equation": "",
"summary": "It is assumed that, as shown for generic DNA replication (Podust et al. 1998), the RFC complex dissociates from PCNA following sliding clamp formation at the telomere, and the DNA toroid alone tethers pol delta to the DNA.",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09884-1",
"P49642-1"
],
"evidence": [
{
"id": "R-HSA-69068",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69068"
}
]
},
{
"id": "R-HSA-69074",
"name": "Formation of Processive Complex",
"equation": "",
"summary": "The loading of proliferating cell nuclear antigen (PCNA) leads to recruitment of pol delta, the process of polymerase switching. Human PCNA is a homotrimer of 36 kDa subunits that form a toroidal structure. The loading of PCNA by RFC is a key event in the transition from the priming mode to the extension mode of DNA synthesis. The processive complex is composed of the pol delta holoenzyme and PCNA (Murakami et al.2010). Both PCNA and the DNA polymerase delta are needed for telomeric C-strand synthesis in a human telomere replication model (Lormand et al. 2013).",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09884-1",
"P28340-1",
"P49642-1"
],
"evidence": [
{
"id": "R-HSA-69074",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69074"
}
]
},
{
"id": "R-HSA-69116",
"name": "Formation of Okazaki fragments",
"equation": "",
"summary": "After RFC initiates the assembly of the primer recognition complex, the complex of pol delta and PCNA is responsible for incorporating the additional nucleotides prior to the position of the next downstream initiator RNA primer. On the lagging strand, short discontinuous segments of DNA, called Okazaki fragments, are synthesized on RNA primers. The average length of the Okazaki fragments is 100 nucleotides. Polymerase switching is a key event that allows the processive synthesis of DNA by the pol delta and PCNA complex (Lee and Hurwitz 1990, Tsurimoto and Stillman 1991, Nethanel et al. 1992, Brown and Campbell 1993, Waga et al.1994, Bambara et al. 1997).",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09884-1",
"P28340-1",
"P49642-1"
],
"evidence": [
{
"id": "R-HSA-69116",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69116"
}
]
},
{
"id": "R-HSA-69127",
"name": "Formation of the Flap Intermediate",
"equation": "",
"summary": "When the polymerase delta:PCNA complex reaches a downstream Okazaki fragment, strand displacement synthesis occurs. The primer containing 5'-terminus of the downstream Okazaki fragment is folded into a single-stranded flap.",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09884-1",
"P28340-1",
"P49642-1"
],
"evidence": [
{
"id": "R-HSA-69127",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69127"
}
]
},
{
"id": "R-HSA-69140",
"name": "RPA binds to the Flap",
"equation": "",
"summary": "The first step in the removal of the flap intermediate is the binding of Replication Protein A (RPA) to the long flap structure. RPA is a eukaryotic single-stranded DNA binding protein.",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09884-1",
"P28340-1",
"P49642-1"
],
"evidence": [
{
"id": "R-HSA-69140",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69140"
}
]
},
{
"id": "R-HSA-69142",
"name": "Recruitment of Dna2 endonuclease",
"equation": "",
"summary": "After RPA binds the long flap, it recruits the Dna2 endonuclease. Dna2 endonuclease removes most of the flap, but the job of complete removal of the flap is then completed by FEN-1.",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09884-1",
"P28340-1",
"P49642-1"
],
"evidence": [
{
"id": "R-HSA-69142",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69142"
}
]
},
{
"id": "R-HSA-69144",
"name": "Removal of RNA primer and dissociation of RPA and Dna2",
"equation": "",
"summary": "The Dna2 endonuclease removes the initiator RNA along with several downstream deoxyribonucleotides. The cleavage of the single-stranded RNA substrate results in the disassembly of RPA and Dna2. The current data for the role of the Dna2 endonuclease has been derived from studies with yeast and Xenopus Dna2.",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09884-1",
"P28340-1",
"P49642-1"
],
"evidence": [
{
"id": "R-HSA-69144",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69144"
}
]
},
{
"id": "R-HSA-69152",
"name": "Removal of remaining Flap",
"equation": "",
"summary": "The remaining flap, which is too short to support RPA binding, is then processed by FEN-1. There is evidence that binding of RPA to the displaced end of the RNA-containing Okazaki fragment prevents FEN-1 from accessing the substrate. FEN-1 is a structure-specific endonuclease that cleaves near the base of the flap at a position one nucleotide into the annealed region. Biochemical studies have shown that the preferred substrate for FEN-1 consists of a one-nucleotide 3'-tail on the upstream primer in addition to the 5'-flap of the downstream primer.",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09884-1",
"P28340-1",
"P49642-1",
"P39748-1"
],
"evidence": [
{
"id": "R-HSA-69152",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69152"
}
]
},
{
"id": "R-HSA-8961632",
"name": "POLA1 gene transcription is stimulated by E2F1",
"equation": "",
"summary": "E2F1 binds to E2F binding sites in the promoter of the POLA1 gene, stimulating POLA1 transcription. POLA1 encodes the catalytic subunit p180 of the DNA polymerase alpha (DeGregori et al. 1995, Giangrande et al. 2004). Activation of POLA1 by E2F1 has also been demonstrated in Drosophila (Ohtani and Nevins 1994).",
"cellular_location": "nucleoplasm",
"input_participant_list": [
"R-HSA-8961640"
],
"output_participant_list": [
"R-HSA-68487"
],
"enzyme_list": [
"P09884-1"
],
"evidence": [
{
"id": "R-HSA-8961632",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8961632"
}
]
},
{
"id": "R-HSA-9668597",
"name": "DNA polymerase:primase binds G-strand of the telomere",
"equation": "",
"summary": "Binding of the polymerase alpha complex and the CST (Ctc1-Stn1-Ten1) complex to the telomeric DNA ends inhibits further extension of the G-strand by telomerase. The loading of the DNA polymerase alpha to telomeres does not depend on the CST complex, but the CST complex is needed for cessation of telomerase activity and for synthesis of RNA primers by the primase component of the DNA polymerase alpha (Feng et al. 2018. Gu et al. 2018).",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09884-1",
"P49642-1"
],
"evidence": [
{
"id": "R-HSA-9668597",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9668597"
}
]
},
{
"id": "R-HSA-9710480",
"name": "Decitabine triphosphate incorporates into DNA",
"equation": "",
"summary": "Cellular uptake of decitabine or 5\u2011aza\u20112\u2032\u2011deoxycytidine is mediated by the equilibrative nucleoside transporters hENT1, hENT2, and hENT3, which also mediate cytosine uptake. Decitabine is a prodrug that has to be converted into a nucleoside triphosphate to become an active drug (reviewed in Raynal NJM & Issa JPJ 2016). The activation of the prodrug relies on three successive phosphorylation steps. The first phosphorylation is catalyzed by the deoxycytidine kinase (DCK) to produce the monophosphorylated form of decitabine or 5\u2011aza\u2011deoxycytidine\u20115\u2032\u2011monophosphate (5\u2011aza\u2011dCMP). Subsequently, two additional phosphorylation reactions catalyzed by the deoxycytidine\u20115\u2032\u2011monophosphate (dCMP) kinase and the nucleoside diphosphokinase will produce 5\u2011aza\u2011deoxycytidine\u20115\u2032\u2011diphosphate (5\u2011aza\u2011dCDP) and 5\u2011aza\u2011deoxycytidine\u20115\u2032\u2011triphosphate (5\u2011aza\u2011dCTP), respectively. Once in its triphosphate form, the active drug can be incorporated into the DNA of dividing cells by DNA polymerase, in the reaction annotated here. DNA polymerase has similar affinities for dCTP and 5\u2011aza\u2011dCTP (Raynal NJM & Issa JPJ 2016).",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09884-1",
"P49642-1"
],
"evidence": [
{
"id": "R-HSA-9710480",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9710480"
}
]
}
],
"reaction_participants": [
{
"participant_id": "R-HSA-68483",
"participant_name": "DNA polymerase epsilon [nucleoplasm]",
"crossref": [
{
"id": "CPX-2108",
"database": "ComplexPortal",
"url": ""
}
]
},
{
"participant_id": "R-HSA-68487",
"participant_name": "POLA1 [nucleoplasm]",
"crossref": [
{
"id": "7N2M",
"database": "PDB",
"url": ""
},
{
"id": "P09884",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "23828",
"database": "Orphanet",
"url": ""
},
{
"id": "4QCL",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000368349",
"database": "Ensembl",
"url": ""
},
{
"id": "DPOLA_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "1N5G",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000101868",
"database": "OpenTargets",
"url": ""
},
{
"id": "P09884",
"database": "UniProt",
"url": ""
},
{
"id": "8D0K",
"database": "PDB",
"url": ""
},
{
"id": "8D0B",
"database": "PDB",
"url": ""
},
{
"id": "7OPL",
"database": "PDB",
"url": ""
},
{
"id": "DPOLA_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "DPOLA_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "P09884",
"database": "GeneCards",
"url": ""
},
{
"id": "1K0P",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000379059",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000101868-POLA1",
"database": "HPA",
"url": ""
},
{
"id": "4Q5V",
"database": "PDB",
"url": ""
},
{
"id": "P09884",
"database": "PRO",
"url": ""
},
{
"id": "5IUD",
"database": "PDB",
"url": ""
},
{
"id": "1K18",
"database": "PDB",
"url": ""
},
{
"id": "6AS7",
"database": "PDB",
"url": ""
},
{
"id": "4Y97",
"database": "PDB",
"url": ""
},
{
"id": "7U5C",
"database": "PDB",
"url": ""
},
{
"id": "NP_058633.2",
"database": "RefSeq",
"url": ""
},
{
"id": "P09884",
"database": "ZINC target",
"url": ""
},
{
"id": "5EXR",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000101868",
"database": "Ensembl",
"url": ""
},
{
"id": "8D9D",
"database": "PDB",
"url": ""
},
{
"id": "8D96",
"database": "PDB",
"url": ""
},
{
"id": "HMDBP00951",
"database": "HMDB Protein",
"url": ""
}
]
},
{
"participant_id": "R-HSA-8961640",
"participant_name": "POLA1 gene [nucleoplasm]",
"crossref": [
{
"id": "ENSG00000101868",
"database": "ENSEMBL",
"url": ""
}
]
}
],
"reaction_enzymes": [
{
"uniprot_ac": "A0A0B7P3V8",
"gene_name": "TY4B-P",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "A0A0B7P3V8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A0B7P3V8"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "A0A0B7P3V8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A0B7P3V8"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "A0A0B7P3V8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A0B7P3V8"
}
]
},
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "A0A0B7P3V8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A0B7P3V8"
}
]
}
]
},
{
"uniprot_ac": "D3Z8X4",
"gene_name": "Pole",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "D3Z8X4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D3Z8X4"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "D3Z8X4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D3Z8X4"
}
]
}
]
},
{
"uniprot_ac": "E9PT58",
"gene_name": "Dntt",
"activity": [
{
"ec_number": "2.7.7.31",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "E9PT58",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/E9PT58"
}
]
},
{
"ec_number": "2.7.7.31",
"activity": "",
"evidence": [
{
"id": "E9PT58",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/E9PT58"
}
]
}
]
},
{
"uniprot_ac": "F1M8G6",
"gene_name": "Rev3l",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "F1M8G6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1M8G6"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "F1M8G6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1M8G6"
}
]
}
]
},
{
"uniprot_ac": "F7F6Z7",
"gene_name": "Polm",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "F7F6Z7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F7F6Z7"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "F7F6Z7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F7F6Z7"
}
]
}
]
},
{
"uniprot_ac": "O00311",
"gene_name": "CDC7",
"activity": [
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "O00311",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O00311"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "O00311",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O00311"
}
]
}
]
},
{
"uniprot_ac": "O00370",
"gene_name": "",
"activity": [
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "O00370",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O00370"
}
]
},
{
"ec_number": "3.1.21.-",
"activity": "",
"evidence": [
{
"id": "O00370",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O00370"
}
]
}
]
},
{
"uniprot_ac": "O13527",
"gene_name": "TY1B-A",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "O13527",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O13527"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "O13527",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O13527"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "O13527",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O13527"
}
]
}
]
},
{
"uniprot_ac": "O13535",
"gene_name": "TY1B-H",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "O13535",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O13535"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "O13535",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O13535"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "O13535",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O13535"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "O13535",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O13535"
}
]
}
]
},
{
"uniprot_ac": "O14746",
"gene_name": "TERT",
"activity": [
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "O14746",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14746"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "",
"evidence": [
{
"id": "O14746",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14746"
}
]
}
]
},
{
"uniprot_ac": "O18475",
"gene_name": "PolQ",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "O18475",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O18475"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "O18475",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O18475"
}
]
}
]
},
{
"uniprot_ac": "O54747",
"gene_name": "Pold1",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "O54747",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54747"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "O54747",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54747"
}
]
},
{
"ec_number": "3.1.11.-",
"activity": "",
"evidence": [
{
"id": "O54747",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54747"
}
]
}
]
},
{
"uniprot_ac": "O60673",
"gene_name": "REV3L",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "O60673",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O60673"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "O60673",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O60673"
}
]
}
]
},
{
"uniprot_ac": "O70372",
"gene_name": "Tert",
"activity": [
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "O70372",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O70372"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "",
"evidence": [
{
"id": "O70372",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O70372"
}
]
}
]
},
{
"uniprot_ac": "O75417",
"gene_name": "POLQ",
"activity": [
{
"ec_number": "3.6.4.12",
"activity": "ATP + H2O = ADP + H(+) + phosphate.",
"evidence": [
{
"id": "O75417",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75417"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "O75417",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75417"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "O75417",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75417"
}
]
}
]
},
{
"uniprot_ac": "O89042",
"gene_name": "Pola1",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "O89042",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O89042"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "O89042",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O89042"
}
]
}
]
},
{
"uniprot_ac": "P04053",
"gene_name": "DNTT",
"activity": [
{
"ec_number": "2.7.7.31",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P04053",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04053"
}
]
},
{
"ec_number": "2.7.7.31",
"activity": "",
"evidence": [
{
"id": "P04053",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04053"
}
]
}
]
},
{
"uniprot_ac": "P06746",
"gene_name": "POLB",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P06746",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06746"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "P06746",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06746"
}
]
},
{
"ec_number": "4.2.99.18",
"activity": "2'-deoxyribonucleotide-(2'-deoxyribose 5'-phosphate)-2'-deoxyribonucleotide-DNA = a 3'-end 2'-deoxyribonucleotide-(2,3-dehydro-2,3-deoxyribose 5'-phosphate)-DNA + a 5'-end 5'-monophospho-2'-deoxyribonucleoside-DNA + H(+).",
"evidence": [
{
"id": "P06746",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06746"
}
]
},
{
"ec_number": "4.2.99.-",
"activity": "",
"evidence": [
{
"id": "P06746",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06746"
}
]
}
]
},
{
"uniprot_ac": "P06766",
"gene_name": "Polb",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P06766",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06766"
}
]
},
{
"ec_number": "4.2.99.18",
"activity": "2'-deoxyribonucleotide-(2'-deoxyribose 5'-phosphate)-2'-deoxyribonucleotide-DNA = a 3'-end 2'-deoxyribonucleotide-(2,3-dehydro-2,3-deoxyribose 5'-phosphate)-DNA + a 5'-end 5'-monophospho-2'-deoxyribonucleoside-DNA + H(+).",
"evidence": [
{
"id": "P06766",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06766"
}
]
},
{
"ec_number": "4.2.99.-",
"activity": "",
"evidence": [
{
"id": "P06766",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06766"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "P06766",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06766"
}
]
}
]
},
{
"uniprot_ac": "P09838",
"gene_name": "Dntt",
"activity": [
{
"ec_number": "3.1.11.-",
"activity": "",
"evidence": [
{
"id": "P09838",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09838"
}
]
},
{
"ec_number": "2.7.7.31",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P09838",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09838"
}
]
},
{
"ec_number": "2.7.7.31",
"activity": "",
"evidence": [
{
"id": "P09838",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09838"
}
]
}
]
},
{
"uniprot_ac": "P09884",
"gene_name": "POLA1",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P09884",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09884"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "P09884",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09884"
}
]
}
]
},
{
"uniprot_ac": "P0C2I2",
"gene_name": "TY1B-DR5",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P0C2I2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2I2"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "P0C2I2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2I2"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P0C2I2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2I2"
}
]
},
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "P0C2I2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2I2"
}
]
}
]
},
{
"uniprot_ac": "P0C2I3",
"gene_name": "TY1B-DR6",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "P0C2I3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2I3"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P0C2I3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2I3"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "P0C2I3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2I3"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P0C2I3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2I3"
}
]
}
]
},
{
"uniprot_ac": "P0C2I5",
"gene_name": "TY1B-LR2",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "P0C2I5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2I5"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P0C2I5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2I5"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "P0C2I5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2I5"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P0C2I5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2I5"
}
]
}
]
},
{
"uniprot_ac": "P0C2I6",
"gene_name": "TY1B-LR3",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "P0C2I6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2I6"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P0C2I6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2I6"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "P0C2I6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2I6"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P0C2I6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2I6"
}
]
}
]
},
{
"uniprot_ac": "P0C2I9",
"gene_name": "TY1B-PR1",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "P0C2I9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2I9"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P0C2I9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2I9"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "P0C2I9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2I9"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P0C2I9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2I9"
}
]
}
]
},
{
"uniprot_ac": "P0C2J0",
"gene_name": "TY1B-PR2",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "P0C2J0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2J0"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P0C2J0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2J0"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "P0C2J0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2J0"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P0C2J0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2J0"
}
]
}
]
},
{
"uniprot_ac": "P0C2J1",
"gene_name": "TY1B-PR3",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "P0C2J1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2J1"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P0C2J1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2J1"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "P0C2J1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2J1"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P0C2J1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2J1"
}
]
}
]
},
{
"uniprot_ac": "P0C2J3",
"gene_name": "TY2B-LR1",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P0C2J3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2J3"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "P0C2J3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2J3"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P0C2J3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2J3"
}
]
},
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "P0C2J3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2J3"
}
]
}
]
},
{
"uniprot_ac": "P0C2J7",
"gene_name": "TY4B-H",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P0C2J7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2J7"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "P0C2J7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2J7"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P0C2J7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2J7"
}
]
},
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "P0C2J7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0C2J7"
}
]
}
]
},
{
"uniprot_ac": "P0CX63",
"gene_name": "TY2B-F",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P0CX63",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0CX63"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "P0CX63",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0CX63"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P0CX63",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0CX63"
}
]
},
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "P0CX63",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0CX63"
}
]
}
]
},
{
"uniprot_ac": "P0CX64",
"gene_name": "TY2B-GR2",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P0CX64",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0CX64"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "P0CX64",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0CX64"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P0CX64",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0CX64"
}
]
},
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "P0CX64",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0CX64"
}
]
}
]
},
{
"uniprot_ac": "P10266",
"gene_name": "ERVK-10",
"activity": [
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P10266",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10266"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "P10266",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10266"
}
]
},
{
"ec_number": "3.4.23.50",
"activity": "Processing at the authentic HIV-1 PR recognition site and release of the mature p17 matrix and the p24 capsid protein, as a result of the cleavage of the -SQNY-|-PIVQ- cleavage site.",
"evidence": [
{
"id": "P10266",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10266"
}
]
}
]
},
{
"uniprot_ac": "P10400",
"gene_name": "Pol",
"activity": [
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P10400",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10400"
}
]
}
]
},
{
"uniprot_ac": "P11369",
"gene_name": "Pol",
"activity": [
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P11369",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11369"
}
]
},
{
"ec_number": "3.1.21.-",
"activity": "",
"evidence": [
{
"id": "P11369",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11369"
}
]
}
]
},
{
"uniprot_ac": "P13382",
"gene_name": "POL1",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P13382",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13382"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "P13382",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13382"
}
]
}
]
},
{
"uniprot_ac": "P14284",
"gene_name": "REV3",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P14284",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14284"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "P14284",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14284"
}
]
}
]
},
{
"uniprot_ac": "P15436",
"gene_name": "POL3",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P15436",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P15436"
}
]
},
{
"ec_number": "3.1.11.-",
"activity": "",
"evidence": [
{
"id": "P15436",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P15436"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "P15436",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P15436"
}
]
}
]
},
{
"uniprot_ac": "P15801",
"gene_name": "MIP1",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P15801",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P15801"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "P15801",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P15801"
}
]
}
]
},
{
"uniprot_ac": "P21951",
"gene_name": "POL2",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P21951",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P21951"
}
]
},
{
"ec_number": "3.1.11.-",
"activity": "",
"evidence": [
{
"id": "P21951",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P21951"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "P21951",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P21951"
}
]
}
]
},
{
"uniprot_ac": "P24941",
"gene_name": "CDK2",
"activity": [
{
"ec_number": "2.7.11.22",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P24941",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24941"
}
]
},
{
"ec_number": "2.7.11.22",
"activity": "",
"evidence": [
{
"id": "P24941",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24941"
}
]
}
]
},
{
"uniprot_ac": "P25205",
"gene_name": "MCM3",
"activity": [
{
"ec_number": "3.6.4.12",
"activity": "ATP + H2O = ADP + H(+) + phosphate.",
"evidence": [
{
"id": "P25205",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P25205"
}
]
},
{
"ec_number": "3.6.4.12",
"activity": "",
"evidence": [
{
"id": "P25205",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P25205"
}
]
}
]
},
{
"uniprot_ac": "P25384",
"gene_name": "TY2B-C",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P25384",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P25384"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "P25384",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P25384"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P25384",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P25384"
}
]
},
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "P25384",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P25384"
}
]
}
]
},
{
"uniprot_ac": "P25615",
"gene_name": "POL4",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P25615",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P25615"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "P25615",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P25615"
}
]
}
]
},
{
"uniprot_ac": "P26019",
"gene_name": "PolA1",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P26019",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P26019"
}
]
},
{
"ec_number": "3.1.11.-",
"activity": "",
"evidence": [
{
"id": "P26019",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P26019"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "P26019",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P26019"
}
]
}
]
},
{
"uniprot_ac": "P28340",
"gene_name": "POLD1",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P28340",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P28340"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "P28340",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P28340"
}
]
},
{
"ec_number": "3.1.11.-",
"activity": "",
"evidence": [
{
"id": "P28340",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P28340"
}
]
}
]
},
{
"uniprot_ac": "P33609",
"gene_name": "Pola1",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P33609",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P33609"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "P33609",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P33609"
}
]
}
]
},
{
"uniprot_ac": "P33991",
"gene_name": "MCM4",
"activity": [
{
"ec_number": "3.6.4.12",
"activity": "ATP + H2O = ADP + H(+) + phosphate.",
"evidence": [
{
"id": "P33991",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P33991"
}
]
},
{
"ec_number": "3.6.4.12",
"activity": "",
"evidence": [
{
"id": "P33991",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P33991"
}
]
}
]
},
{
"uniprot_ac": "P33992",
"gene_name": "MCM5",
"activity": [
{
"ec_number": "3.6.4.12",
"activity": "ATP + H2O = ADP + H(+) + phosphate.",
"evidence": [
{
"id": "P33992",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P33992"
}
]
},
{
"ec_number": "3.6.4.12",
"activity": "",
"evidence": [
{
"id": "P33992",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P33992"
}
]
}
]
},
{
"uniprot_ac": "P33993",
"gene_name": "MCM7",
"activity": [
{
"ec_number": "3.6.4.12",
"activity": "ATP + H2O = ADP + H(+) + phosphate.",
"evidence": [
{
"id": "P33993",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P33993"
}
]
},
{
"ec_number": "3.6.4.12",
"activity": "",
"evidence": [
{
"id": "P33993",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P33993"
}
]
}
]
},
{
"uniprot_ac": "P39748",
"gene_name": "FEN1",
"activity": [
{
"ec_number": "3.1.-.-",
"activity": "",
"evidence": [
{
"id": "P39748",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P39748"
}
]
}
]
},
{
"uniprot_ac": "P39985",
"gene_name": "POL5",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P39985",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P39985"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "P39985",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P39985"
}
]
}
]
},
{
"uniprot_ac": "P46957",
"gene_name": "POL31",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P46957",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P46957"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "P46957",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P46957"
}
]
}
]
},
{
"uniprot_ac": "P47024",
"gene_name": "TY4B-J",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P47024",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P47024"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "P47024",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P47024"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P47024",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P47024"
}
]
},
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "P47024",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P47024"
}
]
}
]
},
{
"uniprot_ac": "P47098",
"gene_name": "TY1B-JR1",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "P47098",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P47098"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P47098",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P47098"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "P47098",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P47098"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P47098",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P47098"
}
]
}
]
},
{
"uniprot_ac": "P47100",
"gene_name": "TY1B-JR2",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "P47100",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P47100"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P47100",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P47100"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "P47100",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P47100"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P47100",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P47100"
}
]
}
]
},
{
"uniprot_ac": "P49642",
"gene_name": "PRIM1",
"activity": [
{
"ec_number": "2.7.7.-",
"activity": "",
"evidence": [
{
"id": "P49642",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49642"
}
]
},
{
"ec_number": "2.7.7.102",
"activity": "ssDNA + n dNTP = ssDNA/pppdN(pdN)n-1 hybrid + (n-1) diphosphate.",
"evidence": [
{
"id": "P49642",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49642"
}
]
},
{
"ec_number": "2.7.7.102",
"activity": "",
"evidence": [
{
"id": "P49642",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49642"
}
]
}
]
},
{
"uniprot_ac": "P49736",
"gene_name": "MCM2",
"activity": [
{
"ec_number": "3.6.4.12",
"activity": "ATP + H2O = ADP + H(+) + phosphate.",
"evidence": [
{
"id": "P49736",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49736"
}
]
},
{
"ec_number": "3.6.4.12",
"activity": "",
"evidence": [
{
"id": "P49736",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P49736"
}
]
}
]
},
{
"uniprot_ac": "P52431",
"gene_name": "Pold1",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P52431",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P52431"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "P52431",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P52431"
}
]
},
{
"ec_number": "3.1.11.-",
"activity": "",
"evidence": [
{
"id": "P52431",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P52431"
}
]
}
]
},
{
"uniprot_ac": "P54098",
"gene_name": "POLG",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P54098",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54098"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "P54098",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54098"
}
]
}
]
},
{
"uniprot_ac": "P54099",
"gene_name": "Polg",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P54099",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54099"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "P54099",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54099"
}
]
}
]
},
{
"uniprot_ac": "P54358",
"gene_name": "PolD1",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P54358",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54358"
}
]
},
{
"ec_number": "3.1.11.-",
"activity": "",
"evidence": [
{
"id": "P54358",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54358"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "P54358",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54358"
}
]
}
]
},
{
"uniprot_ac": "P63128",
"gene_name": "ERVK-9",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P63128",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P63128"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "P63128",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P63128"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P63128",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P63128"
}
]
},
{
"ec_number": "3.4.23.50",
"activity": "Processing at the authentic HIV-1 PR recognition site and release of the mature p17 matrix and the p24 capsid protein, as a result of the cleavage of the -SQNY-|-PIVQ- cleavage site.",
"evidence": [
{
"id": "P63128",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P63128"
}
]
}
]
},
{
"uniprot_ac": "P63132",
"gene_name": "HERVK_113",
"activity": [
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P63132",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P63132"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "P63132",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P63132"
}
]
}
]
},
{
"uniprot_ac": "P63133",
"gene_name": "ERVK-8",
"activity": [
{
"ec_number": "3.4.23.50",
"activity": "Processing at the authentic HIV-1 PR recognition site and release of the mature p17 matrix and the p24 capsid protein, as a result of the cleavage of the -SQNY-|-PIVQ- cleavage site.",
"evidence": [
{
"id": "P63133",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P63133"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P63133",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P63133"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "P63133",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P63133"
}
]
}
]
},
{
"uniprot_ac": "P63135",
"gene_name": "ERVK-7",
"activity": [
{
"ec_number": "3.4.23.50",
"activity": "Processing at the authentic HIV-1 PR recognition site and release of the mature p17 matrix and the p24 capsid protein, as a result of the cleavage of the -SQNY-|-PIVQ- cleavage site.",
"evidence": [
{
"id": "P63135",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P63135"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P63135",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P63135"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "P63135",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P63135"
}
]
}
]
},
{
"uniprot_ac": "P63136",
"gene_name": "ERVK-25",
"activity": [
{
"ec_number": "3.4.23.50",
"activity": "Processing at the authentic HIV-1 PR recognition site and release of the mature p17 matrix and the p24 capsid protein, as a result of the cleavage of the -SQNY-|-PIVQ- cleavage site.",
"evidence": [
{
"id": "P63136",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P63136"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "P63136",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P63136"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "P63136",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P63136"
}
]
}
]
},
{
"uniprot_ac": "Q03434",
"gene_name": "TY1B-ML2",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "Q03434",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03434"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q03434",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03434"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q03434",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03434"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q03434",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03434"
}
]
}
]
},
{
"uniprot_ac": "Q03494",
"gene_name": "TY2B-DR2",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q03494",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03494"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q03494",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03494"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q03494",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03494"
}
]
},
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "Q03494",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03494"
}
]
}
]
},
{
"uniprot_ac": "Q03612",
"gene_name": "TY1B-ER1",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "Q03612",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03612"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q03612",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03612"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q03612",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03612"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q03612",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03612"
}
]
}
]
},
{
"uniprot_ac": "Q03619",
"gene_name": "TY1B-ER2",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "Q03619",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03619"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q03619",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03619"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q03619",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03619"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q03619",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03619"
}
]
}
]
},
{
"uniprot_ac": "Q03855",
"gene_name": "TY1B-DR1",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "Q03855",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03855"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q03855",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03855"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q03855",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03855"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q03855",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03855"
}
]
}
]
},
{
"uniprot_ac": "Q04049",
"gene_name": "RAD30",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q04049",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04049"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q04049",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04049"
}
]
}
]
},
{
"uniprot_ac": "Q04214",
"gene_name": "TY1B-MR1",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "Q04214",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04214"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q04214",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04214"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q04214",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04214"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q04214",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04214"
}
]
}
]
},
{
"uniprot_ac": "Q04670",
"gene_name": "TY1B-MR2",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "Q04670",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04670"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q04670",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04670"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q04670",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04670"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q04670",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04670"
}
]
}
]
},
{
"uniprot_ac": "Q04711",
"gene_name": "TY1B-ML1",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "Q04711",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04711"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q04711",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04711"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q04711",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04711"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q04711",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04711"
}
]
}
]
},
{
"uniprot_ac": "Q06163",
"gene_name": "EST2",
"activity": [
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q06163",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q06163"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "",
"evidence": [
{
"id": "Q06163",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q06163"
}
]
}
]
},
{
"uniprot_ac": "Q07791",
"gene_name": "TY2B-DR3",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "Q07791",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q07791"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q07791",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q07791"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q07791",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q07791"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q07791",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q07791"
}
]
}
]
},
{
"uniprot_ac": "Q07793",
"gene_name": "TY1B-DR4",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "Q07793",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q07793"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q07793",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q07793"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q07793",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q07793"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q07793",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q07793"
}
]
}
]
},
{
"uniprot_ac": "Q07864",
"gene_name": "POLE",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q07864",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q07864"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q07864",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q07864"
}
]
},
{
"ec_number": "3.1.11.-",
"activity": "",
"evidence": [
{
"id": "Q07864",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q07864"
}
]
}
]
},
{
"uniprot_ac": "Q12088",
"gene_name": "TY1B-LR1",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "Q12088",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12088"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q12088",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12088"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q12088",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12088"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q12088",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12088"
}
]
}
]
},
{
"uniprot_ac": "Q12112",
"gene_name": "TY1B-NL1",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "Q12112",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12112"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q12112",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12112"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q12112",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12112"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q12112",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12112"
}
]
}
]
},
{
"uniprot_ac": "Q12113",
"gene_name": "TY2B-OR1",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q12113",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12113"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q12113",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12113"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q12113",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12113"
}
]
},
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "Q12113",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12113"
}
]
}
]
},
{
"uniprot_ac": "Q12141",
"gene_name": "TY1B-GR1",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "Q12141",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12141"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q12141",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12141"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q12141",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12141"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q12141",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12141"
}
]
}
]
},
{
"uniprot_ac": "Q12193",
"gene_name": "TY1B-BR",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "Q12193",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12193"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q12193",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12193"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q12193",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12193"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q12193",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12193"
}
]
}
]
},
{
"uniprot_ac": "Q12269",
"gene_name": "TY1B-GR2",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "Q12269",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12269"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q12269",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12269"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q12269",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12269"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q12269",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12269"
}
]
}
]
},
{
"uniprot_ac": "Q12273",
"gene_name": "TY1B-OL",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "Q12273",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12273"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q12273",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12273"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q12273",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12273"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q12273",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12273"
}
]
}
]
},
{
"uniprot_ac": "Q12316",
"gene_name": "TY1B-GR3",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "Q12316",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12316"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q12316",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12316"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q12316",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12316"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q12316",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12316"
}
]
}
]
},
{
"uniprot_ac": "Q12414",
"gene_name": "TY1B-PL",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "Q12414",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12414"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q12414",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12414"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q12414",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12414"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q12414",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12414"
}
]
}
]
},
{
"uniprot_ac": "Q12472",
"gene_name": "TY2B-DR1",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q12472",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12472"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q12472",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12472"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q12472",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12472"
}
]
},
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "Q12472",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12472"
}
]
}
]
},
{
"uniprot_ac": "Q12490",
"gene_name": "TY1B-BL",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "Q12490",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12490"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q12490",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12490"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q12490",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12490"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q12490",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12490"
}
]
}
]
},
{
"uniprot_ac": "Q12491",
"gene_name": "TY2B-B",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q12491",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12491"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q12491",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12491"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q12491",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12491"
}
]
},
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "Q12491",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12491"
}
]
}
]
},
{
"uniprot_ac": "Q12501",
"gene_name": "TY2B-OR2",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q12501",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12501"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q12501",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12501"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q12501",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12501"
}
]
},
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "Q12501",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12501"
}
]
}
]
},
{
"uniprot_ac": "Q14566",
"gene_name": "MCM6",
"activity": [
{
"ec_number": "3.6.4.12",
"activity": "ATP + H2O = ADP + H(+) + phosphate.",
"evidence": [
{
"id": "Q14566",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q14566"
}
]
},
{
"ec_number": "3.6.4.12",
"activity": "",
"evidence": [
{
"id": "Q14566",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q14566"
}
]
}
]
},
{
"uniprot_ac": "Q1ZXF2",
"gene_name": "polB",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q1ZXF2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q1ZXF2"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q1ZXF2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q1ZXF2"
}
]
}
]
},
{
"uniprot_ac": "Q27607",
"gene_name": "PolG1",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q27607",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q27607"
}
]
},
{
"ec_number": "3.1.11.-",
"activity": "",
"evidence": [
{
"id": "Q27607",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q27607"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q27607",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q27607"
}
]
}
]
},
{
"uniprot_ac": "Q54B44",
"gene_name": "",
"activity": [
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q54B44",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54B44"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "",
"evidence": [
{
"id": "Q54B44",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54B44"
}
]
}
]
},
{
"uniprot_ac": "Q54N97",
"gene_name": "pold1",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q54N97",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54N97"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q54N97",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54N97"
}
]
}
]
},
{
"uniprot_ac": "Q54RD4",
"gene_name": "pole",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q54RD4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54RD4"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q54RD4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54RD4"
}
]
}
]
},
{
"uniprot_ac": "Q54SV8",
"gene_name": "pola1",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q54SV8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54SV8"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q54SV8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54SV8"
}
]
}
]
},
{
"uniprot_ac": "Q55AZ3",
"gene_name": "polZ",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q55AZ3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q55AZ3"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q55AZ3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q55AZ3"
}
]
}
]
},
{
"uniprot_ac": "Q5RKI3",
"gene_name": "Poll",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q5RKI3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5RKI3"
}
]
},
{
"ec_number": "4.2.99.-",
"activity": "",
"evidence": [
{
"id": "Q5RKI3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5RKI3"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q5RKI3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5RKI3"
}
]
}
]
},
{
"uniprot_ac": "Q61493",
"gene_name": "Rev3l",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q61493",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q61493"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q61493",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q61493"
}
]
}
]
},
{
"uniprot_ac": "Q673L6",
"gene_name": "Tert",
"activity": [
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q673L6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q673L6"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "",
"evidence": [
{
"id": "Q673L6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q673L6"
}
]
}
]
},
{
"uniprot_ac": "Q6R3M4",
"gene_name": "Poli",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q6R3M4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6R3M4"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q6R3M4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6R3M4"
}
]
}
]
},
{
"uniprot_ac": "Q7LHG5",
"gene_name": "TY3B-I",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q7LHG5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7LHG5"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q7LHG5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7LHG5"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q7LHG5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7LHG5"
}
]
},
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "Q7LHG5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7LHG5"
}
]
}
]
},
{
"uniprot_ac": "Q7TQ07",
"gene_name": "Poln",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q7TQ07",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7TQ07"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q7TQ07",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7TQ07"
}
]
}
]
},
{
"uniprot_ac": "Q7Z5Q5",
"gene_name": "POLN",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q7Z5Q5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z5Q5"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q7Z5Q5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z5Q5"
}
]
}
]
},
{
"uniprot_ac": "Q8CGS6",
"gene_name": "Polq",
"activity": [
{
"ec_number": "3.6.4.12",
"activity": "ATP + H2O = ADP + H(+) + phosphate.",
"evidence": [
{
"id": "Q8CGS6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8CGS6"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q8CGS6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8CGS6"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q8CGS6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8CGS6"
}
]
}
]
},
{
"uniprot_ac": "Q8K409",
"gene_name": "Polb",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q8K409",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8K409"
}
]
},
{
"ec_number": "4.2.99.18",
"activity": "2'-deoxyribonucleotide-(2'-deoxyribose 5'-phosphate)-2'-deoxyribonucleotide-DNA = a 3'-end 2'-deoxyribonucleotide-(2,3-dehydro-2,3-deoxyribose 5'-phosphate)-DNA + a 5'-end 5'-monophospho-2'-deoxyribonucleoside-DNA + H(+).",
"evidence": [
{
"id": "Q8K409",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8K409"
}
]
},
{
"ec_number": "4.2.99.-",
"activity": "",
"evidence": [
{
"id": "Q8K409",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8K409"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q8K409",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8K409"
}
]
}
]
},
{
"uniprot_ac": "Q92393",
"gene_name": "TY1B-OR",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "Q92393",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q92393"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q92393",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q92393"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q92393",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q92393"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q92393",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q92393"
}
]
}
]
},
{
"uniprot_ac": "Q99231",
"gene_name": "TY1B-DR3",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "Q99231",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99231"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q99231",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99231"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q99231",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99231"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q99231",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99231"
}
]
}
]
},
{
"uniprot_ac": "Q99315",
"gene_name": "TY3B-G",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q99315",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99315"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q99315",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99315"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q99315",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99315"
}
]
},
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "Q99315",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99315"
}
]
}
]
},
{
"uniprot_ac": "Q99337",
"gene_name": "TY1B-NL2",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "Q99337",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99337"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q99337",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99337"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q99337",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99337"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q99337",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99337"
}
]
}
]
},
{
"uniprot_ac": "Q9BXR3",
"gene_name": "ERVK-6",
"activity": [
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q9BXR3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9BXR3"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q9BXR3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9BXR3"
}
]
},
{
"ec_number": "3.4.23.50",
"activity": "Processing at the authentic HIV-1 PR recognition site and release of the mature p17 matrix and the p24 capsid protein, as a result of the cleavage of the -SQNY-|-PIVQ- cleavage site.",
"evidence": [
{
"id": "Q9BXR3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9BXR3"
}
]
}
]
},
{
"uniprot_ac": "Q9GSR1",
"gene_name": "PolZ1",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q9GSR1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9GSR1"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q9GSR1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9GSR1"
}
]
}
]
},
{
"uniprot_ac": "Q9JIW4",
"gene_name": "Polm",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q9JIW4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9JIW4"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q9JIW4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9JIW4"
}
]
}
]
},
{
"uniprot_ac": "Q9JJN0",
"gene_name": "Polh",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q9JJN0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9JJN0"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q9JJN0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9JJN0"
}
]
}
]
},
{
"uniprot_ac": "Q9NP87",
"gene_name": "POLM",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q9NP87",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9NP87"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q9NP87",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9NP87"
}
]
}
]
},
{
"uniprot_ac": "Q9QC07",
"gene_name": "ERVK-18",
"activity": [
{
"ec_number": "3.4.23.50",
"activity": "Processing at the authentic HIV-1 PR recognition site and release of the mature p17 matrix and the p24 capsid protein, as a result of the cleavage of the -SQNY-|-PIVQ- cleavage site.",
"evidence": [
{
"id": "Q9QC07",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9QC07"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q9QC07",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9QC07"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q9QC07",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9QC07"
}
]
}
]
},
{
"uniprot_ac": "Q9QUG2",
"gene_name": "Polk",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q9QUG2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9QUG2"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q9QUG2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9QUG2"
}
]
}
]
},
{
"uniprot_ac": "Q9QXE2",
"gene_name": "Poll",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q9QXE2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9QXE2"
}
]
},
{
"ec_number": "4.2.99.-",
"activity": "",
"evidence": [
{
"id": "Q9QXE2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9QXE2"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q9QXE2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9QXE2"
}
]
}
]
},
{
"uniprot_ac": "Q9QYV8",
"gene_name": "Polg",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q9QYV8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9QYV8"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q9QYV8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9QYV8"
}
]
}
]
},
{
"uniprot_ac": "Q9UBT6",
"gene_name": "POLK",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q9UBT6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UBT6"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q9UBT6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UBT6"
}
]
}
]
},
{
"uniprot_ac": "Q9UGP5",
"gene_name": "POLL",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q9UGP5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UGP5"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q9UGP5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UGP5"
}
]
},
{
"ec_number": "4.2.99.-",
"activity": "",
"evidence": [
{
"id": "Q9UGP5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UGP5"
}
]
}
]
},
{
"uniprot_ac": "Q9UJA3",
"gene_name": "MCM8",
"activity": [
{
"ec_number": "3.6.4.12",
"activity": "ATP + H2O = ADP + H(+) + phosphate.",
"evidence": [
{
"id": "Q9UJA3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UJA3"
}
]
},
{
"ec_number": "3.6.4.12",
"activity": "",
"evidence": [
{
"id": "Q9UJA3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UJA3"
}
]
}
]
},
{
"uniprot_ac": "Q9UNA4",
"gene_name": "POLI",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q9UNA4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UNA4"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q9UNA4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UNA4"
}
]
}
]
},
{
"uniprot_ac": "Q9UQG0",
"gene_name": "ERVK-11",
"activity": [
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q9UQG0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UQG0"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q9UQG0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UQG0"
}
]
}
]
},
{
"uniprot_ac": "Q9VCN1",
"gene_name": "PolE1",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q9VCN1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VCN1"
}
]
},
{
"ec_number": "3.1.11.-",
"activity": "",
"evidence": [
{
"id": "Q9VCN1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VCN1"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q9VCN1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VCN1"
}
]
}
]
},
{
"uniprot_ac": "Q9VHV1",
"gene_name": "PolI",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q9VHV1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VHV1"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q9VHV1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VHV1"
}
]
}
]
},
{
"uniprot_ac": "Q9VNX1",
"gene_name": "PolH",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q9VNX1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VNX1"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q9VNX1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VNX1"
}
]
}
]
},
{
"uniprot_ac": "Q9WJR5",
"gene_name": "ERVK-19",
"activity": [
{
"ec_number": "3.4.23.50",
"activity": "Processing at the authentic HIV-1 PR recognition site and release of the mature p17 matrix and the p24 capsid protein, as a result of the cleavage of the -SQNY-|-PIVQ- cleavage site.",
"evidence": [
{
"id": "Q9WJR5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WJR5"
}
]
},
{
"ec_number": "2.7.7.49",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q9WJR5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WJR5"
}
]
},
{
"ec_number": "3.1.26.4",
"activity": "Endonucleolytic cleavage to 5'-phosphomonoester.",
"evidence": [
{
"id": "Q9WJR5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WJR5"
}
]
}
]
},
{
"uniprot_ac": "Q9WVF7",
"gene_name": "Pole",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q9WVF7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WVF7"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q9WVF7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WVF7"
}
]
},
{
"ec_number": "3.1.11.-",
"activity": "",
"evidence": [
{
"id": "Q9WVF7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WVF7"
}
]
}
]
},
{
"uniprot_ac": "Q9Y253",
"gene_name": "POLH",
"activity": [
{
"ec_number": "2.7.7.7",
"activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).",
"evidence": [
{
"id": "Q9Y253",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y253"
}
]
},
{
"ec_number": "2.7.7.7",
"activity": "",
"evidence": [
{
"id": "Q9Y253",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y253"
}
]
}
]
}
],
"biomarkers": [],
"synthesized_glycans": [],
"cluster_types": [
{
"name": "isoformset.uniprotkb",
"label": "Isoforms"
},
{
"name": "homologset.mgi",
"label": "MGI Homologs"
}
],
"sequence_features": {
"n_linked_sites": [],
"o_linked_sites": [],
"snv_sites": [
116,
1356
],
"glycation_sites": [],
"phosphorylation_sites": [
129,
174,
186,
190,
195,
198,
209,
212,
219,
406
],
"sequon_annotation_sites": [
{
"start_pos": 1011,
"end_pos": 1013
},
{
"start_pos": 1125,
"end_pos": 1127
},
{
"start_pos": 1185,
"end_pos": 1187
},
{
"start_pos": 1203,
"end_pos": 1205
},
{
"start_pos": 1355,
"end_pos": 1357
},
{
"start_pos": 1450,
"end_pos": 1452
},
{
"start_pos": 480,
"end_pos": 482
},
{
"start_pos": 683,
"end_pos": 685
}
]
},
"section_stats": [
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 1
},
{
"field": "total_sites",
"count": 1
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 1
},
{
"field": "o_linked_glycan_sites",
"count": 1
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment"
]
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 1
},
{
"field": "total_sites",
"count": 1
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 1
},
{
"field": "o_linked_glycan_sites",
"count": 1
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment"
]
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 10
},
{
"field": "total_sites",
"count": 10
}
],
"sort_fields": [
"start_pos",
"end_pos",
"kinase_uniprot_canonical_ac",
"kinase_gene_name",
"residue",
"comment",
"site_lbl"
]
},
{
"table_id": "snv",
"table_stats": [
{
"field": "total",
"count": 2
},
{
"field": "total_sites",
"count": 2
}
],
"sort_fields": [
"start_pos",
"end_pos",
"subjects_tested",
"subjects_positive",
"frequency",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl"
]
},
{
"table_id": "snv_disease",
"table_stats": [
{
"field": "total",
"count": 2
},
{
"field": "total_sites",
"count": 2
}
],
"sort_fields": [
"start_pos",
"end_pos",
"subjects_tested",
"subjects_positive",
"frequency",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl"
]
},
{
"table_id": "snv_non_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "publication",
"table_stats": [
{
"field": "total",
"count": 108
}
],
"sort_fields": [
"title",
"journal",
"date",
"authors"
]
}
]
}