{ "uniprot_canonical_ac": "P09651-1", "uniprot_ac": "P09651", "uniprot_id": "ROA1_HUMAN", "mass": { "chemical_mass": 38747.0, "monoisotopic_mass": 38747.0 }, "refseq": { "ac": "NP_002127", "name": "heterogeneous nuclear ribonucleoprotein A1 isoform a", "summary": "This gene encodes a member of a family of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs), which are RNA-binding proteins that associate with pre-mRNAs in the nucleus and influence pre-mRNA processing, as well as other aspects of mRNA metabolism and transport. The protein encoded by this gene is one of the most abundant core proteins of hnRNP complexes and plays a key role in the regulation of alternative splicing. Mutations in this gene have been observed in individuals with amyotrophic lateral sclerosis 20. Multiple alternatively spliced transcript variants have been found. There are numerous pseudogenes of this gene distributed throughout the genome. [provided by RefSeq, Feb 2016].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002127" }, "gene_names": [ { "name": "HNRNPA1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P09651", "id": "P09651" }, { "name": "ALS19; ALS20; hnRNP A1; hnRNP-A1; HNRPA1; HNRPA1L3; IBMPFD3; MPD3; UP 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002127", "id": "NP_002127" }, { "name": "HNRNPA1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002127", "id": "NP_002127" }, { "name": "HNRPA1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P09651", "id": "P09651" } ], "protein_names": [ { "name": "Heterogeneous nuclear ribonucleoprotein A1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P09651" }, { "name": "Helix-destabilizing protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P09651" }, { "name": "Single-strand RNA-binding protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P09651" }, { "name": "heterogeneous nuclear ribonucleoprotein A1 isoform a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002127", "id": "NP_002127" }, { "name": "heterogeneous nuclear ribonucleoprotein B2 protein; nuclear ribonucleoprotein particle A1 protein; helix-destabilizing protein; single-strand DNA-binding protein UP1; heterogeneous nuclear ribonucleoprotein core protein A1; heterogeneous nuclear ribonucleoprotein A1B protein; hnRNP core protein A1-like 3; single-strand RNA-binding protein; putative heterogeneous nuclear ribonucleoprotein A1-like 3; epididymis secretory sperm binding protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002127", "id": "NP_002127" }, { "name": "hnRNP A1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P09651" }, { "name": "hnRNP core protein A1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P09651" } ], "function": [ { "annotation": "(Microbial infection) Cleavage by Enterovirus 71 protease 3C results in increased translation of apoptosis protease activating factor APAF1, leading to apoptosis.", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651#function" }, { "database": "PubMed", "id": "17229681", "url": "https://glygen.org/publication/PubMed/17229681" } ] }, { "annotation": "(Microbial infection) May play a role in HCV RNA replication.", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651#function" }, { "database": "PubMed", "id": "17229681", "url": "https://glygen.org/publication/PubMed/17229681" } ] }, { "annotation": "HnRNP A1 Suppresses the Odontogenic Differentiation and the Inclusion of RUNX2 Exon 5 of Dental Mesenchymal Cells.", "evidence": [ { "database": "RefSeq", "id": "NP_002127", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002127" }, { "database": "PubMed", "id": "37525910", "url": "https://glygen.org/publication/PubMed/37525910" } ] }, { "annotation": "Involved in the packaging of pre-mRNA into hnRNP particles, transport of poly(A) mRNA from the nucleus to the cytoplasm and modulation of splice site selection. Plays a role in the splicing of pyruvate kinase PKM by binding repressively to sequences flanking PKM exon 9, inhibiting exon 9 inclusion and resulting in exon 10 inclusion and production of the PKM M2 isoform. Binds to the IRES and thereby inhibits the translation of the apoptosis protease activating factor APAF1. May bind to specific miRNA hairpins.", "evidence": [ { "database": "UniProtKB", "id": "F8W646", "url": "https://www.uniprot.org/uniprot/F8W646#function" }, { "database": "UniProtKB", "id": "ARBA00037253", "url": "https://www.uniprot.org/uniprot/ARBA00037253#function" }, { "database": "UniProtKB", "id": "F8W6I7", "url": "https://www.uniprot.org/uniprot/F8W6I7#function" }, { "database": "UniProtKB", "id": "F8VZ49", "url": "https://www.uniprot.org/uniprot/F8VZ49#function" }, { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651#function" }, { "database": "PubMed", "id": "17371836", "url": "https://glygen.org/publication/PubMed/17371836" }, { "database": "PubMed", "id": "28431233", "url": "https://glygen.org/publication/PubMed/28431233" }, { "database": "PubMed", "id": "31498791", "url": "https://glygen.org/publication/PubMed/31498791" }, { "database": "PubMed", "id": "20010808", "url": "https://glygen.org/publication/PubMed/20010808" }, { "database": "UniProtKB", "id": "A0A7I2V2L6", "url": "https://www.uniprot.org/uniprot/A0A7I2V2L6#function" }, { "database": "UniProtKB", "id": "A0A7I2V3W0", "url": "https://www.uniprot.org/uniprot/A0A7I2V3W0#function" }, { "database": "UniProtKB", "id": "A0A7I2V3R8", "url": "https://www.uniprot.org/uniprot/A0A7I2V3R8#function" } ] }, { "annotation": "N6-methyladenosine modification of OIP5-AS1 promotes glycolysis, tumorigenesis, and metastasis of gastric cancer by inhibiting Trim21-mediated hnRNPA1 ubiquitination and degradation.", "evidence": [ { "database": "RefSeq", "id": "NP_002127", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002127" }, { "database": "PubMed", "id": "37897508", "url": "https://glygen.org/publication/PubMed/37897508" } ] }, { "annotation": "The mechanism of UP1 binding and unfolding of human telomeric DNA G-quadruplex.", "evidence": [ { "database": "RefSeq", "id": "NP_002127", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002127" }, { "database": "PubMed", "id": "37717939", "url": "https://glygen.org/publication/PubMed/37717939" } ] }, { "annotation": "This gene encodes a member of a family of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs), which are RNA-binding proteins that associate with pre-mRNAs in the nucleus and influence pre-mRNA processing, as well as other aspects of mRNA metabolism and transport. The protein encoded by this gene is one of the most abundant core proteins of hnRNP complexes and plays a key role in the regulation of alternative splicing. Mutations in this gene have been observed in individuals with amyotrophic lateral sclerosis 20. Multiple alternatively spliced transcript variants have been found. There are numerous pseudogenes of this gene distributed throughout the genome. [provided by RefSeq, Feb 2016].", "evidence": [ { "database": "RefSeq", "id": "NP_002127", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002127" } ] } ], "disease": [ { "disease_id": "DOID:0060211", "recommended_name": { "id": "DOID:0060211", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060211", "name": "amyotrophic lateral sclerosis type 20", "description": "An amyotrophic lateral sclerosis with juvenile onset that has_material_basis_in mutation in the HNRNPA1 gene on chromosome 12." }, "synonyms": [ { "id": "DOID:0060211", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060211", "name": "ALS20", "description": "" }, { "id": "DOID:0060211", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060211", "name": "amyotrophic lateral sclerosis 20", "description": "" }, { "id": "MONDO:0014181", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014181", "name": "amyotrophic lateral sclerosis type 20", "description": "Any amyotrophic lateral sclerosis in which the cause of the disease is a mutation in the HNRNPA1 gene." }, { "id": "MONDO:0014181", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014181", "name": "ALS20", "description": "" }, { "id": "MONDO:0014181", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014181", "name": "HNRNPA1 amyotrophic lateral sclerosis", "description": "" }, { "id": "MONDO:0014181", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014181", "name": "amyotrophic lateral sclerosis 20", "description": "" }, { "id": "MONDO:0014181", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014181", "name": "amyotrophic lateral sclerosis caused by mutation in HNRNPA1", "description": "" }, { "id": "MONDO:0014181", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014181", "name": "amyotrophic lateral sclerosis type 20", "description": "" }, { "id": "MIM:615426", "resource": "MIM", "url": "https://www.omim.org/entry/615426", "name": "Amyotrophic lateral sclerosis 20", "description": "Amyotrophic lateral sclerosis 20" } ], "evidence": [ { "id": "615426", "database": "MIM", "url": "https://www.omim.org/entry/615426" } ] }, { "disease_id": "DOID:0111386", "recommended_name": { "id": "DOID:0111386", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111386", "name": "inclusion body myopathy with early-onset Paget disease of bone with or without frontotemporal dementia 3", "description": "An inclusion body myopathy with Paget disease of bone and frontotemporal dementia that has_material_basis_in heterozygous mutation in the HNRNPA1 gene on chromosome 12q13.13." }, "synonyms": [ { "id": "DOID:0111386", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111386", "name": "IBMPFD3", "description": "" }, { "id": "DOID:0111386", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111386", "name": "MSP3", "description": "" }, { "id": "DOID:0111386", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111386", "name": "multisystem proteinopathy 3", "description": "" }, { "id": "MONDO:0014179", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014179", "name": "inclusion body myopathy with early-onset Paget disease with or without frontotemporal dementia 3", "description": "Any inclusion body myopathy with Paget disease of bone and frontotemporal dementia in which the cause of the disease is a mutation in the HNRNPA1 gene." }, { "id": "MONDO:0014179", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014179", "name": "HNRNPA1 inclusion body myopathy with Paget disease of bone and frontotemporal dementia", "description": "" }, { "id": "MONDO:0014179", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014179", "name": "inclusion body myopathy with Paget disease of bone and frontotemporal dementia caused by mutation in HNRNPA1", "description": "" }, { "id": "MONDO:0014179", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014179", "name": "inclusion body myopathy with early-onset Paget disease with or without frontotemporal dementia 3", "description": "" }, { "id": "MONDO:0014179", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014179", "name": "inclusion body myopathy with early-onset Paget disease with or without frontotemporal dementia type 3", "description": "" }, { "id": "MONDO:0014179", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014179", "name": "inclusion body myopathy with early-onset paget disease without frontotemporal dementia 3", "description": "" }, { "id": "MONDO:0014179", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014179", "name": "IBMPFD3", "description": "" }, { "id": "MONDO:0014179", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014179", "name": "multisystem Proteinopathy 3", "description": "" }, { "id": "MIM:615424", "resource": "MIM", "url": "https://www.omim.org/entry/615424", "name": "Inclusion body myopathy with early-onset Paget disease with or without frontotemporal dementia 3", "description": "Inclusion body myopathy with early-onset Paget disease with or without frontotemporal dementia 3" } ], "evidence": [ { "id": "615424", "database": "MIM", "url": "https://www.omim.org/entry/615424" } ] } ], "snv": [ { "evidence": [ { "id": "P09651", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P09651" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 101, "end_pos": 101, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "H", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (HLT->NLT).", "chr_id": "12", "chr_pos": "54282111", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "H101", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs527593637", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs527593637" }, { "id": "rs527593637", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs527593637" }, { "id": "rs527593637", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs527593637" }, { "id": "rs527593637", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs527593637" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 188, "end_pos": 188, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SAS->NAS).", "chr_id": "12", "chr_pos": "54282466", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.000399", "site_lbl": "S188", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs759577941", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759577941" }, { "id": "rs759577941", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759577941" }, { "id": "rs759577941", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs759577941#frequency_tab" }, { "id": "rs759577941", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs759577941" }, { "id": "rs769315031", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769315031" }, { "id": "rs769315031", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769315031" }, { "id": "rs769315031", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769315031" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 217, "end_pos": 217, "sequence_org": "G", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NFG->NFS).", "chr_id": "12", "chr_pos": "54282638", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "G217", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs483353021", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs483353021" }, { "id": "rs483353021", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs483353021" }, { "id": "rs483353021", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs483353021" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 22, "end_pos": 22, "sequence_org": "S", "sequence_mut": "G", "comment": "Somatic mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "12", "chr_pos": "54283835", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S22", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs751747501", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751747501" }, { "id": "rs751747501", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751747501" }, { "id": "rs751747501", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751747501" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 22, "end_pos": 22, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "12", "chr_pos": "54283868", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S22", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs369321855", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369321855" }, { "id": "rs369321855", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369321855" }, { "id": "rs369321855", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs369321855#frequency_tab" }, { "id": "rs369321855", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs369321855" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 278, "end_pos": 278, "sequence_org": "G", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NQG->NQS).", "chr_id": "12", "chr_pos": "54283931", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "G278", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs778636234", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778636234" }, { "id": "rs778636234", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778636234" }, { "id": "rs778636234", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778636234" }, { "id": "rs778636234", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778636234#frequency_tab" }, { "id": "rs778636234", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778636234" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 294, "end_pos": 294, "sequence_org": "G", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NGG->NGS).", "chr_id": "12", "chr_pos": "54284269", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "G294", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs483353020", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs483353020" }, { "id": "rs483353020", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs483353020" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 2, "end_pos": 2, "sequence_org": "S", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SKS->NKS).", "chr_id": "12", "chr_pos": "54283815", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs778636234", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778636234" }, { "id": "rs778636234", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778636234" }, { "id": "rs778636234", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778636234" }, { "id": "rs778636234", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778636234#frequency_tab" }, { "id": "rs778636234", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778636234" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 307, "end_pos": 307, "sequence_org": "G", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NFG->NFS).", "chr_id": "12", "chr_pos": "54284269", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "G307", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs397518454", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs397518454" }, { "id": "rs397518454", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs397518454" }, { "id": "rs397518454", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs397518454" }, { "id": "rs397518454", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs397518454#frequency_tab" }, { "id": "rs397518454", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs397518454" }, { "id": "23455423", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23455423" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 319, "end_pos": 319, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NYN->NYS).", "chr_id": "12", "chr_pos": "54283860", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "0.000399", "site_lbl": "N319", "disease": [ { "disease_id": "DOID:0060211", "recommended_name": { "id": "DOID:0060211", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060211", "name": "amyotrophic lateral sclerosis type 20", "description": "An amyotrophic lateral sclerosis with juvenile onset that has_material_basis_in mutation in the HNRNPA1 gene on chromosome 12." }, "synonyms": [ { "id": "DOID:0060211", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060211", "name": "ALS20", "description": "" }, { "id": "DOID:0060211", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060211", "name": "amyotrophic lateral sclerosis 20", "description": "" }, { "id": "MONDO:0014181", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014181", "name": "amyotrophic lateral sclerosis type 20", "description": "Any amyotrophic lateral sclerosis in which the cause of the disease is a mutation in the HNRNPA1 gene." }, { "id": "MONDO:0014181", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014181", "name": "ALS20", "description": "" }, { "id": "MONDO:0014181", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014181", "name": "HNRNPA1 amyotrophic lateral sclerosis", "description": "" }, { "id": "MONDO:0014181", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014181", "name": "amyotrophic lateral sclerosis 20", "description": "" }, { "id": "MONDO:0014181", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014181", "name": "amyotrophic lateral sclerosis caused by mutation in HNRNPA1", "description": "" }, { "id": "MONDO:0014181", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014181", "name": "amyotrophic lateral sclerosis type 20", "description": "" }, { "id": "MIM:615426", "resource": "MIM", "url": "https://www.omim.org/entry/615426", "name": "Amyotrophic lateral sclerosis 20", "description": "Amyotrophic lateral sclerosis 20" } ] } ], "keywords": [ "ebi", "germline", "disease" ] }, { "evidence": [ { "id": "rs483353033", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs483353033" }, { "id": "rs483353033", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs483353033" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 337, "end_pos": 337, "sequence_org": "S", "sequence_mut": "G", "comment": "Somatic mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "12", "chr_pos": "54283913", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S337", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs1228952980", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1228952980" }, { "id": "rs1228952980", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1228952980#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 337, "end_pos": 337, "sequence_org": "S", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->I).", "chr_id": "12", "chr_pos": "54283914", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S337", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs483353040", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs483353040" }, { "id": "rs483353040", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs483353040" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 360, "end_pos": 360, "sequence_org": "S", "sequence_mut": "A", "comment": "Somatic mutation passed 1 out of 1 filters: o-glyco-site-loss (S->A).", "chr_id": "12", "chr_pos": "54284272", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S360", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs1592174082", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1592174082" }, { "id": "rs1592174082", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1592174082" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 361, "end_pos": 361, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "12", "chr_pos": "54284275", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S361", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1333745692", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1333745692" }, { "id": "rs1333745692", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1333745692" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 364, "end_pos": 364, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->N).", "chr_id": "12", "chr_pos": "54284285", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S364", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs483353026", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs483353026" }, { "id": "rs483353026", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs483353026" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 365, "end_pos": 365, "sequence_org": "S", "sequence_mut": "G", "comment": "Somatic mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "12", "chr_pos": "54284287", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S365", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs483353030", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs483353030" }, { "id": "rs483353030", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs483353030" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 52, "end_pos": 52, "sequence_org": "K", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KRS->NRS).", "chr_id": "12", "chr_pos": "54283891", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K52", "keywords": [ "ebi", "somatic" ] } ], "mutagenesis": [ { "start_pos": 218, "end_pos": 218, "sequence_org": "R", "sequence_mut": "A", "comment": "Abolishes interaction with HOXB-AS3 peptide; when associated with A-225 and A-232.", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" }, { "database": "PubMed", "id": "28985503", "url": "https://glygen.org/publication/PubMed/28985503" } ] }, { "start_pos": 225, "end_pos": 225, "sequence_org": "R", "sequence_mut": "A", "comment": "Abolishes interaction with HOXB-AS3 peptide; when associated with A-218 and A-232.", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" }, { "database": "PubMed", "id": "28985503", "url": "https://glygen.org/publication/PubMed/28985503" } ] }, { "start_pos": 232, "end_pos": 232, "sequence_org": "R", "sequence_mut": "A", "comment": "Abolishes interaction with HOXB-AS3 peptide; when associated with A-218 and A-225.", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" }, { "database": "PubMed", "id": "28985503", "url": "https://glygen.org/publication/PubMed/28985503" } ] }, { "start_pos": 326, "end_pos": 326, "sequence_org": "G", "sequence_mut": "A", "comment": "No nuclear import nor export.", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" }, { "database": "PubMed", "id": "7730395", "url": "https://glygen.org/publication/PubMed/7730395" } ] }, { "start_pos": 327, "end_pos": 327, "sequence_org": "P", "sequence_mut": "A", "comment": "No nuclear import nor export.", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" }, { "database": "PubMed", "id": "7730395", "url": "https://glygen.org/publication/PubMed/7730395" } ] }, { "start_pos": 334, "end_pos": 335, "sequence_org": "GG", "sequence_mut": "LL", "comment": "Normal nuclear import and export.", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" }, { "database": "PubMed", "id": "7730395", "url": "https://glygen.org/publication/PubMed/7730395" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "99.67", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000135486", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135486" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "99.73", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000135486", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135486" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "99.52", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000135486", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135486" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "99.72", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000135486", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135486" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.74", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000135486", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135486" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "99.73", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000135486", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135486" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "99.77", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000135486", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135486" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "99.76", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000135486", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135486" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "99.74", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000135486", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135486" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "99.67", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000135486", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135486" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "99.03", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000135486", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135486" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "99.71", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000135486", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135486" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "99.75", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000135486", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135486" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P09651", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09651" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P09651", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09651" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P09651", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09651" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P09651", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09651" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P09651", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09651" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P09651", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09651" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P09651", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09651" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P09651", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09651" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P09651", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09651" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P09651", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09651" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P09651", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09651" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P09651", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09651" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "common_name": "Human" } ], "gene": [ { "name": "HNRNPA1", "url": "https://www.uniprot.org/uniprot/P09651", "locus": { "chromosome": "12", "start_pos": 54287088, "end_pos": 54280193, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000135486", "url": "https://www.ensembl.org/id/ENSG00000135486" } ] } } ], "crossref": [ { "id": "ENSG00000135486", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135486", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P09651", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P09651", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd12582", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12582", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd12761", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12761", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL1955709", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1955709", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "HNRNPA1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=HNRNPA1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "3178", "url": "https://www.ncbi.nlm.nih.gov/gene/3178", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "5031", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=5031", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "F8VTQ5", "url": "https://www.ebi.ac.uk/intact/interactors/id:F8VTQ5*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "F8VZ49", "url": "https://www.ebi.ac.uk/intact/interactors/id:F8VZ49*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "F8W6I7", "url": "https://www.ebi.ac.uk/intact/interactors/id:F8W6I7*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "P09651", "url": "https://www.ebi.ac.uk/intact/interactors/id:P09651*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000504", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000504", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012677", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012677", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR021662", "url": "https://www.ebi.ac.uk/interpro/entry/IPR021662", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034516", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034516", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034845", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034845", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035979", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035979", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:3178", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3178", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "164017", "url": "http://www.omim.org/entry/164017", "database": "MIM", "categories": [ "Other" ] }, { "id": "615424", "url": "http://www.omim.org/entry/615424", "database": "MIM", "categories": [ "Other" ] }, { "id": "615426", "url": "http://www.omim.org/entry/615426", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P09651", "url": "https://www.nextprot.org/entry/NX_P09651", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P09651", "url": "https://oglcnac.org/atlas/detail/P09651", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P09651", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09651", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "AGMNMRG", "url": "https://omabrowser.org/oma/group/AGMNMRG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3127428at2759", "url": "http://www.orthodb.org/?query=3127428at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR48026", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48026", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR48026:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48026:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR48026:SF22", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48026:SF22", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1HA1", "url": "https://www.rcsb.org/structure/1HA1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1L3K", "url": "https://www.rcsb.org/structure/1L3K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1PGZ", "url": "https://www.rcsb.org/structure/1PGZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1PO6", "url": "https://www.rcsb.org/structure/1PO6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1U1K", "url": "https://www.rcsb.org/structure/1U1K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1U1L", "url": "https://www.rcsb.org/structure/1U1L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1U1M", "url": "https://www.rcsb.org/structure/1U1M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1U1N", "url": "https://www.rcsb.org/structure/1U1N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1U1O", "url": "https://www.rcsb.org/structure/1U1O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1U1P", "url": "https://www.rcsb.org/structure/1U1P", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1U1Q", "url": "https://www.rcsb.org/structure/1U1Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1U1R", "url": "https://www.rcsb.org/structure/1U1R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1UP1", "url": "https://www.rcsb.org/structure/1UP1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2H4M", "url": "https://www.rcsb.org/structure/2H4M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2LYV", "url": "https://www.rcsb.org/structure/2LYV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2UP1", "url": "https://www.rcsb.org/structure/2UP1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4YOE", "url": "https://www.rcsb.org/structure/4YOE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5MPG", "url": "https://www.rcsb.org/structure/5MPG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5MPL", "url": "https://www.rcsb.org/structure/5MPL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5ZGD", "url": "https://www.rcsb.org/structure/5ZGD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5ZGL", "url": "https://www.rcsb.org/structure/5ZGL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6BXX", "url": "https://www.rcsb.org/structure/6BXX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6DCL", "url": "https://www.rcsb.org/structure/6DCL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6J60", "url": "https://www.rcsb.org/structure/6J60", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7BX7", "url": "https://www.rcsb.org/structure/7BX7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7ZJ2", "url": "https://www.rcsb.org/structure/7ZJ2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00076", "url": "http://pfam.xfam.org/family/PF00076", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF11627", "url": "http://pfam.xfam.org/family/PF11627", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P09651", "url": "https://pharos.nih.gov/targets/P09651", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P09651", "url": "http://purl.obolibrary.org/obo/PR_P09651", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-72203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72203", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9692914", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9692914", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9735869", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9735869", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_002127", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002127", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A7I2V2F1", "url": "https://www.uniprot.org/uniprot/A0A7I2V2F1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2F1-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V2F1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2L6", "url": "https://www.uniprot.org/uniprot/A0A7I2V2L6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2L6-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V2L6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2M7", "url": "https://www.uniprot.org/uniprot/A0A7I2V2M7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2M7-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V2M7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2Q7", "url": "https://www.uniprot.org/uniprot/A0A7I2V2Q7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2Q7-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V2Q7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2R4", "url": "https://www.uniprot.org/uniprot/A0A7I2V2R4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2R4-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V2R4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2W8", "url": "https://www.uniprot.org/uniprot/A0A7I2V2W8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2W8-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V2W8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2X1", "url": "https://www.uniprot.org/uniprot/A0A7I2V2X1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2X1-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V2X1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2Z4", "url": "https://www.uniprot.org/uniprot/A0A7I2V2Z4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2Z4-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V2Z4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V334", "url": "https://www.uniprot.org/uniprot/A0A7I2V334", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V334-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V334-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V360", "url": "https://www.uniprot.org/uniprot/A0A7I2V360", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V360-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V360-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3C7", "url": "https://www.uniprot.org/uniprot/A0A7I2V3C7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3C7-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3C7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3F4", "url": "https://www.uniprot.org/uniprot/A0A7I2V3F4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3F4-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3F4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3J5", "url": "https://www.uniprot.org/uniprot/A0A7I2V3J5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3J5-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3J5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3K5", "url": "https://www.uniprot.org/uniprot/A0A7I2V3K5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3K5-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3K5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3R8", "url": "https://www.uniprot.org/uniprot/A0A7I2V3R8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3R8-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3R8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3S1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3S1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3S1-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3S1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3U8", "url": "https://www.uniprot.org/uniprot/A0A7I2V3U8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3U8-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3U8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3U9", "url": "https://www.uniprot.org/uniprot/A0A7I2V3U9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3U9-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3U9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3W0", "url": "https://www.uniprot.org/uniprot/A0A7I2V3W0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3W0-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3W0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3W4", "url": "https://www.uniprot.org/uniprot/A0A7I2V3W4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3W4-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3W4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V434", "url": "https://www.uniprot.org/uniprot/A0A7I2V434", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V434-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V434-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V453", "url": "https://www.uniprot.org/uniprot/A0A7I2V453", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V453-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V453-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V459", "url": "https://www.uniprot.org/uniprot/A0A7I2V459", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V459-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V459-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V497", "url": "https://www.uniprot.org/uniprot/A0A7I2V497", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V497-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V497-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V4E2", "url": "https://www.uniprot.org/uniprot/A0A7I2V4E2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V4E2-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V4E2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V4F8", "url": "https://www.uniprot.org/uniprot/A0A7I2V4F8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V4F8-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V4F8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V4M0", "url": "https://www.uniprot.org/uniprot/A0A7I2V4M0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V4M0-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V4M0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V4P7", "url": "https://www.uniprot.org/uniprot/A0A7I2V4P7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V4P7-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V4P7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V4R7", "url": "https://www.uniprot.org/uniprot/A0A7I2V4R7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V4R7-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V4R7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V520", "url": "https://www.uniprot.org/uniprot/A0A7I2V520", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V520-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V520-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V595", "url": "https://www.uniprot.org/uniprot/A0A7I2V595", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V595-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V595-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5H0", "url": "https://www.uniprot.org/uniprot/A0A7I2V5H0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5H0-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V5H0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5L7", "url": "https://www.uniprot.org/uniprot/A0A7I2V5L7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5L7-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V5L7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5N7", "url": "https://www.uniprot.org/uniprot/A0A7I2V5N7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5N7-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V5N7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5P1", "url": "https://www.uniprot.org/uniprot/A0A7I2V5P1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5P1-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V5P1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5T1", "url": "https://www.uniprot.org/uniprot/A0A7I2V5T1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5T1-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V5T1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5U9", "url": "https://www.uniprot.org/uniprot/A0A7I2V5U9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5U9-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V5U9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5W8", "url": "https://www.uniprot.org/uniprot/A0A7I2V5W8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5W8-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V5W8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V661", "url": "https://www.uniprot.org/uniprot/A0A7I2V661", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V661-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V661-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V666", "url": "https://www.uniprot.org/uniprot/A0A7I2V666", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V666-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V666-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQ85", "url": "https://www.uniprot.org/uniprot/A0A7I2YQ85", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQ85-1", "url": "https://www.uniprot.org/uniprot/A0A7I2YQ85-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQJ2", "url": "https://www.uniprot.org/uniprot/A0A7I2YQJ2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQJ2-1", "url": "https://www.uniprot.org/uniprot/A0A7I2YQJ2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQR6", "url": "https://www.uniprot.org/uniprot/A0A7I2YQR6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQR6-1", "url": "https://www.uniprot.org/uniprot/A0A7I2YQR6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQU4", "url": "https://www.uniprot.org/uniprot/A0A7I2YQU4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQU4-1", "url": "https://www.uniprot.org/uniprot/A0A7I2YQU4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQV3", "url": "https://www.uniprot.org/uniprot/A0A7I2YQV3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQV3-1", "url": "https://www.uniprot.org/uniprot/A0A7I2YQV3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQV6", "url": "https://www.uniprot.org/uniprot/A0A7I2YQV6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQV6-1", "url": "https://www.uniprot.org/uniprot/A0A7I2YQV6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQW0", "url": "https://www.uniprot.org/uniprot/A0A7I2YQW0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQW0-1", "url": "https://www.uniprot.org/uniprot/A0A7I2YQW0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQX9", "url": "https://www.uniprot.org/uniprot/A0A7I2YQX9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQX9-1", "url": "https://www.uniprot.org/uniprot/A0A7I2YQX9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQY2", "url": "https://www.uniprot.org/uniprot/A0A7I2YQY2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQY2-1", "url": "https://www.uniprot.org/uniprot/A0A7I2YQY2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8VTQ5", "url": "https://www.uniprot.org/uniprot/F8VTQ5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8VTQ5-1", "url": "https://www.uniprot.org/uniprot/F8VTQ5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8VYN5", "url": "https://www.uniprot.org/uniprot/F8VYN5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8VYN5-1", "url": "https://www.uniprot.org/uniprot/F8VYN5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8VZ49", "url": "https://www.uniprot.org/uniprot/F8VZ49", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8VZ49-1", "url": "https://www.uniprot.org/uniprot/F8VZ49-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8W646", "url": "https://www.uniprot.org/uniprot/F8W646", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8W646-1", "url": "https://www.uniprot.org/uniprot/F8W646-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8W6I7", "url": "https://www.uniprot.org/uniprot/F8W6I7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8W6I7-1", "url": "https://www.uniprot.org/uniprot/F8W6I7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YH80", "url": "https://www.uniprot.org/uniprot/H0YH80", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YH80-1", "url": "https://www.uniprot.org/uniprot/H0YH80-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P09651-1", "url": "https://www.uniprot.org/uniprot/P09651-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P09651-2", "url": "https://www.uniprot.org/uniprot/P09651-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P09651-3", "url": "https://www.uniprot.org/uniprot/P09651-3", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF", "length": 372, "header": "sp|P09651-1|ROA1_HUMAN Isoform 1 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=5 CANONICAL=P09651-1" }, "isoforms": [ { "isoform_ac": "A0A7I2V2F1-1", "url": "", "sequence": { "sequence": "XGFGGSRGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ", "length": 55, "header": "tr|A0A7I2V2F1-1|ROA1_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54283967, "end_pos": 54282800, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677224.1", "url": "https://www.ensembl.org/id/ENST00000677224.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000502876.1", "url": "https://www.ensembl.org/id/ENSP00000502876.1" } ] } }, { "isoform_ac": "A0A7I2V2L6-1", "url": "", "sequence": { "sequence": "MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGMYGLSTCSSDFSPSLL", "length": 242, "header": "tr|A0A7I2V2L6-1|A0A7I2V2L6_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54282715, "end_pos": 54280808, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677385.1", "url": "https://www.ensembl.org/id/ENST00000677385.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000502985.1", "url": "https://www.ensembl.org/id/ENSP00000502985.1" } ] } }, { "isoform_ac": "A0A7I2V2M7-1", "url": "", "sequence": { "sequence": "XGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ", "length": 104, "header": "tr|A0A7I2V2M7-1|ROA1_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54283967, "end_pos": 54283079, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676951.1", "url": "https://www.ensembl.org/id/ENST00000676951.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000502981.1", "url": "https://www.ensembl.org/id/ENSP00000502981.1" } ] } }, { "isoform_ac": "A0A7I2V2Q7-1", "url": "", "sequence": { "sequence": "XGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ", "length": 96, "header": "tr|A0A7I2V2Q7-1|ROA1_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54283967, "end_pos": 54283079, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678424.1", "url": "https://www.ensembl.org/id/ENST00000678424.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503030.1", "url": "https://www.ensembl.org/id/ENSP00000503030.1" } ] } }, { "isoform_ac": "A0A7I2V2R4-1", "url": "", "sequence": { "sequence": "XRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ", "length": 78, "header": "tr|A0A7I2V2R4-1|A0A7I2V2R4_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54283967, "end_pos": 54282573, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677945.1", "url": "https://www.ensembl.org/id/ENST00000677945.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503056.1", "url": "https://www.ensembl.org/id/ENSP00000503056.1" } ] } }, { "isoform_ac": "A0A7I2V2W8-1", "url": "", "sequence": { "sequence": "XGFGGSRGGGGYGGSGDGYNGFGNDELYSCRWLWRRRPWLLWRKQRLWKWWTGLWKPGQWLWREWQL", "length": 67, "header": "tr|A0A7I2V2W8-1|A0A7I2V2W8_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54283188, "end_pos": 54282800, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677191.1", "url": "https://www.ensembl.org/id/ENST00000677191.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503128.1", "url": "https://www.ensembl.org/id/ENSP00000503128.1" } ] } }, { "isoform_ac": "A0A7I2V2X1-1", "url": "", "sequence": { "sequence": "XGFGGSRGGGGYGGSGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ", "length": 61, "header": "tr|A0A7I2V2X1-1|ROA1_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54283967, "end_pos": 54282800, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678513.1", "url": "https://www.ensembl.org/id/ENST00000678513.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503162.1", "url": "https://www.ensembl.org/id/ENSP00000503162.1" } ] } }, { "isoform_ac": "A0A7I2V2Z4-1", "url": "", "sequence": { "sequence": "MRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSRE", "length": 48, "header": "tr|A0A7I2V2Z4-1|A0A7I2V2Z4_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54281941, "end_pos": 54281798, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000679101.1", "url": "https://www.ensembl.org/id/ENST00000679101.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503166.1", "url": "https://www.ensembl.org/id/ENSP00000503166.1" } ] } }, { "isoform_ac": "A0A7I2V334-1", "url": "", "sequence": { "sequence": "XQKYHTVNGHNCEVRKALSKQEMASASSSQRGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ", "length": 83, "header": "tr|A0A7I2V334-1|A0A7I2V334_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54283967, "end_pos": 54282394, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677636.1", "url": "https://www.ensembl.org/id/ENST00000677636.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503254.1", "url": "https://www.ensembl.org/id/ENSP00000503254.1" } ] } }, { "isoform_ac": "A0A7I2V360-1", "url": "", "sequence": { "sequence": "XSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGRSLLLVLSALKNRNSSVQVRGRKERPCEDLYLSHCTSLSLPCSLHELFCSSNSIL", "length": 108, "header": "tr|A0A7I2V360-1|A0A7I2V360_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54287049, "end_pos": 54283812, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677840.1", "url": "https://www.ensembl.org/id/ENST00000677840.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503273.1", "url": "https://www.ensembl.org/id/ENSP00000503273.1" } ] } }, { "isoform_ac": "A0A7I2V3C7-1", "url": "", "sequence": { "sequence": "MSKSEVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSRE", "length": 54, "header": "tr|A0A7I2V3C7-1|A0A7I2V3C7_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54281941, "end_pos": 54280808, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678690.1", "url": "https://www.ensembl.org/id/ENST00000678690.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503229.1", "url": "https://www.ensembl.org/id/ENSP00000503229.1" } ] } }, { "isoform_ac": "A0A7I2V3F4-1", "url": "", "sequence": { "sequence": "XGFGGSRGGGGYGGSGDGYNGFGNDGPLSHS", "length": 31, "header": "tr|A0A7I2V3F4-1|A0A7I2V3F4_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54283809, "end_pos": 54282800, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678212.1", "url": "https://www.ensembl.org/id/ENST00000678212.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503276.1", "url": "https://www.ensembl.org/id/ENSP00000503276.1" } ] } }, { "isoform_ac": "A0A7I2V3J5-1", "url": "", "sequence": { "sequence": "XGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSSSSSSYGSGRRF", "length": 46, "header": "tr|A0A7I2V3J5-1|ROA1_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54284311, "end_pos": 54283079, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676886.1", "url": "https://www.ensembl.org/id/ENST00000676886.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503468.1", "url": "https://www.ensembl.org/id/ENSP00000503468.1" } ] } }, { "isoform_ac": "A0A7I2V3K5-1", "url": "", "sequence": { "sequence": "XRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ", "length": 77, "header": "tr|A0A7I2V3K5-1|A0A7I2V3K5_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54283967, "end_pos": 54282573, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678873.1", "url": "https://www.ensembl.org/id/ENST00000678873.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503516.1", "url": "https://www.ensembl.org/id/ENSP00000503516.1" } ] } }, { "isoform_ac": "A0A7I2V3R8-1", "url": "", "sequence": { "sequence": "MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF", "length": 319, "header": "tr|A0A7I2V3R8-1|A0A7I2V3R8_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54284310, "end_pos": 54280808, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677249.1", "url": "https://www.ensembl.org/id/ENST00000677249.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503649.1", "url": "https://www.ensembl.org/id/ENSP00000503649.1" } ] } }, { "isoform_ac": "A0A7I2V3S1-1", "url": "", "sequence": { "sequence": "XGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGGYGGSSSSSSYGSGRRF", "length": 70, "header": "tr|A0A7I2V3S1-1|ROA1_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54284311, "end_pos": 54283079, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678412.1", "url": "https://www.ensembl.org/id/ENST00000678412.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503562.1", "url": "https://www.ensembl.org/id/ENSP00000503562.1" } ] } }, { "isoform_ac": "A0A7I2V3U8-1", "url": "", "sequence": { "sequence": "XGFGGSRGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ", "length": 54, "header": "tr|A0A7I2V3U8-1|A0A7I2V3U8_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54283967, "end_pos": 54282800, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677279.1", "url": "https://www.ensembl.org/id/ENST00000677279.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503602.1", "url": "https://www.ensembl.org/id/ENSP00000503602.1" } ] } }, { "isoform_ac": "A0A7I2V3U9-1", "url": "", "sequence": { "sequence": "XGYGGGGGGFGGGS", "length": 14, "header": "tr|A0A7I2V3U9-1|ROA1_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54283234, "end_pos": 54283079, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678947.1", "url": "https://www.ensembl.org/id/ENST00000678947.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503733.1", "url": "https://www.ensembl.org/id/ENSP00000503733.1" } ] } }, { "isoform_ac": "A0A7I2V3W0-1", "url": "", "sequence": { "sequence": "MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQEKLYFSGGYGGSSSSSSYGSGRRF", "length": 326, "header": "tr|A0A7I2V3W0-1|ROA1_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54284310, "end_pos": 54280808, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677375.1", "url": "https://www.ensembl.org/id/ENST00000677375.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503651.1", "url": "https://www.ensembl.org/id/ENSP00000503651.1" } ] } }, { "isoform_ac": "A0A7I2V3W4-1", "url": "", "sequence": { "sequence": "VMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEATMILGITTISLQILDP", "length": 58, "header": "tr|A0A7I2V3W4-1|ROA1_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54283886, "end_pos": 54281795, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678448.1", "url": "https://www.ensembl.org/id/ENST00000678448.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503619.1", "url": "https://www.ensembl.org/id/ENSP00000503619.1" } ] } }, { "isoform_ac": "A0A7I2V434-1", "url": "", "sequence": { "sequence": "XSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGQYFAKPRNQ", "length": 42, "header": "tr|A0A7I2V434-1|ROA1_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54283967, "end_pos": 54283812, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677518.1", "url": "https://www.ensembl.org/id/ENST00000677518.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503537.1", "url": "https://www.ensembl.org/id/ENSP00000503537.1" } ] } }, { "isoform_ac": "A0A7I2V453-1", "url": "", "sequence": { "sequence": "XRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ", "length": 83, "header": "tr|A0A7I2V453-1|A0A7I2V453_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54283967, "end_pos": 54282573, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678876.1", "url": "https://www.ensembl.org/id/ENST00000678876.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503756.1", "url": "https://www.ensembl.org/id/ENSP00000503756.1" } ] } }, { "isoform_ac": "A0A7I2V459-1", "url": "", "sequence": { "sequence": "XGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ", "length": 97, "header": "tr|A0A7I2V459-1|A0A7I2V459_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54283967, "end_pos": 54283079, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676853.1", "url": "https://www.ensembl.org/id/ENST00000676853.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503749.1", "url": "https://www.ensembl.org/id/ENSP00000503749.1" } ] } }, { "isoform_ac": "A0A7I2V497-1", "url": "", "sequence": { "sequence": "XSNFGGGGRNFGGRSSGPYGGGGQYFAKPRNQ", "length": 32, "header": "tr|A0A7I2V497-1|A0A7I2V497_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54283967, "end_pos": 54283812, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677847.1", "url": "https://www.ensembl.org/id/ENST00000677847.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503848.1", "url": "https://www.ensembl.org/id/ENSP00000503848.1" } ] } }, { "isoform_ac": "A0A7I2V4E2-1", "url": "", "sequence": { "sequence": "XGYGGGGPGYSGGSRGYGSGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ", "length": 65, "header": "tr|A0A7I2V4E2-1|ROA1_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54283967, "end_pos": 54283079, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676472.1", "url": "https://www.ensembl.org/id/ENST00000676472.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503977.1", "url": "https://www.ensembl.org/id/ENSP00000503977.1" } ] } }, { "isoform_ac": "A0A7I2V4F8-1", "url": "", "sequence": { "sequence": "XGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ", "length": 99, "header": "tr|A0A7I2V4F8-1|A0A7I2V4F8_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54283967, "end_pos": 54283079, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678611.1", "url": "https://www.ensembl.org/id/ENST00000678611.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504004.1", "url": "https://www.ensembl.org/id/ENSP00000504004.1" } ] } }, { "isoform_ac": "A0A7I2V4M0-1", "url": "", "sequence": { "sequence": "VMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREALLI", "length": 53, "header": "tr|A0A7I2V4M0-1|ROA1_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54282063, "end_pos": 54281795, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676842.1", "url": "https://www.ensembl.org/id/ENST00000676842.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504036.1", "url": "https://www.ensembl.org/id/ENSP00000504036.1" } ] } }, { "isoform_ac": "A0A7I2V4P7-1", "url": "", "sequence": { "sequence": "XRSGSGNFGGGRGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ", "length": 60, "header": "tr|A0A7I2V4P7-1|ROA1_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54283967, "end_pos": 54282573, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678597.1", "url": "https://www.ensembl.org/id/ENST00000678597.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504089.1", "url": "https://www.ensembl.org/id/ENSP00000504089.1" } ] } }, { "isoform_ac": "A0A7I2V4R7-1", "url": "", "sequence": { "sequence": "XGFGGSRGGGGYGGSGDGYNGFGNDGNR", "length": 28, "header": "tr|A0A7I2V4R7-1|A0A7I2V4R7_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54283787, "end_pos": 54282800, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000679344.1", "url": "https://www.ensembl.org/id/ENST00000679344.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504058.1", "url": "https://www.ensembl.org/id/ENSP00000504058.1" } ] } }, { "isoform_ac": "A0A7I2V520-1", "url": "", "sequence": { "sequence": "XGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ", "length": 97, "header": "tr|A0A7I2V520-1|A0A7I2V520_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54283967, "end_pos": 54283079, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678581.1", "url": "https://www.ensembl.org/id/ENST00000678581.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504251.1", "url": "https://www.ensembl.org/id/ENSP00000504251.1" } ] } }, { "isoform_ac": "A0A7I2V595-1", "url": "", "sequence": { "sequence": "XGYGGGGFGGGS", "length": 12, "header": "tr|A0A7I2V595-1|A0A7I2V595_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=4 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54283234, "end_pos": 54283079, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677488.1", "url": "https://www.ensembl.org/id/ENST00000677488.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504431.1", "url": "https://www.ensembl.org/id/ENSP00000504431.1" } ] } }, { "isoform_ac": "A0A7I2V5H0-1", "url": "", "sequence": { "sequence": "XQKYHTVNGHNCEVRKALSKQEMASASSSQRGGFGGSRGGGGYGGSGDGYNGFGND", "length": 56, "header": "tr|A0A7I2V5H0-1|ROA1_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54282874, "end_pos": 54282394, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677291.1", "url": "https://www.ensembl.org/id/ENST00000677291.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504458.1", "url": "https://www.ensembl.org/id/ENSP00000504458.1" } ] } }, { "isoform_ac": "A0A7I2V5L7-1", "url": "", "sequence": { "sequence": "XRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGS", "length": 83, "header": "tr|A0A7I2V5L7-1|A0A7I2V5L7_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54283234, "end_pos": 54282573, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678347.1", "url": "https://www.ensembl.org/id/ENST00000678347.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504511.1", "url": "https://www.ensembl.org/id/ENSP00000504511.1" } ] } }, { "isoform_ac": "A0A7I2V5N7-1", "url": "", "sequence": { "sequence": "XSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGNKA", "length": 56, "header": "tr|A0A7I2V5N7-1|ROA1_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54284560, "end_pos": 54283812, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000679026.1", "url": "https://www.ensembl.org/id/ENST00000679026.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504539.1", "url": "https://www.ensembl.org/id/ENSP00000504539.1" } ] } }, { "isoform_ac": "A0A7I2V5P1-1", "url": "", "sequence": { "sequence": "XGFGGSRGGGGYGGSGDGYNGFGNDGNYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ", "length": 70, "header": "tr|A0A7I2V5P1-1|ROA1_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54283967, "end_pos": 54282800, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676707.1", "url": "https://www.ensembl.org/id/ENST00000676707.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504696.1", "url": "https://www.ensembl.org/id/ENSP00000504696.1" } ] } }, { "isoform_ac": "A0A7I2V5T1-1", "url": "", "sequence": { "sequence": "XQKYHTVNGHNCEVRKALSKQEMASASSSQRGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGS", "length": 83, "header": "tr|A0A7I2V5T1-1|A0A7I2V5T1_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54283234, "end_pos": 54282394, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677645.1", "url": "https://www.ensembl.org/id/ENST00000677645.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504753.1", "url": "https://www.ensembl.org/id/ENSP00000504753.1" } ] } }, { "isoform_ac": "A0A7I2V5U9-1", "url": "", "sequence": { "sequence": "MSKSEDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIV", "length": 75, "header": "tr|A0A7I2V5U9-1|A0A7I2V5U9_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54282299, "end_pos": 54280808, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678919.1", "url": "https://www.ensembl.org/id/ENST00000678919.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504604.1", "url": "https://www.ensembl.org/id/ENSP00000504604.1" } ] } }, { "isoform_ac": "A0A7I2V5W8-1", "url": "", "sequence": { "sequence": "XGFGGSRGGGGYGGSGDGYNGFGNDGKFFRNK", "length": 32, "header": "tr|A0A7I2V5W8-1|A0A7I2V5W8_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54282895, "end_pos": 54282800, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676572.1", "url": "https://www.ensembl.org/id/ENST00000676572.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503865.1", "url": "https://www.ensembl.org/id/ENSP00000503865.1" } ] } }, { "isoform_ac": "A0A7I2V661-1", "url": "", "sequence": { "sequence": "XRSGSGNFGGGRGGGFGGNDNFGRGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ", "length": 70, "header": "tr|A0A7I2V661-1|A0A7I2V661_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54283967, "end_pos": 54282573, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678934.1", "url": "https://www.ensembl.org/id/ENST00000678934.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504850.1", "url": "https://www.ensembl.org/id/ENSP00000504850.1" } ] } }, { "isoform_ac": "A0A7I2V666-1", "url": "", "sequence": { "sequence": "XGFGGSRGGGGYGGSGDGYNGFGNDGNNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ", "length": 77, "header": "tr|A0A7I2V666-1|A0A7I2V666_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54283967, "end_pos": 54282800, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000679063.1", "url": "https://www.ensembl.org/id/ENST00000679063.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504683.1", "url": "https://www.ensembl.org/id/ENSP00000504683.1" } ] } }, { "isoform_ac": "A0A7I2YQ85-1", "url": "", "sequence": { "sequence": "MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVGGVCY", "length": 49, "header": "tr|A0A7I2YQ85-1|A0A7I2YQ85_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54286676, "end_pos": 54280808, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677220.1", "url": "https://www.ensembl.org/id/ENST00000677220.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000502987.1", "url": "https://www.ensembl.org/id/ENSP00000502987.1" } ] } }, { "isoform_ac": "A0A7I2YQJ2-1", "url": "", "sequence": { "sequence": "XGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGRKFWRQKLWPLWRWRPILCKTTKPRWLWRFQQQQ", "length": 87, "header": "tr|A0A7I2YQJ2-1|ROA1_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54284286, "end_pos": 54283079, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678970.1", "url": "https://www.ensembl.org/id/ENST00000678970.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503825.1", "url": "https://www.ensembl.org/id/ENSP00000503825.1" } ] } }, { "isoform_ac": "A0A7I2YQR6-1", "url": "", "sequence": { "sequence": "XGFGGSRGGGGYGGSGDGYNGFGNDGGYGGSSSSSSYGSGRRF", "length": 43, "header": "tr|A0A7I2YQR6-1|ROA1_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54284311, "end_pos": 54282800, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678456.1", "url": "https://www.ensembl.org/id/ENST00000678456.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504368.1", "url": "https://www.ensembl.org/id/ENSP00000504368.1" } ] } }, { "isoform_ac": "A0A7I2YQU4-1", "url": "", "sequence": { "sequence": "XGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGNKA", "length": 56, "header": "tr|A0A7I2YQU4-1|ROA1_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54284560, "end_pos": 54283079, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000679079.1", "url": "https://www.ensembl.org/id/ENST00000679079.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504545.1", "url": "https://www.ensembl.org/id/ENSP00000504545.1" } ] } }, { "isoform_ac": "A0A7I2YQV3-1", "url": "", "sequence": { "sequence": "VMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVVEATMILGITTISLQILDP", "length": 54, "header": "tr|A0A7I2YQV3-1|A0A7I2YQV3_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54283886, "end_pos": 54281795, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000679273.1", "url": "https://www.ensembl.org/id/ENST00000679273.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504626.1", "url": "https://www.ensembl.org/id/ENSP00000504626.1" } ] } }, { "isoform_ac": "A0A7I2YQV6-1", "url": "", "sequence": { "sequence": "XGFGGSRGGGGYGGSGDGYNGFGNDGRSLLLVLSALKNRNSSVQVRGRKERPCEDLYLSHCTSLSLPCSLHELFCSSNSIL", "length": 81, "header": "tr|A0A7I2YQV6-1|A0A7I2YQV6_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54287049, "end_pos": 54282800, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677778.1", "url": "https://www.ensembl.org/id/ENST00000677778.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504642.1", "url": "https://www.ensembl.org/id/ENSP00000504642.1" } ] } }, { "isoform_ac": "A0A7I2YQW0-1", "url": "", "sequence": { "sequence": "XGYGGSSSSSSYGSGRRF", "length": 18, "header": "tr|A0A7I2YQW0-1|ROA1_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54284311, "end_pos": 54284258, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676661.1", "url": "https://www.ensembl.org/id/ENST00000676661.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503829.1", "url": "https://www.ensembl.org/id/ENSP00000503829.1" } ] } }, { "isoform_ac": "A0A7I2YQX9-1", "url": "", "sequence": { "sequence": "MRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF", "length": 275, "header": "tr|A0A7I2YQX9-1|A0A7I2YQX9_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54284310, "end_pos": 54281798, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678077.1", "url": "https://www.ensembl.org/id/ENST00000678077.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504814.1", "url": "https://www.ensembl.org/id/ENSP00000504814.1" } ] } }, { "isoform_ac": "A0A7I2YQY2-1", "url": "", "sequence": { "sequence": "MKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF", "length": 45, "header": "tr|A0A7I2YQY2-1|A0A7I2YQY2_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54284310, "end_pos": 54283886, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676794.1", "url": "https://www.ensembl.org/id/ENST00000676794.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504819.1", "url": "https://www.ensembl.org/id/ENSP00000504819.1" } ] } }, { "isoform_ac": "F8VTQ5-1", "url": "", "sequence": { "sequence": "MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQR", "length": 145, "header": "tr|F8VTQ5-1|F8VTQ5_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54282485, "end_pos": 54280808, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000551702.5", "url": "https://www.ensembl.org/id/ENST00000551702.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000448117.1", "url": "https://www.ensembl.org/id/ENSP00000448117.1" } ] } }, { "isoform_ac": "F8VYN5-1", "url": "", "sequence": { "sequence": "VMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREVRFSKTRCPLNCEKDICWWH", "length": 69, "header": "tr|F8VYN5-1|F8VYN5_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=2 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54282145, "end_pos": 54281795, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000550994.2", "url": "https://www.ensembl.org/id/ENST00000550994.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000448917.2", "url": "https://www.ensembl.org/id/ENSP00000448917.2" } ] } }, { "isoform_ac": "F8VZ49-1", "url": "", "sequence": { "sequence": "MRDSLLVAKFLGTQDLCLFLNLALSPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGG", "length": 231, "header": "tr|F8VZ49-1|ROA1_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54282625, "end_pos": 54281023, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000548688.5", "url": "https://www.ensembl.org/id/ENST00000548688.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000447782.1", "url": "https://www.ensembl.org/id/ENSP00000447782.1" } ] } }, { "isoform_ac": "F8W646-1", "url": "", "sequence": { "sequence": "MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSN", "length": 156, "header": "tr|F8W646-1|ROA1_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54283876, "end_pos": 54280808, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000547708.5", "url": "https://www.ensembl.org/id/ENST00000547708.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000448229.1", "url": "https://www.ensembl.org/id/ENSP00000448229.1" } ] } }, { "isoform_ac": "F8W6I7-1", "url": "", "sequence": { "sequence": "MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGIGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF", "length": 307, "header": "tr|F8W6I7-1|ROA1_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=2 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54284310, "end_pos": 54280808, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000330752", "url": "https://www.ensembl.org/id/ENST00000330752" }, { "database": "Ensembl Peptide", "id": "ENSP00000333504", "url": "https://www.ensembl.org/id/ENSP00000333504" } ] } }, { "isoform_ac": "H0YH80-1", "url": "", "sequence": { "sequence": "KIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF", "length": 191, "header": "tr|H0YH80-1|H0YH80_HUMAN Computationally mapped isoform of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54284310, "end_pos": 54280808, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000550482", "url": "https://www.ensembl.org/id/ENST00000550482" }, { "database": "Ensembl Peptide", "id": "ENSP00000446486", "url": "https://www.ensembl.org/id/ENSP00000446486" } ] } }, { "isoform_ac": "P09651-1", "url": "", "sequence": { "sequence": "MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF", "length": 372, "header": "sp|P09651-1|ROA1_HUMAN Isoform 1 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=5 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54284310, "end_pos": 54280808, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677210.1", "url": "https://www.ensembl.org/id/ENST00000677210.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503610.1", "url": "https://www.ensembl.org/id/ENSP00000503610.1" } ] } }, { "isoform_ac": "P09651-2", "url": "", "sequence": { "sequence": "MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF", "length": 320, "header": "sp|P09651-2|ROA1_HUMAN Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=5 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54284310, "end_pos": 54280808, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000547566.5", "url": "https://www.ensembl.org/id/ENST00000547566.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000449913.1", "url": "https://www.ensembl.org/id/ENSP00000449913.1" } ] } }, { "isoform_ac": "P09651-3", "url": "", "sequence": { "sequence": "MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF", "length": 267, "header": "sp|P09651-3|ROA1_HUMAN Isoform 3 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=5 CANONICAL=P09651-1" }, "locus": { "chromosome": "12", "start_pos": 54284310, "end_pos": 54280808, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000547276.5", "url": "https://www.ensembl.org/id/ENST00000547276.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000447260.1", "url": "https://www.ensembl.org/id/ENSP00000447260.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 22, "start_aa": "Ser", "end_pos": 22, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser22", "evidence": [ { "id": "P09651", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09651" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "30444036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30444036" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "27913144", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27913144" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "P09651", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P09651" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 337, "start_aa": "Ser", "end_pos": 337, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser337", "evidence": [ { "id": "P09651", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09651" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "30444036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30444036" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "27913144", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27913144" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "P09651", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P09651" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 338, "start_aa": "Ser", "end_pos": 338, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser338", "evidence": [ { "id": "P09651", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P09651" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 360, "start_aa": "Ser", "end_pos": 360, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser360", "evidence": [ { "id": "P09651", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P09651" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 361, "start_aa": "Ser", "end_pos": 361, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser361", "evidence": [ { "id": "P09651", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09651" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "30444036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30444036" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "27913144", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27913144" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "P09651", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P09651" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 362, "start_aa": "Ser", "end_pos": 362, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser362", "evidence": [ { "id": "P09651", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09651" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "30444036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30444036" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "27913144", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27913144" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "P09651", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P09651" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 363, "start_aa": "Ser", "end_pos": 363, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser363", "evidence": [ { "id": "P09651", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09651" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "30444036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30444036" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "27913144", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27913144" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "P09651", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P09651" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 364, "start_aa": "Ser", "end_pos": 364, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser364", "evidence": [ { "id": "P09651", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09651" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "30444036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30444036" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "27913144", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27913144" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "P09651", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P09651" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 365, "start_aa": "Ser", "end_pos": 365, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser365", "evidence": [ { "id": "P09651", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09651" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "30444036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30444036" }, { "id": "32574038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32574038" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "27913144", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27913144" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "P09651", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P09651" } ] } ], "phosphorylation": [ { "start_pos": 138, "end_pos": 138, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P09651", "url": "http://phospho.elm.eu.org/byAccession/P09651.html" }, { "database": "PubMed", "id": "16097034", "url": "https://glygen.org/publication/PubMed/16097034" } ], "site_lbl": "Thr138" }, { "start_pos": 142, "end_pos": 142, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P09651", "url": "http://phospho.elm.eu.org/byAccession/P09651.html" } ], "site_lbl": "Ser142" }, { "start_pos": 167, "end_pos": 167, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "phospho.ELM", "id": "P09651", "url": "http://phospho.elm.eu.org/byAccession/P09651.html" } ], "site_lbl": "Tyr167" }, { "start_pos": 192, "end_pos": 192, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MKNK2", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" }, { "database": "phospho.ELM", "id": "P09651", "url": "http://phospho.elm.eu.org/byAccession/P09651.html" }, { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" }, { "database": "PubMed", "id": "16111636", "url": "https://glygen.org/publication/PubMed/16111636" }, { "database": "PubMed", "id": "19656952", "url": "https://glygen.org/publication/PubMed/19656952" }, { "database": "PubMed", "id": "25999341", "url": "https://glygen.org/publication/PubMed/25999341" } ], "site_lbl": "Ser192" }, { "start_pos": 199, "end_pos": 199, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" }, { "database": "PubMed", "id": "8451194", "url": "https://glygen.org/publication/PubMed/8451194" } ], "site_lbl": "Ser199" }, { "start_pos": 199, "end_pos": 199, "kinase_uniprot_canonical_ac": "P31749-1", "kinase_gene_name": "AKT1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" }, { "database": "PubMed", "id": "18562319", "url": "https://glygen.org/publication/PubMed/18562319" } ], "site_lbl": "Ser199" }, { "start_pos": 199, "end_pos": 199, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "phospho.ELM", "id": "P09651", "url": "http://phospho.elm.eu.org/byAccession/P09651.html" }, { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" }, { "database": "PubMed", "id": "8451194", "url": "https://glygen.org/publication/PubMed/8451194" }, { "database": "PubMed", "id": "18562319", "url": "https://glygen.org/publication/PubMed/18562319" }, { "database": "PubMed", "id": "21454539", "url": "https://glygen.org/publication/PubMed/21454539" }, { "database": "PubMed", "id": "33319070", "url": "https://glygen.org/publication/PubMed/33319070" }, { "database": "PubMed", "id": "34080184", "url": "https://glygen.org/publication/PubMed/34080184" } ], "site_lbl": "Ser199" }, { "start_pos": 22, "end_pos": 22, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "site_lbl": "Ser22" }, { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "P09651", "url": "http://phospho.elm.eu.org/byAccession/P09651.html" }, { "database": "PubMed", "id": "14729942", "url": "https://glygen.org/publication/PubMed/14729942" } ], "site_lbl": "Ser2" }, { "start_pos": 337, "end_pos": 337, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P09651", "url": "http://phospho.elm.eu.org/byAccession/P09651.html" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ], "site_lbl": "Ser337" }, { "start_pos": 338, "end_pos": 338, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P09651", "url": "http://phospho.elm.eu.org/byAccession/P09651.html" } ], "site_lbl": "Ser338" }, { "start_pos": 347, "end_pos": 347, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" }, { "database": "PubMed", "id": "15592455", "url": "https://glygen.org/publication/PubMed/15592455" }, { "database": "PubMed", "id": "19901323", "url": "https://glygen.org/publication/PubMed/19901323" }, { "database": "phospho.ELM", "id": "P09651", "url": "http://phospho.elm.eu.org/byAccession/P09651.html" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" } ], "site_lbl": "Tyr347" }, { "start_pos": 357, "end_pos": 357, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ], "site_lbl": "Tyr357" }, { "start_pos": 360, "end_pos": 360, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ], "site_lbl": "Ser360" }, { "start_pos": 361, "end_pos": 361, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ], "site_lbl": "Ser361" }, { "start_pos": 362, "end_pos": 362, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MKNK2", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" }, { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P09651", "url": "http://phospho.elm.eu.org/byAccession/P09651.html" }, { "database": "PubMed", "id": "16111636", "url": "https://glygen.org/publication/PubMed/16111636" } ], "site_lbl": "Ser362" }, { "start_pos": 363, "end_pos": 363, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MKNK2", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" }, { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" }, { "database": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "phospho.ELM", "id": "P09651", "url": "http://phospho.elm.eu.org/byAccession/P09651.html" }, { "database": "PubMed", "id": "16111636", "url": "https://glygen.org/publication/PubMed/16111636" } ], "site_lbl": "Ser363" }, { "start_pos": 364, "end_pos": 364, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MKNK2", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" }, { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "phospho.ELM", "id": "P09651", "url": "http://phospho.elm.eu.org/byAccession/P09651.html" }, { "database": "PubMed", "id": "16111636", "url": "https://glygen.org/publication/PubMed/16111636" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ], "site_lbl": "Ser364" }, { "start_pos": 365, "end_pos": 365, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" }, { "database": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ], "site_lbl": "Ser365" }, { "start_pos": 368, "end_pos": 368, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "phospho.ELM", "id": "P09651", "url": "http://phospho.elm.eu.org/byAccession/P09651.html" } ], "site_lbl": "Ser368" }, { "start_pos": 4, "end_pos": 4, "kinase_uniprot_canonical_ac": "Q9UBS0-1", "kinase_gene_name": "RPS6KB2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" }, { "database": "PubMed", "id": "25324306", "url": "https://glygen.org/publication/PubMed/25324306" } ], "site_lbl": "Ser4" }, { "start_pos": 4, "end_pos": 4, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" }, { "database": "PubMed", "id": "17322306", "url": "https://glygen.org/publication/PubMed/17322306" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18707149", "url": "https://glygen.org/publication/PubMed/18707149" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" }, { "database": "phospho.ELM", "id": "P09651", "url": "http://phospho.elm.eu.org/byAccession/P09651.html" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ], "site_lbl": "Ser4" }, { "start_pos": 6, "end_pos": 6, "kinase_uniprot_canonical_ac": "Q9UBS0-1", "kinase_gene_name": "RPS6KB2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" }, { "database": "PubMed", "id": "25324306", "url": "https://glygen.org/publication/PubMed/25324306" } ], "site_lbl": "Ser6" }, { "start_pos": 6, "end_pos": 6, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" }, { "database": "PubMed", "id": "14729942", "url": "https://glygen.org/publication/PubMed/14729942" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" }, { "database": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18707149", "url": "https://glygen.org/publication/PubMed/18707149" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "20068230", "url": "https://glygen.org/publication/PubMed/20068230" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" }, { "database": "PubMed", "id": "8288564", "url": "https://glygen.org/publication/PubMed/8288564" }, { "database": "phospho.ELM", "id": "P09651", "url": "http://phospho.elm.eu.org/byAccession/P09651.html" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "29344170", "url": "https://glygen.org/publication/PubMed/29344170" } ], "site_lbl": "Ser6" }, { "start_pos": 91, "end_pos": 91, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "phospho.ELM", "id": "P09651", "url": "http://phospho.elm.eu.org/byAccession/P09651.html" } ], "site_lbl": "Ser91" }, { "start_pos": 95, "end_pos": 95, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" }, { "database": "PubMed", "id": "7727389", "url": "https://glygen.org/publication/PubMed/7727389" } ], "site_lbl": "Ser95" }, { "start_pos": 95, "end_pos": 95, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "phospho.ELM", "id": "P09651", "url": "http://phospho.elm.eu.org/byAccession/P09651.html" }, { "database": "PubMed", "id": "19656952", "url": "https://glygen.org/publication/PubMed/19656952" }, { "database": "PubMed", "id": "25999341", "url": "https://glygen.org/publication/PubMed/25999341" } ], "site_lbl": "Ser95" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Functional association of U2 snRNP with the ATP-independent spliceosomal complex E.", "journal": "Molecular cell", "date": "2000", "authors": "Das R, Zhou Z, Reed R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "10882114", "url": "https://glygen.org/publication/PubMed/10882114" } ] }, { "title": "The RNA-binding protein TIA-1 is a novel mammalian splicing regulator acting through intron sequences adjacent to a 5' splice site.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Del Gatto-Konczak F, Bourgeois CF, Le Guiner C, Kister L, Gesnel MC, Stevenin J, Breathnach R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "10938105", "url": "https://glygen.org/publication/PubMed/10938105" } ] }, { "title": "An intronic splicing silencer causes skipping of the IIIb exon of fibroblast growth factor receptor 2 through involvement of polypyrimidine tract binding protein.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Carstens RP, Wagner EJ, Garcia-Blanco MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "10982855", "url": "https://glygen.org/publication/PubMed/10982855" } ] }, { "title": "The protein Aly links pre-messenger-RNA splicing to nuclear export in metazoans.", "journal": "Nature", "date": "2000", "authors": "Zhou Z, Luo MJ, Straesser K, Katahira J, Hurt E, Reed R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "11014198", "url": "https://glygen.org/publication/PubMed/11014198" } ] }, { "title": "Functional analysis of the human CDC5L complex and identification of its components by mass spectrometry.", "journal": "The EMBO journal", "date": "2000", "authors": "Ajuh P, Kuster B, Panov K, Zomerdijk JC, Mann M, Lamond AI", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "11101529", "url": "https://glygen.org/publication/PubMed/11101529" } ] }, { "title": "The 100-kda U5 snRNP protein (hPrp28p) contacts the 5' splice site through its ATPase site.", "journal": "RNA (New York, N.Y.)", "date": "2001", "authors": "Ismaili N, Sha M, Gustafson EH, Konarska MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "11233976", "url": "https://glygen.org/publication/PubMed/11233976" } ] }, { "title": "Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.", "journal": "RNA", "date": "2002", "authors": "Jurica MS, Licklider LJ, Gygi SR, Grigorieff N, Moore MJ", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" }, { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "11991638", "url": "https://glygen.org/publication/PubMed/11991638" } ] }, { "title": "Large-scale proteomic analysis of the human spliceosome.", "journal": "Genome research", "date": "2002", "authors": "Rappsilber J, Ryder U, Lamond AI, Mann M", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "12176931", "url": "https://glygen.org/publication/PubMed/12176931" } ] }, { "title": "A Non-sequence-specific double-stranded RNA structural element regulates splicing of two mutually exclusive exons of fibroblast growth factor receptor 2 (FGFR2).", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Muh SJ, Hovhannisyan RH, Carstens RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "12393912", "url": "https://glygen.org/publication/PubMed/12393912" } ] }, { "title": "Small nuclear ribonucleoprotein remodeling during catalytic activation of the spliceosome.", "journal": "Science (New York, N.Y.)", "date": "2002", "authors": "Makarov EM, Makarova OV, Urlaub H, Gentzel M, Will CL, Wilm M, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "12411573", "url": "https://glygen.org/publication/PubMed/12411573" } ] }, { "title": "5' exon interactions within the human spliceosome establish a framework for exon junction complex structure and assembly.", "journal": "Genes & development", "date": "2002", "authors": "Reichert VL, Le Hir H, Jurica MS, Moore MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "12414731", "url": "https://glygen.org/publication/PubMed/12414731" } ] }, { "title": "Protein composition of human prespliceosomes isolated by a tobramycin affinity-selection method.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Hartmuth K, Urlaub H, Vornlocher HP, Will CL, Gentzel M, Wilm M, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "12477934", "url": "https://glygen.org/publication/PubMed/12477934" } ] }, { "title": "A simple whole cell lysate system for in vitro splicing reveals a stepwise assembly of the exon-exon junction complex.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Kataoka N, Dreyfuss G", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "14625303", "url": "https://glygen.org/publication/PubMed/14625303" } ] }, { "title": "Prp5 bridges U1 and U2 snRNPs and enables stable U2 snRNP association with intron RNA.", "journal": "The EMBO journal", "date": "2004", "authors": "Xu YZ, Newnham CM, Kameoka S, Huang T, Konarska MM, Query CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "14713954", "url": "https://glygen.org/publication/PubMed/14713954" } ] }, { "title": "Identification of phosphoproteins and their phosphorylation sites in the WEHI-231 B lymphoma cell line.", "journal": "Molecular & cellular proteomics : MCP", "date": "2004", "authors": "Shu H, Chen S, Bi Q, Mumby M, Brekken DL", "evidence": [ { "database": "iPTMnet", "id": "P09651-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651-1" } ], "reference": [ { "type": "PubMed", "id": "14729942", "url": "https://glygen.org/publication/PubMed/14729942" } ] }, { "title": "Sumoylation of heterogeneous nuclear ribonucleoproteins, zinc finger proteins, and nuclear pore complex proteins: a proteomic analysis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Li T, Evdokimov E, Shen RF, Chao CC, Tekle E, Wang T, Stadtman ER, Yang DC, Chock PB", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "reference": [ { "type": "PubMed", "id": "15161980", "url": "https://glygen.org/publication/PubMed/15161980" } ] }, { "title": "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.", "journal": "Nature biotechnology", "date": "2005", "authors": "Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ", "evidence": [ { "database": "iPTMnet", "id": "P09651-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651-1" } ], "reference": [ { "type": "PubMed", "id": "15592455", "url": "https://glygen.org/publication/PubMed/15592455" } ] }, { "title": "A novel intronic cis element, ISE/ISS-3, regulates rat fibroblast growth factor receptor 2 splicing through activation of an upstream exon and repression of a downstream exon containing a noncanonical branch point sequence.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Hovhannisyan RH, Carstens RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "15601847", "url": "https://glygen.org/publication/PubMed/15601847" } ] }, { "title": "Identifying and quantifying in vivo methylation sites by heavy methyl SILAC.", "journal": "Nature methods", "date": "2004", "authors": "Ong SE, Mittler G, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "reference": [ { "type": "PubMed", "id": "15782174", "url": "https://glygen.org/publication/PubMed/15782174" } ] }, { "title": "The nucleocapsid protein of SARS coronavirus has a high binding affinity to the human cellular heterogeneous nuclear ribonucleoprotein A1.", "journal": "FEBS Lett.", "date": "2005", "authors": "Luo H, Chen Q, Chen J, Chen K, Shen X, Jiang H", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" }, { "database": "Reactome", "id": "R-HSA-9692914", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9692914" } ], "reference": [ { "type": "PubMed", "id": "15862300", "url": "https://glygen.org/publication/PubMed/15862300" } ] }, { "title": "Global phosphoproteome analysis on human HepG2 hepatocytes using reversed-phase diagonal LC.", "journal": "Proteomics", "date": "2005", "authors": "Gevaert K, Staes A, Van Damme J, De Groot S, Hugelier K, Demol H, Martens L, Goethals M, Vandekerckhove J", "evidence": [ { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" } ], "reference": [ { "type": "PubMed", "id": "16097034", "url": "https://glygen.org/publication/PubMed/16097034" } ] }, { "title": "The Mnks are novel components in the control of TNF alpha biosynthesis and phosphorylate and regulate hnRNP A1.", "journal": "Immunity", "date": "2005", "authors": "Buxade M, Parra JL, Rousseau S, Shpiro N, Marquez R, Morrice N, Bain J, Espel E, Proud CG", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" }, { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" } ], "reference": [ { "type": "PubMed", "id": "16111636", "url": "https://glygen.org/publication/PubMed/16111636" } ] }, { "title": "Biochemical analysis of the EJC reveals two new factors and a stable tetrameric protein core.", "journal": "RNA (New York, N.Y.)", "date": "2005", "authors": "Tange TO, Shibuya T, Jurica MS, Moore MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "16314458", "url": "https://glygen.org/publication/PubMed/16314458" } ] }, { "title": "Characterization of sequences and mechanisms through which ISE/ISS-3 regulates FGFR2 splicing.", "journal": "Nucleic acids research", "date": "2006", "authors": "Hovhannisyan RH, Warzecha CC, Carstens RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "16410617", "url": "https://glygen.org/publication/PubMed/16410617" } ] }, { "title": "Fox-2 mediates epithelial cell-specific fibroblast growth factor receptor 2 exon choice.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Baraniak AP, Chen JR, Garcia-Blanco MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "16449636", "url": "https://glygen.org/publication/PubMed/16449636" } ] }, { "title": "Identification of RNA-binding proteins that regulate FGFR2 splicing through the use of sensitive and specific dual color fluorescence minigene assays.", "journal": "RNA (New York, N.Y.)", "date": "2006", "authors": "Newman EA, Muh SJ, Hovhannisyan RH, Warzecha CC, Jones RB, McKeehan WL, Carstens RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "16603716", "url": "https://glygen.org/publication/PubMed/16603716" } ] }, { "title": "Protein composition and electron microscopy structure of affinity-purified human spliceosomal B complexes isolated under physiological conditions.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Deckert J, Hartmuth K, Boehringer D, Behzadnia N, Will CL, Kastner B, Stark H, Urlaub H, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "16809785", "url": "https://glygen.org/publication/PubMed/16809785" } ] }, { "title": "Alternative splicing in the human gene for the core protein A1 generates another hnRNP protein.", "journal": "EMBO J.", "date": "1990", "authors": "Buvoli M, Cobianchi F, Bestagno MG, Mangiarotti A, Bassi MT, Biamonti G, Riva S", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "reference": [ { "type": "PubMed", "id": "1691095", "url": "https://glygen.org/publication/PubMed/1691095" } ] }, { "title": "Severe acute respiratory syndrome coronavirus nsp1 protein suppresses host gene expression by promoting host mRNA degradation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Kamitani W, Narayanan K, Huang C, Lokugamage K, Ikegami T, Ito N, Kubo H, Makino S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9735869", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9735869" } ], "reference": [ { "type": "PubMed", "id": "16912115", "url": "https://glygen.org/publication/PubMed/16912115" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" }, { "database": "iPTMnet", "id": "P09651-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651-1" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "Protein composition of human mRNPs spliced in vitro and differential requirements for mRNP protein recruitment.", "journal": "RNA (New York, N.Y.)", "date": "2007", "authors": "Merz C, Urlaub H, Will CL, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "17095540", "url": "https://glygen.org/publication/PubMed/17095540" } ] }, { "title": "An RNA-binding protein, hnRNP A1, and a scaffold protein, septin 6, facilitate hepatitis C virus replication.", "journal": "Journal of virology", "date": "2007-04", "authors": "Kim Chon Saeng, Seol Su Kyoung, Song Ok-Kyu, Park Ji Hoon, Jang Sung Key", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "reference": [ { "type": "PubMed", "id": "17229681", "url": "https://glygen.org/publication/PubMed/17229681" } ] }, { "title": "Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Molina H, Horn DM, Tang N, Mathivanan S, Pandey A", "evidence": [ { "database": "iPTMnet", "id": "P09651-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651-1" } ], "reference": [ { "type": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" } ] }, { "title": "Molecular composition of IMP1 ribonucleoprotein granules.", "journal": "Mol. Cell. Proteomics", "date": "2007", "authors": "Jonson L, Vikesaa J, Krogh A, Nielsen LK, Hansen Tv, Borup R, Johnsen AH, Christiansen J, Nielsen FC", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "reference": [ { "type": "PubMed", "id": "17289661", "url": "https://glygen.org/publication/PubMed/17289661" } ] }, { "title": "Phosphopeptide enrichment by aliphatic hydroxy acid-modified metal oxide chromatography for nano-LC-MS/MS in proteomics applications.", "journal": "Molecular & cellular proteomics : MCP", "date": "2007", "authors": "Sugiyama N, Masuda T, Shinoda K, Nakamura A, Tomita M, Ishihama Y", "evidence": [ { "database": "iPTMnet", "id": "P09651-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651-1" } ], "reference": [ { "type": "PubMed", "id": "17322306", "url": "https://glygen.org/publication/PubMed/17322306" } ] }, { "title": "Composition and three-dimensional EM structure of double affinity-purified, human prespliceosomal A complexes.", "journal": "The EMBO journal", "date": "2007", "authors": "Behzadnia N, Golas MM, Hartmuth K, Sander B, Kastner B, Deckert J, Dube P, Will CL, Urlaub H, Stark H, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "17332742", "url": "https://glygen.org/publication/PubMed/17332742" } ] }, { "title": "The RNA-binding protein Sam68 modulates the alternative splicing of Bcl-x.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Paronetto MP, Achsel T, Massiello A, Chalfant CE, Sette C", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "reference": [ { "type": "PubMed", "id": "17371836", "url": "https://glygen.org/publication/PubMed/17371836" } ] }, { "title": "Splicing remodels messenger ribonucleoprotein architecture via eIF4A3-dependent and -independent recruitment of exon junction complex components.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Zhang Z, Krainer AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "17606899", "url": "https://glygen.org/publication/PubMed/17606899" } ] }, { "title": "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.", "journal": "J. Proteome Res.", "date": "2007", "authors": "Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" }, { "database": "iPTMnet", "id": "P09651-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651-1" } ], "reference": [ { "type": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" } ] }, { "title": "Heterogeneous ribonucleoprotein m is a splicing regulatory protein that can enhance or silence splicing of alternatively spliced exons.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Hovhannisyan RH, Carstens RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "17959601", "url": "https://glygen.org/publication/PubMed/17959601" } ] }, { "title": "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer.", "journal": "Cell", "date": "2007", "authors": "Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ", "evidence": [ { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" } ], "reference": [ { "type": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" } ] }, { "title": "Hydrophilic interaction chromatography reduces the complexity of the phosphoproteome and improves global phosphopeptide isolation and detection.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008", "authors": "McNulty DE, Annan RS", "evidence": [ { "database": "iPTMnet", "id": "P09651-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651-1" } ], "reference": [ { "type": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" } ] }, { "title": "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.", "journal": "Journal of proteome research", "date": "2008", "authors": "Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" } ], "reference": [ { "type": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ] }, { "title": "The nucleocapsid protein of SARS-associated coronavirus inhibits B23 phosphorylation.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Zeng Y, Ye L, Zhu S, Zheng H, Zhao P, Cai W, Su L, She Y, Wu Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-9692914", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9692914" } ], "reference": [ { "type": "PubMed", "id": "18243139", "url": "https://glygen.org/publication/PubMed/18243139" } ] }, { "title": "Isolation of an active step I spliceosome and composition of its RNP core.", "journal": "Nature", "date": "2008", "authors": "Bessonov S, Anokhina M, Will CL, Urlaub H, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "18322460", "url": "https://glygen.org/publication/PubMed/18322460" } ] }, { "title": "The nucleocapsid protein of severe acute respiratory syndrome coronavirus inhibits cell cytokinesis and proliferation by interacting with translation elongation factor 1alpha.", "journal": "Journal of virology", "date": "2008", "authors": "Zhou B, Liu J, Wang Q, Liu X, Li X, Li P, Ma Q, Cao C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9735869", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9735869" } ], "reference": [ { "type": "PubMed", "id": "18448518", "url": "https://glygen.org/publication/PubMed/18448518" } ] }, { "title": "Motif-specific sampling of phosphoproteomes.", "journal": "Journal of proteome research", "date": "2008", "authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "P09651-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651-1" } ], "reference": [ { "type": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ] }, { "title": "Heterogeneous nuclear ribonucleoprotein A1 regulates cyclin D1 and c-myc internal ribosome entry site function through Akt signaling.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Jo OD, Martin J, Bernath A, Masri J, Lichtenstein A, Gera J", "evidence": [ { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" } ], "reference": [ { "type": "PubMed", "id": "18562319", "url": "https://glygen.org/publication/PubMed/18562319" } ] }, { "title": "hnRNP H and hnRNP F complex with Fox2 to silence fibroblast growth factor receptor 2 exon IIIc.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Mauger DM, Lin C, Garcia-Blanco MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "18573884", "url": "https://glygen.org/publication/PubMed/18573884" } ] }, { "title": "Distinct activities of the DExD/H-box splicing factor hUAP56 facilitate stepwise assembly of the spliceosome.", "journal": "Genes & development", "date": "2008", "authors": "Shen H, Zheng X, Shen J, Zhang L, Zhao R, Green MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "18593880", "url": "https://glygen.org/publication/PubMed/18593880" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" }, { "database": "iPTMnet", "id": "P09651-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Immobilized metal affinity chromatography revisited: pH/acid control toward high selectivity in phosphoproteomics.", "journal": "Journal of proteome research", "date": "2008", "authors": "Tsai CF, Wang YT, Chen YR, Lai CY, Lin PY, Pan KT, Chen JY, Khoo KH, Chen YJ", "evidence": [ { "database": "iPTMnet", "id": "P09651-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651-1" } ], "reference": [ { "type": "PubMed", "id": "18707149", "url": "https://glygen.org/publication/PubMed/18707149" } ] }, { "title": "Successive and selective release of phosphorylated peptides captured by hydroxy acid-modified metal oxide chromatography.", "journal": "Journal of proteome research", "date": "2008", "authors": "Kyono Y, Sugiyama N, Imami K, Tomita M, Ishihama Y", "evidence": [ { "database": "iPTMnet", "id": "P09651-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651-1" } ], "reference": [ { "type": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" } ] }, { "title": "Characterization of cDNAs encoding the polypyrimidine tract-binding protein.", "journal": "Genes & development", "date": "1991", "authors": "Gil A, Sharp PA, Jamison SF, Garcia-Blanco MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "1906035", "url": "https://glygen.org/publication/PubMed/1906035" } ] }, { "title": "Isolation and characterization of post-splicing lariat-intron complexes.", "journal": "Nucleic acids research", "date": "2009", "authors": "Yoshimoto R, Kataoka N, Okawa K, Ohno M", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "19103666", "url": "https://glygen.org/publication/PubMed/19103666" } ] }, { "title": "TFIP11 interacts with mDEAH9, an RNA helicase involved in spliceosome disassembly.", "journal": "International journal of molecular sciences", "date": "2008", "authors": "Wen X, Tannukit S, Paine ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "19165350", "url": "https://glygen.org/publication/PubMed/19165350" } ] }, { "title": "ESRP1 and ESRP2 are epithelial cell-type-specific regulators of FGFR2 splicing.", "journal": "Molecular cell", "date": "2009", "authors": "Warzecha CC, Sato TK, Nabet B, Hogenesch JB, Carstens RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "19285943", "url": "https://glygen.org/publication/PubMed/19285943" } ] }, { "title": "Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.", "journal": "J. Proteome Res.", "date": "2008", "authors": "Carrascal M, Ovelleiro D, Casas V, Gay M, Abian J", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "reference": [ { "type": "PubMed", "id": "19367720", "url": "https://glygen.org/publication/PubMed/19367720" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "P09651-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651-1" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "Exon, intron and splice site locations in the spliceosomal B complex.", "journal": "The EMBO journal", "date": "2009", "authors": "Wolf E, Kastner B, Deckert J, Merz C, Stark H, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "19536130", "url": "https://glygen.org/publication/PubMed/19536130" } ] }, { "title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "reference": [ { "type": "PubMed", "id": "19608861", "url": "https://glygen.org/publication/PubMed/19608861" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P09651-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651-1" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "The human telomerase RNA component, hTR, activates the DNA-dependent protein kinase to phosphorylate heterogeneous nuclear ribonucleoprotein A1.", "journal": "Nucleic acids research", "date": "2009", "authors": "Ting NS, Pohorelic B, Yu Y, Lees-Miller SP, Beattie TL", "evidence": [ { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" } ], "reference": [ { "type": "PubMed", "id": "19656952", "url": "https://glygen.org/publication/PubMed/19656952" } ] }, { "title": "Phosphorylation dynamics during early differentiation of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Van Hoof D, Munoz J, Braam SR, Pinkse MW, Linding R, Heck AJ, Mummery CL, Krijgsveld J", "evidence": [ { "database": "iPTMnet", "id": "P09651-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651-1" } ], "reference": [ { "type": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ] }, { "title": "A two-pronged strategy to suppress host protein synthesis by SARS coronavirus Nsp1 protein.", "journal": "Nature structural & molecular biology", "date": "2009", "authors": "Kamitani W, Huang C, Narayanan K, Lokugamage KG, Makino S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9735869", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9735869" } ], "reference": [ { "type": "PubMed", "id": "19838190", "url": "https://glygen.org/publication/PubMed/19838190" } ] }, { "title": "Multiple myeloma phosphotyrosine proteomic profile associated with FGFR3 expression, ligand activation, and drug inhibition.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "St-Germain JR, Taylor P, Tong J, Jin LL, Nikolic A, Stewart II, Ewing RM, Dharsee M, Li Z, Trudel S, Moran MF", "evidence": [ { "database": "iPTMnet", "id": "P09651-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651-1" } ], "reference": [ { "type": "PubMed", "id": "19901323", "url": "https://glygen.org/publication/PubMed/19901323" } ] }, { "title": "HnRNP proteins controlled by c-Myc deregulate pyruvate kinase mRNA splicing in cancer.", "journal": "Nature", "date": "2010-01-21", "authors": "David Charles J, Chen Mo, Assanah Marcela, Canoll Peter, Manley James L", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "reference": [ { "type": "PubMed", "id": "20010808", "url": "https://glygen.org/publication/PubMed/20010808" } ] }, { "title": "Extensive crosstalk between O-GlcNAcylation and phosphorylation regulates cytokinesis.", "journal": "Science signaling", "date": "2010", "authors": "Wang Z, Udeshi ND, Slawson C, Compton PD, Sakabe K, Cheung WD, Shabanowitz J, Hunt DF, Hart GW", "evidence": [ { "database": "iPTMnet", "id": "P09651-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651-1" } ], "reference": [ { "type": "PubMed", "id": "20068230", "url": "https://glygen.org/publication/PubMed/20068230" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" }, { "database": "iPTMnet", "id": "P09651-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Phosphoproteome analysis of human liver tissue by long-gradient nanoflow LC coupled with multiple stage MS analysis.", "journal": "Electrophoresis", "date": "2010", "authors": "Han G, Ye M, Liu H, Song C, Sun D, Wu Y, Jiang X, Chen R, Wang C, Wang L, Zou H", "evidence": [ { "database": "iPTMnet", "id": "P09651-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651-1" } ], "reference": [ { "type": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ] }, { "title": "Glycopeptide-specific monoclonal antibodies suggest new roles for O-GlcNAc.", "journal": "Nature chemical biology", "date": "2010", "authors": "Teo CF, Ingale S, Wolfert MA, Elsayed GA, Not LG, Chatham JC, Wells L, Boons GJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09651", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09651" } ], "reference": [ { "type": "PubMed", "id": "20305658", "url": "https://glygen.org/publication/PubMed/20305658" } ] }, { "title": "Contribution of DEAH-box protein DHX16 in human pre-mRNA splicing.", "journal": "The Biochemical journal", "date": "2010", "authors": "Gencheva M, Kato M, Newo AN, Lin RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "20423332", "url": "https://glygen.org/publication/PubMed/20423332" } ] }, { "title": "Characterization of purified human Bact spliceosomal complexes reveals compositional and morphological changes during spliceosome activation and first step catalysis.", "journal": "RNA (New York, N.Y.)", "date": "2010", "authors": "Bessonov S, Anokhina M, Krasauskas A, Golas MM, Sander B, Will CL, Urlaub H, Stark H, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "20980672", "url": "https://glygen.org/publication/PubMed/20980672" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" }, { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "Phosphomimetic substitution of heterogeneous nuclear ribonucleoprotein A1 at serine 199 abolishes AKT-dependent internal ribosome entry site-transacting factor (ITAF) function via effects on strand annealing and results in mammalian target of rapamycin complex 1 (mTORC1) inhibitor sensitivity.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Martin J, Masri J, Cloninger C, Holmes B, Artinian N, Funk A, Ruegg T, Anderson L, Bashir T, Bernath A, Lichtenstein A, Gera J", "evidence": [ { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" } ], "reference": [ { "type": "PubMed", "id": "21454539", "url": "https://glygen.org/publication/PubMed/21454539" } ] }, { "title": "Semiquantitative proteomic analysis of the human spliceosome via a novel two-dimensional gel electrophoresis method.", "journal": "Molecular and cellular biology", "date": "2011", "authors": "Agafonov DE, Deckert J, Wolf E, Odenwalder P, Bessonov S, Will CL, Urlaub H, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "21536652", "url": "https://glygen.org/publication/PubMed/21536652" } ] }, { "title": "Combining high-energy C-trap dissociation and electron transfer dissociation for protein O-GlcNAc modification site assignment.", "journal": "Journal of proteome research", "date": "2011", "authors": "Zhao P, Viner R, Teo CF, Boons GJ, Horn D, Wells L", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09651", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09651" } ], "reference": [ { "type": "PubMed", "id": "21740066", "url": "https://glygen.org/publication/PubMed/21740066" } ] }, { "title": "Modeling by homology of RNA binding domain in A1 hnRNP protein.", "journal": "FEBS Lett.", "date": "1990", "authors": "Ghetti A, Bolognesi M, Cobianchi F, Morandi C", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "reference": [ { "type": "PubMed", "id": "2176620", "url": "https://glygen.org/publication/PubMed/2176620" } ] }, { "title": "Evidence for base-pairing between mammalian U2 and U6 small nuclear ribonucleoprotein particles.", "journal": "Genes & development", "date": "1990", "authors": "Hausner TP, Giglio LM, Weiner AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "2176635", "url": "https://glygen.org/publication/PubMed/2176635" } ] }, { "title": "Functional mammalian spliceosomal complex E contains SMN complex proteins in addition to U1 and U2 snRNPs.", "journal": "Nucleic acids research", "date": "2012", "authors": "Makarov EM, Owen N, Bottrill A, Makarova OV", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "22110043", "url": "https://glygen.org/publication/PubMed/22110043" } ] }, { "title": "GlcNAcylation of histone H2B facilitates its monoubiquitination.", "journal": "Nature", "date": "2011", "authors": "Fujiki R, Hashiba W, Sekine H, Yokoyama A, Chikanishi T, Ito S, Imai Y, Kim J, He HH, Igarashi K, Kanno J, Ohtake F, Kitagawa H, Roeder RG, Brown M, Kato S", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09651", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09651" } ], "reference": [ { "type": "PubMed", "id": "22121020", "url": "https://glygen.org/publication/PubMed/22121020" } ] }, { "title": "SARS coronavirus nsp1 protein induces template-dependent endonucleolytic cleavage of mRNAs: viral mRNAs are resistant to nsp1-induced RNA cleavage.", "journal": "PLoS pathogens", "date": "2011", "authors": "Huang C, Lokugamage KG, Rozovics JM, Narayanan K, Semler BL, Makino S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9735869", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9735869" } ], "reference": [ { "type": "PubMed", "id": "22174690", "url": "https://glygen.org/publication/PubMed/22174690" } ] }, { "title": "Dynamic protein-protein interaction wiring of the human spliceosome.", "journal": "Molecular cell", "date": "2012", "authors": "Hegele A, Kamburov A, Grossmann A, Sourlis C, Wowro S, Weimann M, Will CL, Pena V, Luhrmann R, Stelzl U", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "22365833", "url": "https://glygen.org/publication/PubMed/22365833" } ] }, { "title": "Severe acute respiratory syndrome coronavirus nsp1 facilitates efficient propagation in cells through a specific translational shutoff of host mRNA.", "journal": "Journal of virology", "date": "2012", "authors": "Tanaka T, Kamitani W, DeDiego ML, Enjuanes L, Matsuura Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9735869", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9735869" } ], "reference": [ { "type": "PubMed", "id": "22855488", "url": "https://glygen.org/publication/PubMed/22855488" } ] }, { "title": "CWC22 connects pre-mRNA splicing and exon junction complex assembly.", "journal": "Cell reports", "date": "2012", "authors": "Steckelberg AL, Boehm V, Gromadzka AM, Gehring NH", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "22959432", "url": "https://glygen.org/publication/PubMed/22959432" } ] }, { "title": "Human CWC22 escorts the helicase eIF4AIII to spliceosomes and promotes exon junction complex assembly.", "journal": "Nature structural & molecular biology", "date": "2012", "authors": "Barbosa I, Haque N, Fiorini F, Barrandon C, Tomasetto C, Blanchette M, Le Hir H", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "22961380", "url": "https://glygen.org/publication/PubMed/22961380" } ] }, { "title": "Severe acute respiratory syndrome coronavirus protein nsp1 is a novel eukaryotic translation inhibitor that represses multiple steps of translation initiation.", "journal": "Journal of virology", "date": "2012", "authors": "Lokugamage KG, Narayanan K, Huang C, Makino S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9735869", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9735869" } ], "reference": [ { "type": "PubMed", "id": "23035226", "url": "https://glygen.org/publication/PubMed/23035226" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" }, { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Aly and THO are required for assembly of the human TREX complex and association of TREX components with the spliced mRNA.", "journal": "Nucleic acids research", "date": "2013", "authors": "Chi B, Wang Q, Wu G, Tan M, Wang L, Shi M, Chang X, Cheng H", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "23222130", "url": "https://glygen.org/publication/PubMed/23222130" } ] }, { "title": "Human spliceosomal protein CWC22 plays a role in coupling splicing to exon junction complex deposition and nonsense-mediated decay.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Alexandrov A, Colognori D, Shu MD, Steitz JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "23236153", "url": "https://glygen.org/publication/PubMed/23236153" } ] }, { "title": "Rearrangements within human spliceosomes captured after exon ligation.", "journal": "RNA (New York, N.Y.)", "date": "2013", "authors": "Ilagan JO, Chalkley RJ, Burlingame AL, Jurica MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "23345524", "url": "https://glygen.org/publication/PubMed/23345524" } ] }, { "title": "Mutations in prion-like domains in hnRNPA2B1 and hnRNPA1 cause multisystem proteinopathy and ALS.", "journal": "Nature", "date": "2013", "authors": "Kim HJ, Kim NC, Wang YD, Scarborough EA, Moore J, Diaz Z, MacLea KS, Freibaum B, Li S, Molliex A, Kanagaraj AP, Carter R, Boylan KB, Wojtas AM, Rademakers R, Pinkus JL, Greenberg SA, Trojanowski JQ, Traynor BJ, Smith BN, Topp S, Gkazi AS, Miller J, Shaw CE, Kottlors M, Kirschner J, Pestronk A, Li YR, Ford AF, Gitler AD, Benatar M, King OD, Kimonis VE, Ross ED, Weihl CC, Shorter J, Taylor JP", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" }, { "database": "dbSNP", "id": "rs397518454", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs397518454" } ], "reference": [ { "type": "PubMed", "id": "23455423", "url": "https://glygen.org/publication/PubMed/23455423" } ] }, { "title": "Specificity factors in cytoplasmic polyadenylation.", "journal": "Wiley interdisciplinary reviews. RNA", "date": "2013", "authors": "Charlesworth A, Meijer HA, de Moor CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-72203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72203" } ], "reference": [ { "type": "PubMed", "id": "23776146", "url": "https://glygen.org/publication/PubMed/23776146" } ] }, { "title": "Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Guo A, Gu H, Zhou J, Mulhern D, Wang Y, Lee KA, Yang V, Aguiar M, Kornhauser J, Jia X, Ren J, Beausoleil SA, Silva JC, Vemulapalli V, Bedford MT, Comb MJ", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "reference": [ { "type": "PubMed", "id": "24129315", "url": "https://glygen.org/publication/PubMed/24129315" } ] }, { "title": "RNA catalyses nuclear pre-mRNA splicing.", "journal": "Nature", "date": "2013", "authors": "Fica SM, Tuttle N, Novak T, Li NS, Lu J, Koodathingal P, Dai Q, Staley JP, Piccirilli JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "24196718", "url": "https://glygen.org/publication/PubMed/24196718" } ] }, { "title": "Identification of a novel component C2ORF3 in the lariat-intron complex: lack of C2ORF3 interferes with pre-mRNA splicing via intron turnover pathway.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2014", "authors": "Yoshimoto R, Okawa K, Yoshida M, Ohno M, Kataoka N", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "24304693", "url": "https://glygen.org/publication/PubMed/24304693" } ] }, { "title": "A METTL3-METTL14 complex mediates mammalian nuclear RNA N6-adenosine methylation.", "journal": "Nature chemical biology", "date": "2014", "authors": "Liu J, Yue Y, Han D, Wang X, Fu Y, Zhang L, Jia G, Yu M, Lu Z, Deng X, Dai Q, Chen W, He C", "evidence": [ { "database": "Reactome", "id": "R-HSA-72203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72203" } ], "reference": [ { "type": "PubMed", "id": "24316715", "url": "https://glygen.org/publication/PubMed/24316715" } ] }, { "title": "Mammalian WTAP is a regulatory subunit of the RNA N6-methyladenosine methyltransferase.", "journal": "Cell research", "date": "2014", "authors": "Ping XL, Sun BF, Wang L, Xiao W, Yang X, Wang WJ, Adhikari S, Shi Y, Lv Y, Chen YS, Zhao X, Li A, Yang Y, Dahal U, Lou XM, Liu X, Huang J, Yuan WP, Zhu XF, Cheng T, Zhao YL, Wang X, Rendtlew Danielsen JM, Liu F, Yang YG", "evidence": [ { "database": "Reactome", "id": "R-HSA-72203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72203" } ], "reference": [ { "type": "PubMed", "id": "24407421", "url": "https://glygen.org/publication/PubMed/24407421" } ] }, { "title": "Mass spectrometry-based relative quantification of proteins in precatalytic and catalytically active spliceosomes by metabolic labeling (SILAC), chemical labeling (iTRAQ), and label-free spectral count.", "journal": "RNA (New York, N.Y.)", "date": "2014", "authors": "Schmidt C, Gronborg M, Deckert J, Bessonov S, Conrad T, Luhrmann R, Urlaub H", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "24448447", "url": "https://glygen.org/publication/PubMed/24448447" } ] }, { "title": "C9ORF72, implicated in amytrophic lateral sclerosis and frontotemporal dementia, regulates endosomal trafficking.", "journal": "Hum. Mol. Genet.", "date": "2014", "authors": "Farg Manal A, Sundaramoorthy Vinod, Sultana Jessica M, Yang Shu, Atkinson Rachel A K, Levina Vita, Halloran Mark A, Gleeson Paul A, Blair Ian P, Soo Kai Y, King Anna E, Atkin Julie D", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "reference": [ { "type": "PubMed", "id": "24549040", "url": "https://glygen.org/publication/PubMed/24549040" } ] }, { "title": "A missense mutation in the splicing factor gene DHX38 is associated with early-onset retinitis pigmentosa with macular coloboma.", "journal": "Journal of medical genetics", "date": "2014", "authors": "Ajmal M, Khan MI, Neveling K, Khan YM, Azam M, Waheed NK, Hamel CP, Ben-Yosef T, De Baere E, Koenekoop RK, Collin RW, Qamar R, Cremers FP", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "24737827", "url": "https://glygen.org/publication/PubMed/24737827" } ] }, { "title": "Structural and functional analysis of the human spliceosomal DEAD-box helicase Prp28.", "journal": "Acta crystallographica. Section D, Biological crystallography", "date": "2014", "authors": "Mohlmann S, Mathew R, Neumann P, Schmitt A, Luhrmann R, Ficner R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "24914973", "url": "https://glygen.org/publication/PubMed/24914973" } ] }, { "title": "Perturbation of m6A writers reveals two distinct classes of mRNA methylation at internal and 5' sites.", "journal": "Cell reports", "date": "2014", "authors": "Schwartz S, Mumbach MR, Jovanovic M, Wang T, Maciag K, Bushkin GG, Mertins P, Ter-Ovanesyan D, Habib N, Cacchiarelli D, Sanjana NE, Freinkman E, Pacold ME, Satija R, Mikkelsen TS, Hacohen N, Zhang F, Carr SA, Lander ES, Regev A", "evidence": [ { "database": "Reactome", "id": "R-HSA-72203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72203" } ], "reference": [ { "type": "PubMed", "id": "24981863", "url": "https://glygen.org/publication/PubMed/24981863" } ] }, { "title": "hnRNPA1 couples nuclear export and translation of specific mRNAs downstream of FGF-2/S6K2 signalling.", "journal": "Nucleic acids research", "date": "2014", "authors": "Roy R, Durie D, Li H, Liu BQ, Skehel JM, Mauri F, Cuorvo LV, Barbareschi M, Guo L, Holcik M, Seckl MJ, Pardo OE", "evidence": [ { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" } ], "reference": [ { "type": "PubMed", "id": "25324306", "url": "https://glygen.org/publication/PubMed/25324306" } ] }, { "title": "Coronavirus nonstructural protein 1: Common and distinct functions in the regulation of host and viral gene expression.", "journal": "Virus research", "date": "2015", "authors": "Narayanan K, Ramirez SI, Lokugamage KG, Makino S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9735869", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9735869" } ], "reference": [ { "type": "PubMed", "id": "25432065", "url": "https://glygen.org/publication/PubMed/25432065" } ] }, { "title": "Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.", "journal": "eLife", "date": "2015", "authors": "Kondo Y, Oubridge C, van Roon AM, Nagai K", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "25555158", "url": "https://glygen.org/publication/PubMed/25555158" } ] }, { "title": "Mammalian pre-mRNA branch site selection by U2 snRNP involves base pairing.", "journal": "Genes & development", "date": "1989", "authors": "Wu J, Manley JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "2558966", "url": "https://glygen.org/publication/PubMed/2558966" } ] }, { "title": "ALS-linked mutations in ubiquilin-2 or hnRNPA1 reduce interaction between ubiquilin-2 and hnRNPA1.", "journal": "Human molecular genetics", "date": "2015", "authors": "Gilpin KM, Chang L, Monteiro MJ", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "reference": [ { "type": "PubMed", "id": "25616961", "url": "https://glygen.org/publication/PubMed/25616961" } ] }, { "title": "Peptidylprolyl isomerase A governs TARDBP function and assembly in heterogeneous nuclear ribonucleoprotein complexes.", "journal": "Brain", "date": "2015", "authors": "Lauranzano E, Pozzi S, Pasetto L, Stucchi R, Massignan T, Paolella K, Mombrini M, Nardo G, Lunetta C, Corbo M, Mora G, Bendotti C, Bonetto V", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "reference": [ { "type": "PubMed", "id": "25678563", "url": "https://glygen.org/publication/PubMed/25678563" } ] }, { "title": "System-wide analysis of SUMOylation dynamics in response to replication stress reveals novel small ubiquitin-like modified target proteins and acceptor lysines relevant for genome stability.", "journal": "Mol. Cell. Proteomics", "date": "2015", "authors": "Xiao Zhenyu, Chang Jer-Gung, Hendriks Ivo A, Sigur\u00f0sson J\u00f3n Otti, Olsen Jesper V, Vertegaal Alfred C O", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "reference": [ { "type": "PubMed", "id": "25755297", "url": "https://glygen.org/publication/PubMed/25755297" } ] }, { "title": "DNA-PKcs phosphorylates hnRNP-A1 to facilitate the RPA-to-POT1 switch and telomere capping after replication.", "journal": "Nucleic acids research", "date": "2015", "authors": "Sui J, Lin YF, Xu K, Lee KJ, Wang D, Chen BP", "evidence": [ { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" } ], "reference": [ { "type": "PubMed", "id": "25999341", "url": "https://glygen.org/publication/PubMed/25999341" } ] }, { "title": "Stable tri-snRNP integration is accompanied by a major structural rearrangement of the spliceosome that is dependent on Prp8 interaction with the 5' splice site.", "journal": "RNA (New York, N.Y.)", "date": "2015", "authors": "Boesler C, Rigo N, Agafonov DE, Kastner B, Urlaub H, Will CL, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "26385511", "url": "https://glygen.org/publication/PubMed/26385511" } ] }, { "title": "Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.", "journal": "Nucleic acids research", "date": "2015", "authors": "Crisci A, Raleff F, Bagdiul I, Raabe M, Urlaub H, Rain JC, Kramer A", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "26420826", "url": "https://glygen.org/publication/PubMed/26420826" } ] }, { "title": "Noncanonical registers and base pairs in human 5' splice-site selection.", "journal": "Nucleic acids research", "date": "2016", "authors": "Tan J, Ho JX, Zhong Z, Luo S, Chen G, Roca X", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "26969736", "url": "https://glygen.org/publication/PubMed/26969736" } ] }, { "title": "A spliceosome intermediate with loosely associated tri-snRNP accumulates in the absence of Prp28 ATPase activity.", "journal": "Nature communications", "date": "2016", "authors": "Boesler C, Rigo N, Anokhina MM, Tauchert MJ, Agafonov DE, Kastner B, Urlaub H, Ficner R, Will CL, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "27377154", "url": "https://glygen.org/publication/PubMed/27377154" } ] }, { "title": "Cryo-EM structure of the spliceosome immediately after branching.", "journal": "Nature", "date": "2016", "authors": "Galej WP, Wilkinson ME, Fica SM, Oubridge C, Newman AJ, Nagai K", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "27459055", "url": "https://glygen.org/publication/PubMed/27459055" } ] }, { "title": "Isolation of an active gene encoding human hnRNP protein A1. Evidence for alternative splicing.", "journal": "J. Mol. Biol.", "date": "1989", "authors": "Biamonti G, Buvoli M, Bassi M T, Morandi C, Cobianchi F, Riva S", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "reference": [ { "type": "PubMed", "id": "2760922", "url": "https://glygen.org/publication/PubMed/2760922" } ] }, { "title": "Stoichiometries of U2AF35, U2AF65 and U2 snRNP reveal new early spliceosome assembly pathways.", "journal": "Nucleic acids research", "date": "2017", "authors": "Chen L, Weinmeister R, Kralovicova J, Eperon LP, Vorechovsky I, Hudson AJ, Eperon IC", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "27683217", "url": "https://glygen.org/publication/PubMed/27683217" } ] }, { "title": "Whole-exome sequencing identifies a missense mutation in hnRNPA1 in a family with flail arm ALS.", "journal": "Neurology", "date": "2016", "authors": "Liu Q, Shu S, Wang RR, Liu F, Cui B, Guo XN, Lu CX, Li XG, Liu MS, Peng B, Cui LY, Zhang X", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "reference": [ { "type": "PubMed", "id": "27694260", "url": "https://glygen.org/publication/PubMed/27694260" } ] }, { "title": "The effect of O-GlcNAcylation on hnRNP A1 translocation and interaction with transportin1.", "journal": "Experimental cell research", "date": "2017", "authors": "Roth S, Khalaila I", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09651", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09651" }, { "database": "O-GlcNAc Atlas", "id": "P09651", "url": "https://oglcnac.org/atlas/detail/P09651" } ], "reference": [ { "type": "PubMed", "id": "27913144", "url": "https://glygen.org/publication/PubMed/27913144" } ] }, { "title": "Human cactin interacts with DHX8 and SRRM2 to assure efficient pre-mRNA splicing and sister chromatid cohesion.", "journal": "Journal of cell science", "date": "2017", "authors": "Zanini IM, Soneson C, Lorenzi LE, Azzalin CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "28062851", "url": "https://glygen.org/publication/PubMed/28062851" } ] }, { "title": "Cryo-EM structure of a human spliceosome activated for step 2 of splicing.", "journal": "Nature", "date": "2017", "authors": "Bertram K, Agafonov DE, Liu WT, Dybkov O, Will CL, Hartmuth K, Urlaub H, Kastner B, Stark H, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "28076346", "url": "https://glygen.org/publication/PubMed/28076346" } ] }, { "title": "cDNA cloning of human hnRNP protein A1 reveals the existence of multiple mRNA isoforms.", "journal": "Nucleic Acids Res.", "date": "1988", "authors": "Buvoli M, Biamonti G, Tsoulfas P, Bassi M T, Ghetti A, Riva S, Morandi C", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "reference": [ { "type": "PubMed", "id": "2836799", "url": "https://glygen.org/publication/PubMed/2836799" } ] }, { "title": "A Compendium of RNA-Binding Proteins that Regulate MicroRNA Biogenesis.", "journal": "Molecular cell", "date": "2017", "authors": "Treiber T, Treiber N, Plessmann U, Harlander S, Daiss JL, Eichner N, Lehmann G, Schall K, Urlaub H, Meister G", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "reference": [ { "type": "PubMed", "id": "28431233", "url": "https://glygen.org/publication/PubMed/28431233" } ] }, { "title": "An Atomic Structure of the Human Spliceosome.", "journal": "Cell", "date": "2017", "authors": "Zhang X, Yan C, Hang J, Finci LI, Lei J, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "28502770", "url": "https://glygen.org/publication/PubMed/28502770" } ] }, { "title": "Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.", "journal": "Cell", "date": "2017", "authors": "Bertram K, Agafonov DE, Dybkov O, Haselbach D, Leelaram MN, Will CL, Urlaub H, Kastner B, Luhrmann R, Stark H", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "28781166", "url": "https://glygen.org/publication/PubMed/28781166" } ] }, { "title": "A Peptide Encoded by a Putative lncRNA HOXB-AS3 Suppresses Colon Cancer Growth.", "journal": "Molecular cell", "date": "2017", "authors": "Huang JZ, Chen M, Chen D, Gao XC, Zhu S, Huang H, Hu M, Zhu H, Yan GR", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "reference": [ { "type": "PubMed", "id": "28985503", "url": "https://glygen.org/publication/PubMed/28985503" } ] }, { "title": "Artificial Cysteine S-Glycosylation Induced by Per-O-Acetylated Unnatural Monosaccharides during Metabolic Glycan Labeling.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2018", "authors": "Qin W, Qin K, Fan X, Peng L, Hong W, Zhu Y, Lv P, Du Y, Huang R, Han M, Cheng B, Liu Y, Zhou W, Wang C, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09651", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09651" } ], "reference": [ { "type": "PubMed", "id": "29237092", "url": "https://glygen.org/publication/PubMed/29237092" } ] }, { "title": "Structure of a human catalytic step I spliceosome.", "journal": "Science (New York, N.Y.)", "date": "2018", "authors": "Zhan X, Yan C, Zhang X, Lei J, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "29301961", "url": "https://glygen.org/publication/PubMed/29301961" } ] }, { "title": "Phosphorylation of Ser6 in hnRNPA1 by S6K2 regulates glucose metabolism and cell growth in colorectal cancer.", "journal": "Oncology letters", "date": "2017", "authors": "Sun Y, Luo M, Chang G, Ren W, Wu K, Li X, Shen J, Zhao X, Hu Y", "evidence": [ { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" } ], "reference": [ { "type": "PubMed", "id": "29344170", "url": "https://glygen.org/publication/PubMed/29344170" } ] }, { "title": "Mapping and Quantification of Over 2000 O-linked Glycopeptides in Activated Human T Cells with Isotope-Targeted Glycoproteomics (Isotag).", "journal": "Molecular & cellular proteomics : MCP", "date": "2018", "authors": "Woo CM, Lund PJ, Huang AC, Davis MM, Bertozzi CR, Pitteri SJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09651", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09651" }, { "database": "O-GlcNAc Atlas", "id": "P09651", "url": "https://oglcnac.org/atlas/detail/P09651" } ], "reference": [ { "type": "PubMed", "id": "29351928", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "title": "Structure of the human activated spliceosome in three conformational states.", "journal": "Cell research", "date": "2018", "authors": "Zhang X, Yan C, Zhan X, Li L, Lei J, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "29360106", "url": "https://glygen.org/publication/PubMed/29360106" } ] }, { "title": "Structure and Conformational Dynamics of the Human Spliceosomal B(act) Complex.", "journal": "Cell", "date": "2018", "authors": "Haselbach D, Komarov I, Agafonov DE, Hartmuth K, Graf B, Dybkov O, Urlaub H, Kastner B, Luhrmann R, Stark H", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "29361316", "url": "https://glygen.org/publication/PubMed/29361316" } ] }, { "title": "Spliceosome assembly involves the binding and release of U4 small nuclear ribonucleoprotein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1988", "authors": "Lamond AI, Konarska MM, Grabowski PJ, Sharp PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "2963332", "url": "https://glygen.org/publication/PubMed/2963332" } ] }, { "title": "Quantitative Profiling of Protein O-GlcNAcylation Sites by an Isotope-Tagged Cleavable Linker.", "journal": "ACS chemical biology", "date": "2018", "authors": "Qin K, Zhu Y, Qin W, Gao J, Shao X, Wang YL, Zhou W, Wang C, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09651", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09651" }, { "database": "O-GlcNAc Atlas", "id": "P09651", "url": "https://oglcnac.org/atlas/detail/P09651" } ], "reference": [ { "type": "PubMed", "id": "30059200", "url": "https://glygen.org/publication/PubMed/30059200" } ] }, { "title": "Mammalian single-stranded DNA binding protein UP I is derived from the hnRNP core protein A1.", "journal": "EMBO J.", "date": "1986", "authors": "Riva S, Morandi C, Tsoulfas P, Pandolfo M, Biamonti G, Merrill B, Williams K R, Multhaup G, Beyreuther K, Werr H", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "reference": [ { "type": "PubMed", "id": "3023065", "url": "https://glygen.org/publication/PubMed/3023065" } ] }, { "title": "Structures of the human pre-catalytic spliceosome and its precursor spliceosome.", "journal": "Cell research", "date": "2018", "authors": "Zhan X, Yan C, Zhang X, Lei J, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "30315277", "url": "https://glygen.org/publication/PubMed/30315277" } ] }, { "title": "O-GlcNAc-induced nuclear translocation of hnRNP-K is associated with progression and metastasis of cholangiocarcinoma.", "journal": "Molecular oncology", "date": "2019", "authors": "Phoomak C, Park D, Silsirivanit A, Sawanyawisuth K, Vaeteewoottacharn K, Detarya M, Wongkham C, Lebrilla CB, Wongkham S", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09651", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09651" } ], "reference": [ { "type": "PubMed", "id": "30444036", "url": "https://glygen.org/publication/PubMed/30444036" } ] }, { "title": "An Isotope-Coded Photocleavable Probe for Quantitative Profiling of Protein O-GlcNAcylation.", "journal": "ACS chemical biology", "date": "2019", "authors": "Li J, Li Z, Duan X, Qin K, Dang L, Sun S, Cai L, Hsieh-Wilson LC, Wu L, Yi W", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "P09651", "url": "https://oglcnac.org/atlas/detail/P09651" } ], "reference": [ { "type": "PubMed", "id": "30620550", "url": "https://glygen.org/publication/PubMed/30620550" } ] }, { "title": "A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.", "journal": "Science (New York, N.Y.)", "date": "2019", "authors": "Fica SM, Oubridge C, Wilkinson ME, Newman AJ, Nagai K", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "30705154", "url": "https://glygen.org/publication/PubMed/30705154" } ] }, { "title": "Structures of the human spliceosomes before and after release of the ligated exon.", "journal": "Cell research", "date": "2019", "authors": "Zhang X, Zhan X, Yan C, Zhang W, Liu D, Lei J, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "30728453", "url": "https://glygen.org/publication/PubMed/30728453" } ] }, { "title": "Structural Insights into Nuclear pre-mRNA Splicing in Higher Eukaryotes.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2019", "authors": "Kastner B, Will CL, Stark H, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "30765414", "url": "https://glygen.org/publication/PubMed/30765414" } ] }, { "title": "Mechanism of 5' splice site transfer for human spliceosome activation.", "journal": "Science (New York, N.Y.)", "date": "2019", "authors": "Charenton C, Wilkinson ME, Nagai K", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "30975767", "url": "https://glygen.org/publication/PubMed/30975767" } ] }, { "title": "Aspartate Residues Far from the Active Site Drive O-GlcNAc Transferase Substrate Selection.", "journal": "Journal of the American Chemical Society", "date": "2019", "authors": "Joiner CM, Levine ZG, Aonbangkhen C, Woo CM, Walker S", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09651", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09651" }, { "database": "O-GlcNAc Atlas", "id": "P09651", "url": "https://oglcnac.org/atlas/detail/P09651" } ], "reference": [ { "type": "PubMed", "id": "31373491", "url": "https://glygen.org/publication/PubMed/31373491" } ] }, { "title": "Structural and functional characterisation of human RNA helicase DHX8 provides insights into the mechanism of RNA-stimulated ADP release.", "journal": "The Biochemical journal", "date": "2019", "authors": "Felisberto-Rodrigues C, Thomas JC, McAndrew C, Le Bihan YV, Burke R, Workman P, van Montfort RLM", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "31409651", "url": "https://glygen.org/publication/PubMed/31409651" } ] }, { "title": "Next-generation unnatural monosaccharides reveal that ESRRB O-GlcNAcylation regulates pluripotency of mouse embryonic stem cells.", "journal": "Nature communications", "date": "2019", "authors": "Hao Y, Fan X, Shi Y, Zhang C, Sun DE, Qin K, Qin W, Zhou W, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09651", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09651" }, { "database": "O-GlcNAc Atlas", "id": "P09651", "url": "https://oglcnac.org/atlas/detail/P09651" } ], "reference": [ { "type": "PubMed", "id": "31492838", "url": "https://glygen.org/publication/PubMed/31492838" } ] }, { "title": "EV71 3C protease induces apoptosis by cleavage of hnRNP A1 to promote apaf-1 translation.", "journal": "PloS one", "date": "2019", "authors": "Li ML, Lin JY, Chen BS, Weng KF, Shih SR, Calderon JD, Tolbert BS, Brewer G", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "reference": [ { "type": "PubMed", "id": "31498791", "url": "https://glygen.org/publication/PubMed/31498791" } ] }, { "title": "Engineering a Proximity-Directed O-GlcNAc Transferase for Selective Protein O-GlcNAcylation in Cells.", "journal": "ACS chemical biology", "date": "2020", "authors": "Ramirez DH, Aonbangkhen C, Wu HY, Naftaly JA, Tang S, O'Meara TR, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09651", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09651" } ], "reference": [ { "type": "PubMed", "id": "32119511", "url": "https://glygen.org/publication/PubMed/32119511" } ] }, { "title": "Structural basis for DEAH-helicase activation by G-patch proteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2020", "authors": "Studer MK, Ivanovic L, Weber ME, Marti S, Jonas S", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "32179686", "url": "https://glygen.org/publication/PubMed/32179686" } ] }, { "title": "Structural and functional insights into CWC27/CWC22 heterodimer linking the exon junction complex to spliceosomes.", "journal": "Nucleic acids research", "date": "2020", "authors": "Busetto V, Barbosa I, Basquin J, Marquenet E, Hocq R, Hennion M, Paternina JA, Namane A, Conti E, Bensaude O, Le Hir H", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "32329775", "url": "https://glygen.org/publication/PubMed/32329775" } ] }, { "title": "Molecular architecture of the human 17S U2 snRNP.", "journal": "Nature", "date": "2020", "authors": "Zhang Z, Will CL, Bertram K, Dybkov O, Hartmuth K, Agafonov DE, Hofele R, Urlaub H, Kastner B, Luhrmann R, Stark H", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "32494006", "url": "https://glygen.org/publication/PubMed/32494006" } ] }, { "title": "A Chemoenzymatic Method Based on Easily Accessible Enzymes for Profiling Protein O-GlcNAcylation.", "journal": "Analytical chemistry", "date": "2020", "authors": "Xu S, Sun F, Wu R", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09651", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09651" }, { "database": "O-GlcNAc Atlas", "id": "P09651", "url": "https://oglcnac.org/atlas/detail/P09651" } ], "reference": [ { "type": "PubMed", "id": "32574038", "url": "https://glygen.org/publication/PubMed/32574038" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09651", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09651" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.", "journal": "Science (New York, N.Y.)", "date": "2020", "authors": "Townsend C, Leelaram MN, Agafonov DE, Dybkov O, Will CL, Bertram K, Urlaub H, Kastner B, Stark H, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "33243851", "url": "https://glygen.org/publication/PubMed/33243851" } ] }, { "title": "Depleting deubiquitinating enzymes promotes apoptosis in glioma cell line via RNA binding proteins SF2/ASF1.", "journal": "Biochemistry and biophysics reports", "date": "2020-12", "authors": "Vashistha Vidhi, Bhardwaj Sachin, Yadav Birendra K, Yadav Ajay K", "evidence": [ { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" } ], "reference": [ { "type": "PubMed", "id": "33319070", "url": "https://glygen.org/publication/PubMed/33319070" } ] }, { "title": "Overexpression of SARS-CoV-2 protein ORF6 dislocates RAE1 and NUP98 from the nuclear pore complex.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2021", "authors": "Kato K, Ikliptikawati DK, Kobayashi A, Kondo H, Lim K, Hazawa M, Wong RW", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "reference": [ { "type": "PubMed", "id": "33360543", "url": "https://glygen.org/publication/PubMed/33360543" } ] }, { "title": "Structure of a transcribing RNA polymerase II-U1 snRNP complex.", "journal": "Science (New York, N.Y.)", "date": "2021", "authors": "Zhang S, Aibara S, Vos SM, Agafonov DE, Luhrmann R, Cramer P", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "33446560", "url": "https://glygen.org/publication/PubMed/33446560" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09651", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09651" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "hnRNPA1 enhances FOXP3 stability to promote the differentiation and functions of regulatory T cells.", "journal": "FEBS letters", "date": "2021", "authors": "Liu X, Tian N, Huang Q, Xu Z, Cheng H, Liu X, Li D, Liang R, Li B, Dai X", "evidence": [ { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" } ], "reference": [ { "type": "PubMed", "id": "34080184", "url": "https://glygen.org/publication/PubMed/34080184" } ] }, { "title": "Structural basis of intron selection by U2 snRNP in the presence of covalent inhibitors.", "journal": "Nature communications", "date": "2021", "authors": "Cretu C, Gee P, Liu X, Agrawal A, Nguyen TV, Ghosh AK, Cook A, Jurica M, Larsen NA, Pena V", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "34301950", "url": "https://glygen.org/publication/PubMed/34301950" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09651", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09651" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "Structural basis of branch site recognition by the human spliceosome.", "journal": "Science (New York, N.Y.)", "date": "2022", "authors": "Tholen J, Razew M, Weis F, Galej WP", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "34822310", "url": "https://glygen.org/publication/PubMed/34822310" } ] }, { "title": "O-GlcNAcylation promotes fatty acid synthase activity under nutritional stress as a pro-survival mechanism in cancer cells.", "journal": "Proteomics", "date": "2022", "authors": "Wong YK, Wang J, Lim TK, Lin Q, Yap CT, Shen HM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09651", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09651" } ], "reference": [ { "type": "PubMed", "id": "35083852", "url": "https://glygen.org/publication/PubMed/35083852" } ] }, { "title": "Simultaneously Identifying and Distinguishing Glycoproteins with O-GlcNAc and O-GalNAc (the Tn Antigen) in Human Cancer Cells.", "journal": "Analytical chemistry", "date": "2022", "authors": "Xu S, Zheng J, Xiao H, Wu R", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09651", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09651" } ], "reference": [ { "type": "PubMed", "id": "35132862", "url": "https://glygen.org/publication/PubMed/35132862" } ] }, { "title": "Retinitis pigmentosa-linked mutation in DHX38 modulates its splicing activity.", "journal": "PloS one", "date": "2022", "authors": "Obuca M, Cvackova Z, Kubovciak J, Kolar M, Stanek D", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "35385551", "url": "https://glygen.org/publication/PubMed/35385551" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09651", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09651" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "HnRNP A1 Suppresses the Odontogenic Differentiation and the Inclusion of RUNX2 Exon 5 of Dental Mesenchymal Cells.", "journal": "Frontiers in bioscience (Landmark edition)", "date": "2023-07-19", "authors": "Zhang Yanan, Huang Junjun, Yan Lingyan, Jia Rong, Guo Jihua", "evidence": [ { "database": "RefSeq", "id": "NP_002127", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002127" } ], "reference": [ { "type": "PubMed", "id": "37525910", "url": "https://glygen.org/publication/PubMed/37525910" } ] }, { "title": "A compensatory base change in U1 snRNA suppresses a 5' splice site mutation.", "journal": "Cell", "date": "1986", "authors": "Zhuang Y, Weiner AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "3757028", "url": "https://glygen.org/publication/PubMed/3757028" } ] }, { "title": "The mechanism of UP1 binding and unfolding of human telomeric DNA G-quadruplex.", "journal": "Biochimica et biophysica acta. Gene regulatory mechanisms", "date": "2023-12", "authors": "Ling Xiaobin, Yao Yuqi, Ding Lei, Ma Jinbiao", "evidence": [ { "database": "RefSeq", "id": "NP_002127", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002127" } ], "reference": [ { "type": "PubMed", "id": "37717939", "url": "https://glygen.org/publication/PubMed/37717939" } ] }, { "title": "N6-methyladenosine modification of OIP5-AS1 promotes glycolysis, tumorigenesis, and metastasis of gastric cancer by inhibiting Trim21-mediated hnRNPA1 ubiquitination and degradation.", "journal": "Gastric cancer : official journal of the International Gastric Cancer Association and the Japanese Gastric Cancer Association", "date": "2024-01", "authors": "Xie Rongjun, Liu Longfei, Lu Xianzhou, He Chengjian, Yao Hongyi, Li Guoxin", "evidence": [ { "database": "RefSeq", "id": "NP_002127", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002127" } ], "reference": [ { "type": "PubMed", "id": "37897508", "url": "https://glygen.org/publication/PubMed/37897508" } ] }, { "title": "Regulation of in vitro nucleic acid strand annealing activity of heterogeneous nuclear ribonucleoprotein protein A1 by reversible phosphorylation.", "journal": "Biochemistry", "date": "1994", "authors": "Idriss H, Kumar A, Casas-Finet JR, Guo H, Damuni Z, Wilson SH", "evidence": [ { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" } ], "reference": [ { "type": "PubMed", "id": "7727389", "url": "https://glygen.org/publication/PubMed/7727389" } ] }, { "title": "A nuclear localization domain in the hnRNP A1 protein.", "journal": "The Journal of cell biology", "date": "1995", "authors": "Siomi H, Dreyfuss G", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "reference": [ { "type": "PubMed", "id": "7730395", "url": "https://glygen.org/publication/PubMed/7730395" } ] }, { "title": "Nucleo-cytoplasmic distribution of human hnRNP proteins: a search for the targeting domains in hnRNP A1.", "journal": "J. Cell Sci.", "date": "1995", "authors": "Weighardt F, Biamonti G, Riva S", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "reference": [ { "type": "PubMed", "id": "7769000", "url": "https://glygen.org/publication/PubMed/7769000" } ] }, { "title": "Enzymatic methylation of recombinant heterogeneous nuclear RNP protein A1. Dual substrate specificity for S-adenosylmethionine:histone-arginine N-methyltransferase.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Rajpurohit R, Lee SO, Park JO, Paik WK, Kim S", "evidence": [ { "database": "iPTMnet", "id": "P09651-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651-1" } ], "reference": [ { "type": "PubMed", "id": "8288564", "url": "https://glygen.org/publication/PubMed/8288564" } ] }, { "title": "hnRNP proteins and the biogenesis of mRNA.", "journal": "Annual review of biochemistry", "date": "1993", "authors": "Dreyfuss G, Matunis MJ, Pinol-Roma S, Burd CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-72203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72203" } ], "reference": [ { "type": "PubMed", "id": "8352591", "url": "https://glygen.org/publication/PubMed/8352591" } ] }, { "title": "Phosphorylation of human hnRNP protein A1 abrogates in vitro strand annealing activity.", "journal": "Nucleic acids research", "date": "1993", "authors": "Cobianchi F, Calvio C, Stoppini M, Buvoli M, Riva S", "evidence": [ { "database": "iPTMnet", "id": "P09651", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09651" } ], "reference": [ { "type": "PubMed", "id": "8451194", "url": "https://glygen.org/publication/PubMed/8451194" } ] }, { "title": "A nuclear export signal in hnRNP A1: a signal-mediated, temperature-dependent nuclear protein export pathway.", "journal": "Cell", "date": "1995", "authors": "Michael WM, Choi M, Dreyfuss G", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "reference": [ { "type": "PubMed", "id": "8521471", "url": "https://glygen.org/publication/PubMed/8521471" } ] }, { "title": "Evidence that sequence-independent binding of highly conserved U2 snRNP proteins upstream of the branch site is required for assembly of spliceosomal complex A.", "journal": "Genes & development", "date": "1996", "authors": "Gozani O, Feld R, Reed R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "8566756", "url": "https://glygen.org/publication/PubMed/8566756" } ] }, { "title": "A human RNA helicase-like protein, HRH1, facilitates nuclear export of spliced mRNA by releasing the RNA from the spliceosome.", "journal": "Genes & development", "date": "1996", "authors": "Ohno M, Shimura Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "8608946", "url": "https://glygen.org/publication/PubMed/8608946" } ] }, { "title": "Association of U2 snRNP with the spliceosomal complex E.", "journal": "Nucleic acids research", "date": "1997", "authors": "Hong W, Bennett M, Xiao Y, Feld Kramer R, Wang C, Reed R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "9016565", "url": "https://glygen.org/publication/PubMed/9016565" } ] }, { "title": "Crystal structure of human UP1, the domain of hnRNP A1 that contains two RNA-recognition motifs.", "journal": "Structure", "date": "1997", "authors": "Xu R M, Jokhan L, Cheng X, Mayeda A, Krainer A R", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "reference": [ { "type": "PubMed", "id": "9115444", "url": "https://glygen.org/publication/PubMed/9115444" } ] }, { "title": "Crystal structure of the two RNA binding domains of human hnRNP A1 at 1.75-A resolution.", "journal": "Nat. Struct. Biol.", "date": "1997", "authors": "Shamoo Y, Krueger U, Rice L M, Williams K R, Steitz T A", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "reference": [ { "type": "PubMed", "id": "9164463", "url": "https://glygen.org/publication/PubMed/9164463" } ] }, { "title": "U2AF65 recruits a novel human DEAD box protein required for the U2 snRNP-branchpoint interaction.", "journal": "Genes & development", "date": "1997", "authors": "Fleckner J, Zhang M, Valcarcel J, Green MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "9242493", "url": "https://glygen.org/publication/PubMed/9242493" } ] }, { "title": "Multiple interdependent sequence elements control splicing of a fibroblast growth factor receptor 2 alternative exon.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Del Gatto F, Plet A, Gesnel MC, Fort C, Breathnach R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "9271388", "url": "https://glygen.org/publication/PubMed/9271388" } ] }, { "title": "Purification and cDNA cloning of the AdoMet-binding subunit of the human mRNA (N6-adenosine)-methyltransferase.", "journal": "RNA (New York, N.Y.)", "date": "1997", "authors": "Bokar JA, Shambaugh ME, Polayes D, Matera AG, Rottman FM", "evidence": [ { "database": "Reactome", "id": "R-HSA-72203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72203" } ], "reference": [ { "type": "PubMed", "id": "9409616", "url": "https://glygen.org/publication/PubMed/9409616" } ] }, { "title": "A cooperative interaction between U2AF65 and mBBP/SF1 facilitates branchpoint region recognition.", "journal": "Genes & development", "date": "1998", "authors": "Berglund JA, Abovich N, Rosbash M", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "9512519", "url": "https://glygen.org/publication/PubMed/9512519" } ] }, { "title": "Human homologs of yeast prp16 and prp17 reveal conservation of the mechanism for catalytic step II of pre-mRNA splicing.", "journal": "The EMBO journal", "date": "1998", "authors": "Zhou Z, Reed R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "9524131", "url": "https://glygen.org/publication/PubMed/9524131" } ] }, { "title": "The human U5-200kD DEXH-box protein unwinds U4/U6 RNA duplices in vitro.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Laggerbauer B, Achsel T, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "9539711", "url": "https://glygen.org/publication/PubMed/9539711" } ] }, { "title": "A potential role for U2AF-SAP 155 interactions in recruiting U2 snRNP to the branch site.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Gozani O, Potashkin J, Reed R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "9671485", "url": "https://glygen.org/publication/PubMed/9671485" } ] }, { "title": "The mammalian homologue of Prp16p is overexpressed in a cell line tolerant to Leflunomide, a new immunoregulatory drug effective against rheumatoid arthritis.", "journal": "RNA (New York, N.Y.)", "date": "1998", "authors": "Ortlepp D, Laggerbauer B, Mullner S, Achsel T, Kirschbaum B, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "9701291", "url": "https://glygen.org/publication/PubMed/9701291" } ] }, { "title": "Mass spectrometry and EST-database searching allows characterization of the multi-protein spliceosome complex.", "journal": "Nature genetics", "date": "1998", "authors": "Neubauer G, King A, Rappsilber J, Calvio C, Watson M, Ajuh P, Sleeman J, Lamond A, Mann M", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "9731529", "url": "https://glygen.org/publication/PubMed/9731529" } ] }, { "title": "hnRNP A1 recruited to an exon in vivo can function as an exon splicing silencer.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Del Gatto-Konczak F, Olive M, Gesnel MC, Breathnach R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "9858549", "url": "https://glygen.org/publication/PubMed/9858549" } ] } ], "pathway": [ { "id": "hsa:3178", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3178", "resource": "KEGG Pathway" }, { "id": "R-HSA-6803529", "name": "FGFR2 alternative splicing", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529", "resource": "Reactome", "description": "FGFR2 alternative splicing" }, { "id": "R-HSA-72163", "name": "mRNA Splicing - Major Pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163", "resource": "Reactome", "description": "mRNA Splicing - Major Pathway" }, { "id": "R-HSA-72203", "name": "Processing of Capped Intron-Containing Pre-mRNA", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72203", "resource": "Reactome", "description": "Processing of Capped Intron-Containing Pre-mRNA" }, { "id": "R-HSA-9692914", "name": "SARS-CoV-1-host interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9692914", "resource": "Reactome", "description": "SARS-CoV-1-host interactions" }, { "id": "R-HSA-9735869", "name": "SARS-CoV-1 modulates host translation machinery", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9735869", "resource": "Reactome", "description": "SARS-CoV-1 modulates host translation machinery" } ], "orthologs": [ { "uniprot_canonical_ac": "P04256-1", "protein_name": "Heterogeneous nuclear ribonucleoprotein A1", "gene_name": "Hnrnpa1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALCKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF", "length": 320 }, "evidence": [ { "id": "45918361", "url": "http://www.informatics.jax.org/homology/45918361", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P49312-1", "protein_name": "Heterogeneous nuclear ribonucleoprotein A1", "gene_name": "Hnrnpa1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF", "length": 320 }, "evidence": [ { "id": "45918361", "url": "http://www.informatics.jax.org/homology/45918361", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q32P51-1", "protein_name": "Heterogeneous nuclear ribonucleoprotein A1-like 2", "gene_name": "HNRNPA1L2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNTTPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVKGHNCEVRKALPKQEMASASSSQRGRRGSGNFGGGRGDGFGGNDNFGRGGNFSGRGGFGGSCGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPQNQGGYGVSSSSSSYGSGRRF", "length": 320 }, "evidence": [ { "id": "45918361", "url": "http://www.informatics.jax.org/homology/45918361", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 12, "go_terms": [ { "name": "pre-mRNA binding", "id": "GO:0036002", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036002", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "G-rich strand telomeric DNA binding", "id": "GO:0098505", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098505", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "telomeric repeat-containing RNA binding", "id": "GO:0061752", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061752", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "protein domain specific binding", "id": "GO:0019904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019904", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "single-stranded RNA binding", "id": "GO:0003727", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003727", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "miRNA binding", "id": "GO:0035198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035198", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "mRNA 3'-UTR binding", "id": "GO:0003730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003730", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "single-stranded DNA binding", "id": "GO:0003697", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003697", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "molecular condensate scaffold activity", "id": "GO:0140693", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140693", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 10, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "spliceosomal complex", "id": "GO:0005681", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005681", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "catalytic step 2 spliceosome", "id": "GO:0071013", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071013", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "ribonucleoprotein complex", "id": "GO:1990904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990904", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "intracellular non-membrane-bounded organelle", "id": "GO:0043232", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043232", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 15, "go_terms": [ { "name": "amyloid fibril formation", "id": "GO:1990000", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990000", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "import into nucleus", "id": "GO:0051170", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051170", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "negative regulation of telomere maintenance via telomerase", "id": "GO:0032211", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032211", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "positive regulation of telomere maintenance via telomerase", "id": "GO:0032212", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032212", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "cellular response to glucose starvation", "id": "GO:0042149", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042149", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "nuclear export", "id": "GO:0051168", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051168", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "regulation of RNA splicing", "id": "GO:0043484", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043484", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "mRNA splicing, via spliceosome", "id": "GO:0000398", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000398", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "mRNA transport", "id": "GO:0051028", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051028", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "cellular response to sodium arsenite", "id": "GO:1903936", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903936", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "RNA export from nucleus", "id": "GO:0006405", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006405", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "regulation of alternative mRNA splicing, via spliceosome", "id": "GO:0000381", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000381", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "localization", "id": "GO:0051179", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051179", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "mRNA processing", "id": "GO:0006397", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006397", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" }, { "name": "RNA splicing", "id": "GO:0008380", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008380", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 221, "end_pos": 223, "annotation": "n_glycosylation_sequon" }, { "start_pos": 320, "end_pos": 322, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Sumoylated.", "evidence": [ { "database": "UniProtKB", "id": "P09651", "url": "https://www.uniprot.org/uniprot/P09651" }, { "database": "PubMed", "id": "15161980", "url": "https://glygen.org/publication/PubMed/15161980" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 22, 337, 338, 360, 361, 362, 363, 364, 365 ], "snv_sites": [ 2, 22, 52, 101, 188, 217, 278, 294, 307, 319, 337, 360, 361, 364, 365 ], "glycation_sites": [], "phosphorylation_sites": [ 2, 4, 6, 22, 91, 95, 138, 142, 167, 192, 199, 337, 338, 347, 357, 360, 361, 362, 363, 364, 365, 368 ], "sequon_annotation_sites": [ { "start_pos": 221, "end_pos": 223 }, { "start_pos": 320, "end_pos": 322 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 9 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 9 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 9 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 9 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 27 }, { "field": "total_sites", "count": 22 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 17 }, { "field": "total_sites", "count": 15 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 15 }, { "field": "total_sites", "count": 13 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 192 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }