{
"uniprot_canonical_ac": "P09601-1",
"uniprot_ac": "P09601",
"uniprot_id": "HMOX1_HUMAN",
"mass": {
"chemical_mass": 32819.0,
"monoisotopic_mass": 32819.0
},
"refseq": {
"ac": "NP_002124",
"name": "heme oxygenase 1",
"summary": "Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. [provided by RefSeq, Jul 2008].",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002124"
},
"gene_names": [
{
"name": "HMOX1",
"resource": "UniProtKB",
"type": "recommended",
"url": "https://www.uniprot.org/uniprot/P09601",
"id": "P09601"
},
{
"name": "HMOX1",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002124",
"id": "NP_002124"
},
{
"name": "HO1",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/P09601",
"id": "P09601"
},
{
"name": "HO",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/P09601",
"id": "P09601"
},
{
"name": "bK286B10; HMOX1D; HO-1; HSP32",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002124",
"id": "NP_002124"
}
],
"protein_names": [
{
"name": "Heme oxygenase 1",
"resource": "UniProtKB",
"type": "recommended",
"url": "",
"id": "P09601"
},
{
"name": "1.14.14.18",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P09601"
},
{
"name": "HO-1",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P09601"
},
{
"name": "heat shock protein, 32-kD; heme oxygenase (decycling) 1",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002124",
"id": "NP_002124"
},
{
"name": "heme oxygenase 1",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002124",
"id": "NP_002124"
}
],
"function": [
{
"annotation": "(Microbial infection) During SARS-COV-2 infection, promotes SARS-CoV-2 ORF3A-mediated autophagy but is unlikely to be required for ORF3A-mediated induction of reticulophagy.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601#function"
},
{
"database": "PubMed",
"id": "35239449",
"url": "https://glygen.org/publication/PubMed/35239449"
}
]
},
{
"annotation": "Associations between UGT1A1, SLCO1B1, SLCO1B3, BLVRA and HMOX1 polymorphisms and susceptibility to neonatal severe hyperbilirubinemia in Chinese Han population. Publication Status: Online-Only",
"evidence": [
{
"database": "RefSeq",
"id": "NP_002124",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002124"
},
{
"database": "PubMed",
"id": "38279097",
"url": "https://glygen.org/publication/PubMed/38279097"
}
]
},
{
"annotation": "Catalyzes the oxidative cleavage of heme at the alpha-methene bridge carbon, released as carbon monoxide (CO), to generate biliverdin IXalpha, while releasing the central heme iron chelate as ferrous iron.",
"evidence": [
{
"database": "UniProtKB",
"id": "A0A7I2V3I1",
"url": "https://www.uniprot.org/uniprot/A0A7I2V3I1#function"
},
{
"database": "UniProtKB",
"id": "ARBA00037361",
"url": "https://www.uniprot.org/uniprot/ARBA00037361#function"
},
{
"database": "UniProtKB",
"id": "B1AHA8",
"url": "https://www.uniprot.org/uniprot/B1AHA8#function"
},
{
"database": "UniProtKB",
"id": "A0A7I2V277",
"url": "https://www.uniprot.org/uniprot/A0A7I2V277#function"
},
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601#function"
},
{
"database": "PubMed",
"id": "7703255",
"url": "https://glygen.org/publication/PubMed/7703255"
},
{
"database": "PubMed",
"id": "11121422",
"url": "https://glygen.org/publication/PubMed/11121422"
},
{
"database": "PubMed",
"id": "20055707",
"url": "https://glygen.org/publication/PubMed/20055707"
},
{
"database": "PubMed",
"id": "19556236",
"url": "https://glygen.org/publication/PubMed/19556236"
},
{
"database": "UniProtKB",
"id": "A0A7I2V3M0",
"url": "https://www.uniprot.org/uniprot/A0A7I2V3M0#function"
}
]
},
{
"annotation": "Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. [provided by RefSeq, Jul 2008].",
"evidence": [
{
"database": "RefSeq",
"id": "NP_002124",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002124"
}
]
},
{
"annotation": "IL-38 alleviates atherogenic responses via SIRT6/HO-1 signaling: A promising strategy against obesity-related atherosclerosis.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_002124",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002124"
},
{
"database": "PubMed",
"id": "38154209",
"url": "https://glygen.org/publication/PubMed/38154209"
}
]
},
{
"annotation": "Inhibition of heme oxygenase 1 alleviates thoracic aortic aneurysm via restoration of extracellular matrix.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_002124",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002124"
},
{
"database": "PubMed",
"id": "38147696",
"url": "https://glygen.org/publication/PubMed/38147696"
}
]
},
{
"annotation": "Mechanisms by which silencing long-stranded noncoding RNA KCNQ1OT1 alleviates myocardial ischemia/reperfusion injury (MI/RI)-induced cardiac injury via miR-377-3p/HMOX1. Publication Status: Online-Only",
"evidence": [
{
"database": "RefSeq",
"id": "NP_002124",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002124"
},
{
"database": "PubMed",
"id": "38172743",
"url": "https://glygen.org/publication/PubMed/38172743"
}
]
},
{
"annotation": "SNP (A > G - rs13057211) but not GT(n) polymorphism in HMOX-1 promotor gene is associated with COVID-19 mortality. Publication Status: Online-Only",
"evidence": [
{
"database": "RefSeq",
"id": "NP_002124",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002124"
},
{
"database": "PubMed",
"id": "38129860",
"url": "https://glygen.org/publication/PubMed/38129860"
}
]
}
],
"disease": [
{
"disease_id": "MONDO:0013536",
"recommended_name": {
"id": "MONDO:0013536",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013536",
"name": "heme oxygenase 1 deficiency",
"description": ""
},
"synonyms": [
{
"id": "MONDO:0013536",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013536",
"name": "heme oxygenase 1 deficiency",
"description": ""
},
{
"id": "MONDO:0013536",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013536",
"name": "heme oxygenase-1 deficiency",
"description": ""
},
{
"id": "MONDO:0013536",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013536",
"name": "HMOX1D",
"description": ""
},
{
"id": "MIM:614034",
"resource": "MIM",
"url": "https://www.omim.org/entry/614034",
"name": "Heme oxygenase 1 deficiency",
"description": "Heme oxygenase 1 deficiency"
}
],
"evidence": [
{
"id": "614034",
"database": "MIM",
"url": "https://www.omim.org/entry/614034"
}
]
}
],
"snv": [],
"mutagenesis": [
{
"start_pos": 140,
"end_pos": 140,
"sequence_org": "D",
"sequence_mut": "A",
"comment": "Inactive as a heme oxygenase but active as a peroxidase.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
},
{
"database": "PubMed",
"id": "11121422",
"url": "https://glygen.org/publication/PubMed/11121422"
},
{
"database": "PubMed",
"id": "12842469",
"url": "https://glygen.org/publication/PubMed/12842469"
}
]
},
{
"start_pos": 140,
"end_pos": 140,
"sequence_org": "D",
"sequence_mut": "F",
"comment": "Inactive as a heme oxygenase but active as a peroxidase.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
},
{
"database": "PubMed",
"id": "11121422",
"url": "https://glygen.org/publication/PubMed/11121422"
},
{
"database": "PubMed",
"id": "12842469",
"url": "https://glygen.org/publication/PubMed/12842469"
}
]
},
{
"start_pos": 140,
"end_pos": 140,
"sequence_org": "D",
"sequence_mut": "H",
"comment": "Inactive as a heme oxygenase but active as a peroxidase.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
},
{
"database": "PubMed",
"id": "11121422",
"url": "https://glygen.org/publication/PubMed/11121422"
},
{
"database": "PubMed",
"id": "12842469",
"url": "https://glygen.org/publication/PubMed/12842469"
}
]
},
{
"start_pos": 140,
"end_pos": 140,
"sequence_org": "D",
"sequence_mut": "L",
"comment": "Inactive as a heme oxygenase but active as a peroxidase.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
},
{
"database": "PubMed",
"id": "11121422",
"url": "https://glygen.org/publication/PubMed/11121422"
},
{
"database": "PubMed",
"id": "12842469",
"url": "https://glygen.org/publication/PubMed/12842469"
}
]
},
{
"start_pos": 140,
"end_pos": 140,
"sequence_org": "D",
"sequence_mut": "N",
"comment": "Inactive as a heme oxygenase but active as a peroxidase.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
},
{
"database": "PubMed",
"id": "11121422",
"url": "https://glygen.org/publication/PubMed/11121422"
},
{
"database": "PubMed",
"id": "12842469",
"url": "https://glygen.org/publication/PubMed/12842469"
}
]
},
{
"start_pos": 270,
"end_pos": 270,
"sequence_org": "W",
"sequence_mut": "A",
"comment": "No effect on catalytic activity, oligomerization and localization to the endoplasmic reticulum.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
},
{
"database": "PubMed",
"id": "19556236",
"url": "https://glygen.org/publication/PubMed/19556236"
}
]
},
{
"start_pos": 270,
"end_pos": 270,
"sequence_org": "W",
"sequence_mut": "N",
"comment": "Significant reduction in catalytic activity, reduced oligomerization, reduced endoplasmic reticulum localization with cytoplasmic mislocalization.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
},
{
"database": "PubMed",
"id": "19556236",
"url": "https://glygen.org/publication/PubMed/19556236"
}
]
}
],
"expression_tissue": [
{
"tissue": {
"name": "Adult mammalian kidney",
"namespace": "UBERON",
"id": "0000082",
"url": "http://purl.obolibrary.org/obo/UBERON_0000082"
},
"score": "88.38",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000100292",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000100292"
}
]
},
{
"tissue": {
"name": "Oral cavity",
"namespace": "UBERON",
"id": "0000167",
"url": "http://purl.obolibrary.org/obo/UBERON_0000167"
},
"score": "79.08",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000100292",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000100292"
}
]
},
{
"tissue": {
"name": "Stomach",
"namespace": "UBERON",
"id": "0000945",
"url": "http://purl.obolibrary.org/obo/UBERON_0000945"
},
"score": "68.64",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000100292",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000100292"
}
]
},
{
"tissue": {
"name": "Uterus",
"namespace": "UBERON",
"id": "0000995",
"url": "http://purl.obolibrary.org/obo/UBERON_0000995"
},
"score": "63.88",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000100292",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000100292"
}
]
},
{
"tissue": {
"name": "Esophagus",
"namespace": "UBERON",
"id": "0001043",
"url": "http://purl.obolibrary.org/obo/UBERON_0001043"
},
"score": "91.02",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000100292",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000100292"
}
]
},
{
"tissue": {
"name": "Rectum",
"namespace": "UBERON",
"id": "0001052",
"url": "http://purl.obolibrary.org/obo/UBERON_0001052"
},
"score": "88.44",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000100292",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000100292"
}
]
},
{
"tissue": {
"name": "Colon",
"namespace": "UBERON",
"id": "0001155",
"url": "http://purl.obolibrary.org/obo/UBERON_0001155"
},
"score": "53.64",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000100292",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000100292"
}
]
},
{
"tissue": {
"name": "Urinary bladder",
"namespace": "UBERON",
"id": "0001255",
"url": "http://purl.obolibrary.org/obo/UBERON_0001255"
},
"score": "74.86",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000100292",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000100292"
}
]
},
{
"tissue": {
"name": "Thyroid gland",
"namespace": "UBERON",
"id": "0002046",
"url": "http://purl.obolibrary.org/obo/UBERON_0002046"
},
"score": "76.45",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000100292",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000100292"
}
]
},
{
"tissue": {
"name": "Lung",
"namespace": "UBERON",
"id": "0002048",
"url": "http://purl.obolibrary.org/obo/UBERON_0002048"
},
"score": "74.8",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000100292",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000100292"
}
]
},
{
"tissue": {
"name": "Liver",
"namespace": "UBERON",
"id": "0002107",
"url": "http://purl.obolibrary.org/obo/UBERON_0002107"
},
"score": "90.33",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000100292",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000100292"
}
]
},
{
"tissue": {
"name": "Prostate gland",
"namespace": "UBERON",
"id": "0002367",
"url": "http://purl.obolibrary.org/obo/UBERON_0002367"
},
"score": "72.94",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000100292",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000100292"
}
]
},
{
"tissue": {
"name": "Thoracic mammary gland",
"namespace": "UBERON",
"id": "0005200",
"url": "http://purl.obolibrary.org/obo/UBERON_0005200"
},
"score": "81.96",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000100292",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000100292"
}
]
}
],
"expression_disease": [
{
"significant": "No",
"trend": "up",
"name": "Prostate cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10283",
"evidence": [
{
"database": "BioXpress",
"id": "P09601",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09601"
}
],
"disease": [
{
"disease_id": "DOID:10283",
"recommended_name": {
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer",
"description": "A male reproductive organ cancer that is located_in the prostate."
},
"synonyms": [
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "NGP - new growth of prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "malignant tumor of the prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "tumor of the prostate",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, type 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "HPC9",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "EHBP1 familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "familial prostate cancer caused by mutation in EHBP1",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, type 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "HPC12",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, type 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "HPC5",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, type 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, susceptibility to, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "HPC3",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, type 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, susceptibility to, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "HPC4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, on chromosome 7",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "MSMB familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "familial prostate cancer caused by mutation in MSMB",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, type 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "HPC13",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, type 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "HPC8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "predisposing for prostate cancer",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, type 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "HPC6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "HPC10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate carcinoma",
"description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate carcinoma",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, somatic",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, hereditary",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "HPC7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer aggressiveness",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "RNASEL familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "familial prostate cancer caused by mutation in RNASEL",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, type 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "HPC1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "Prca1",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "HPC11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "HPC14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "HPC15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "HPCX1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer susceptibility, X-linked",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "HPCX2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MIM:611868",
"resource": "MIM",
"url": "https://www.omim.org/entry/611868",
"name": "Prostate cancer, hereditary, 12",
"description": "Prostate cancer, hereditary, 12"
},
{
"id": "MIM:611928",
"resource": "MIM",
"url": "https://www.omim.org/entry/611928",
"name": "Prostate cancer, hereditary, 13",
"description": "Prostate cancer, hereditary, 13"
},
{
"id": "MIM:176807",
"resource": "MIM",
"url": "https://www.omim.org/entry/176807",
"name": "Prostate cancer",
"description": "Prostate cancer"
},
{
"id": "MIM:601518",
"resource": "MIM",
"url": "https://www.omim.org/entry/601518",
"name": "Prostate cancer, hereditary, 1",
"description": "Prostate cancer, hereditary, 1"
},
{
"id": "MIM:611955",
"resource": "MIM",
"url": "https://www.omim.org/entry/611955",
"name": "Prostate cancer, hereditary, 11",
"description": "Prostate cancer, hereditary, 11"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Stomach cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10534",
"evidence": [
{
"database": "BioXpress",
"id": "P09601",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09601"
}
],
"disease": [
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Urinary bladder cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11054",
"evidence": [
{
"database": "BioXpress",
"id": "P09601",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09601"
}
],
"disease": [
{
"disease_id": "DOID:11054",
"recommended_name": {
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "urinary bladder cancer",
"description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
},
"synonyms": [
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "bladder cancer",
"description": ""
},
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": "A primary or metastatic malignant neoplasm involving the bladder."
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "bladder cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "cancer of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumour",
"description": ""
},
{
"id": "MIM:109800",
"resource": "MIM",
"url": "https://www.omim.org/entry/109800",
"name": "Bladder cancer",
"description": "Bladder cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "down",
"name": "Head and neck cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11934",
"evidence": [
{
"database": "BioXpress",
"id": "P09601",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09601"
}
],
"disease": [
{
"disease_id": "DOID:11934",
"recommended_name": {
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck cancer",
"description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx."
},
"synonyms": [
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck tumours",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head/neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "tumor of head and neck",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Lung cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1324",
"evidence": [
{
"database": "BioXpress",
"id": "P09601",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09601"
}
],
"disease": [
{
"disease_id": "DOID:1324",
"recommended_name": {
"id": "DOID:1324",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1324",
"name": "lung cancer",
"description": "A respiratory system cancer that is located_in the lung."
},
"synonyms": [
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "LNCR1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "LNCR3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "adenocarcinoma of lung, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "LNCR4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "LNCR5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": "A malignant neoplasm involving the lung."
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "cancer of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung neoplasm",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumor",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumour",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "Nonsmall cell lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "alveolar cell carcinoma",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung neoplasm",
"description": ""
},
{
"id": "MIM:211980",
"resource": "MIM",
"url": "https://www.omim.org/entry/211980",
"name": "Lung cancer",
"description": "Lung cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Breast cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1612",
"evidence": [
{
"database": "BioXpress",
"id": "P09601",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09601"
}
],
"disease": [
{
"disease_id": "DOID:1612",
"recommended_name": {
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast cancer",
"description": "A thoracic cancer that originates in the mammary gland."
},
"synonyms": [
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant neoplasm of breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant tumor of the breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary cancer",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "primary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, lobular, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of the breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial Male",
"description": ""
},
{
"id": "MIM:114480",
"resource": "MIM",
"url": "https://www.omim.org/entry/114480",
"name": "Breast cancer",
"description": "Breast cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Thyroid cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1781",
"evidence": [
{
"database": "BioXpress",
"id": "P09601",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09601"
}
],
"disease": [
{
"disease_id": "DOID:1781",
"recommended_name": {
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid cancer",
"description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage."
},
"synonyms": [
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid gland cancer",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "Thyroid gland neoplasm",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant tumour of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Kidney cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:263",
"evidence": [
{
"database": "BioXpress",
"id": "P09601",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09601"
}
],
"disease": [
{
"disease_id": "DOID:263",
"recommended_name": {
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "kidney cancer",
"description": "A urinary system cancer that is located_in the kidney."
},
"synonyms": [
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant neoplasm of kidney except pelvis",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant tumour of kidney",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "renal cancer",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Liver cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:3571",
"evidence": [
{
"database": "BioXpress",
"id": "P09601",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09601"
}
],
"disease": [
{
"disease_id": "DOID:3571",
"recommended_name": {
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "liver cancer",
"description": "A hepatobiliary system cancer that is located_in the liver."
},
"synonyms": [
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Ca liver - primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Resectable malignant neoplasm of Liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant hepato-biliary neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant tumor of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "non-resectable primary hepatic malignant neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary liver cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "resectable malignant neoplasm of the liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, not specified as primary or secondary",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Uterine cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:363",
"evidence": [
{
"database": "BioXpress",
"id": "P09601",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09601"
}
],
"disease": [
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Esophageal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:5041",
"evidence": [
{
"database": "BioXpress",
"id": "P09601",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09601"
}
],
"disease": [
{
"disease_id": "DOID:5041",
"recommended_name": {
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophageal cancer",
"description": "A gastrointestinal system cancer that is located_in the esophagus."
},
"synonyms": [
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophagus cancer",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Distal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Proximal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of the middle Third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": "A primary or metastatic malignant neoplasm involving the esophagus."
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "oesophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the middle third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of abdominal oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the middle third of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Aerodigestive tract cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Escc, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "gastric cardia adenocarcinoma, susceptibility to",
"description": ""
},
{
"id": "MIM:133239",
"resource": "MIM",
"url": "https://www.omim.org/entry/133239",
"name": "Esophageal cancer",
"description": "Esophageal cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Colorectal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:9256",
"evidence": [
{
"database": "BioXpress",
"id": "P09601",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09601"
}
],
"disease": [
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
}
]
}
],
"species": [
{
"name": "Homo sapiens",
"taxid": 9606,
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"common_name": "Human"
}
],
"gene": [
{
"name": "HMOX1",
"url": "https://www.uniprot.org/uniprot/P09601",
"locus": {
"chromosome": "22",
"start_pos": 35394214,
"end_pos": 35380361,
"strand": "-",
"evidence": [
{
"database": "Ensembl Gene",
"id": "ENSG00000100292",
"url": "https://www.ensembl.org/id/ENSG00000100292"
}
]
}
}
],
"crossref": [
{
"id": "ENSG00000100292",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000100292",
"database": "Bgee",
"categories": [
"Gene Expression"
]
},
{
"id": "1.14.14.18",
"url": "https://www.brenda-enzymes.org/enzyme.php?ecno=1.14.14.18&UniProtAcc=P09601",
"database": "BRENDA",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "cd00232",
"url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00232",
"database": "CDD",
"categories": [
"Protein Classification"
]
},
{
"id": "CHEMBL2823",
"url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2823",
"database": "ChEMBL",
"categories": [
"Other"
]
},
{
"id": "HMOX1",
"url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=HMOX1",
"database": "GeneCards",
"categories": [
"Gene Annotation",
"Organism-specific"
]
},
{
"id": "3162",
"url": "https://www.ncbi.nlm.nih.gov/gene/3162",
"database": "GeneID",
"categories": [
"Genome Annotation"
]
},
{
"id": "5013",
"url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=5013",
"database": "HGNC",
"categories": [
"Organism-specific"
]
},
{
"id": "P09601",
"url": "https://www.ebi.ac.uk/intact/interactors/id:P09601*",
"database": "IntAct",
"categories": [
"Other"
]
},
{
"id": "IPR002051",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR002051",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR016053",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR016053",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR016084",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR016084",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR018207",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR018207",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "hsa:3162",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3162",
"database": "KEGG Pathway",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "141250",
"url": "http://www.omim.org/entry/141250",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "614034",
"url": "http://www.omim.org/entry/614034",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "NX_P09601",
"url": "https://www.nextprot.org/entry/NX_P09601",
"database": "neXtProt",
"categories": [
"Protein",
"Organism-specific"
]
},
{
"id": "P09601",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09601",
"database": "O-GlcNAc Database",
"categories": [
"Glycoproteomics"
]
},
{
"id": "KKSHTMA",
"url": "https://omabrowser.org/oma/group/KKSHTMA/",
"database": "OMA",
"categories": [
"Protein Classification"
]
},
{
"id": "1366343at2759",
"url": "http://www.orthodb.org/?query=1366343at2759",
"database": "OrthoDB",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR10720",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10720",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR10720:SF1",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10720:SF1",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "1N3U",
"url": "https://www.rcsb.org/structure/1N3U",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1N45",
"url": "https://www.rcsb.org/structure/1N45",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1NI6",
"url": "https://www.rcsb.org/structure/1NI6",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1OYK",
"url": "https://www.rcsb.org/structure/1OYK",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1OYL",
"url": "https://www.rcsb.org/structure/1OYL",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1OZE",
"url": "https://www.rcsb.org/structure/1OZE",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1OZL",
"url": "https://www.rcsb.org/structure/1OZL",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1OZR",
"url": "https://www.rcsb.org/structure/1OZR",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1OZW",
"url": "https://www.rcsb.org/structure/1OZW",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1S13",
"url": "https://www.rcsb.org/structure/1S13",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1S8C",
"url": "https://www.rcsb.org/structure/1S8C",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1T5P",
"url": "https://www.rcsb.org/structure/1T5P",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1TWN",
"url": "https://www.rcsb.org/structure/1TWN",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1TWR",
"url": "https://www.rcsb.org/structure/1TWR",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1XJZ",
"url": "https://www.rcsb.org/structure/1XJZ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1XK0",
"url": "https://www.rcsb.org/structure/1XK0",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1XK1",
"url": "https://www.rcsb.org/structure/1XK1",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1XK2",
"url": "https://www.rcsb.org/structure/1XK2",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1XK3",
"url": "https://www.rcsb.org/structure/1XK3",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3CZY",
"url": "https://www.rcsb.org/structure/3CZY",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3HOK",
"url": "https://www.rcsb.org/structure/3HOK",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3K4F",
"url": "https://www.rcsb.org/structure/3K4F",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3TGM",
"url": "https://www.rcsb.org/structure/3TGM",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4WD4",
"url": "https://www.rcsb.org/structure/4WD4",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5BTQ",
"url": "https://www.rcsb.org/structure/5BTQ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6EHA",
"url": "https://www.rcsb.org/structure/6EHA",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "PF01126",
"url": "http://pfam.xfam.org/family/PF01126",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "P09601",
"url": "https://pharos.nih.gov/targets/P09601",
"database": "PHAROS",
"categories": [
"Organism-specific"
]
},
{
"id": "PR_P09601",
"url": "http://purl.obolibrary.org/obo/PR_P09601",
"database": "PRO",
"categories": [
"Protein"
]
},
{
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-844456",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9609523",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9660826",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9660826",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9707587",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707587",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9707616",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "NP_002124",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002124",
"database": "RefSeq",
"categories": [
"Protein"
]
},
{
"id": "21764",
"url": "https://www.rhea-db.org/rhea/21764",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "A0A7I2V277",
"url": "https://www.uniprot.org/uniprot/A0A7I2V277",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A7I2V277-1",
"url": "https://www.uniprot.org/uniprot/A0A7I2V277-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A7I2V3I1",
"url": "https://www.uniprot.org/uniprot/A0A7I2V3I1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A7I2V3I1-1",
"url": "https://www.uniprot.org/uniprot/A0A7I2V3I1-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A7I2V3M0",
"url": "https://www.uniprot.org/uniprot/A0A7I2V3M0",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A7I2V3M0-1",
"url": "https://www.uniprot.org/uniprot/A0A7I2V3M0-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A7I2YQL9",
"url": "https://www.uniprot.org/uniprot/A0A7I2YQL9",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A7I2YQL9-1",
"url": "https://www.uniprot.org/uniprot/A0A7I2YQL9-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "B1AHA8",
"url": "https://www.uniprot.org/uniprot/B1AHA8",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "B1AHA8-1",
"url": "https://www.uniprot.org/uniprot/B1AHA8-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P09601-1",
"url": "https://www.uniprot.org/uniprot/P09601-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
}
],
"sequence": {
"sequence": "MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM",
"length": 288,
"header": "sp|P09601-1|HMOX1_HUMAN Isoform 1 of Heme oxygenase 1 OS=Homo sapiens OX=9606 GN=HMOX1 PE=1 SV=1 CANONICAL=P09601-1"
},
"isoforms": [
{
"isoform_ac": "A0A7I2V277-1",
"url": "",
"sequence": {
"sequence": "MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM",
"length": 124,
"header": "tr|A0A7I2V277-1|HMOX1_HUMAN Computationally mapped isoform of Heme oxygenase 1 OS=Homo sapiens OX=9606 GN=HMOX1 PE=1 SV=1 CANONICAL=P09601-1"
},
"locus": {
"chromosome": "22",
"start_pos": 35393595,
"end_pos": 35381174,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000677931.1",
"url": "https://www.ensembl.org/id/ENST00000677931.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000502849.1",
"url": "https://www.ensembl.org/id/ENSP00000502849.1"
}
]
}
},
{
"isoform_ac": "A0A7I2V3I1-1",
"url": "",
"sequence": {
"sequence": "MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQILPPWRLPEGSPHSTPAPRLRFSDGSLHSAFWWRQLL",
"length": 249,
"header": "tr|A0A7I2V3I1-1|HMOX1_HUMAN Computationally mapped isoform of Heme oxygenase 1 OS=Homo sapiens OX=9606 GN=HMOX1 PE=1 SV=1 CANONICAL=P09601-1"
},
"locus": {
"chromosome": "22",
"start_pos": 35393578,
"end_pos": 35381174,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000679074.1",
"url": "https://www.ensembl.org/id/ENST00000679074.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000503459.1",
"url": "https://www.ensembl.org/id/ENSP00000503459.1"
}
]
}
},
{
"isoform_ac": "A0A7I2V3M0-1",
"url": "",
"sequence": {
"sequence": "AENAEFMRNFQKGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM",
"length": 157,
"header": "tr|A0A7I2V3M0-1|HMOX1_HUMAN Computationally mapped isoform of Heme oxygenase 1 OS=Homo sapiens OX=9606 GN=HMOX1 PE=1 SV=1 CANONICAL=P09601-1"
},
"locus": {
"chromosome": "22",
"start_pos": 35393595,
"end_pos": 35383164,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000678411.1",
"url": "https://www.ensembl.org/id/ENST00000678411.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000503526.1",
"url": "https://www.ensembl.org/id/ENSP00000503526.1"
}
]
}
},
{
"isoform_ac": "A0A7I2YQL9-1",
"url": "",
"sequence": {
"sequence": "MERPQPDRQARGAGRGTGAFLSQPCLRPSPTPGHCHTATEPRSQKLGLWSQEHAPGFVRGPEGGHQGGAHPGREC",
"length": 75,
"header": "tr|A0A7I2YQL9-1|HMOX1_HUMAN Computationally mapped isoform of Heme oxygenase 1 OS=Homo sapiens OX=9606 GN=HMOX1 PE=1 SV=1 CANONICAL=P09601-1"
},
"locus": {
"chromosome": "22",
"start_pos": 35383174,
"end_pos": 35381174,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000481190.2",
"url": "https://www.ensembl.org/id/ENST00000481190.2"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000503987.1",
"url": "https://www.ensembl.org/id/ENSP00000503987.1"
}
]
}
},
{
"isoform_ac": "B1AHA8-1",
"url": "",
"sequence": {
"sequence": "MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMN",
"length": 187,
"header": "tr|B1AHA8-1|HMOX1_HUMAN Computationally mapped isoform of Heme oxygenase 1 OS=Homo sapiens OX=9606 GN=HMOX1 PE=1 SV=1 CANONICAL=P09601-1"
},
"locus": {
"chromosome": "22",
"start_pos": 35387101,
"end_pos": 35381174,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000412893.5",
"url": "https://www.ensembl.org/id/ENST00000412893.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000413316.1",
"url": "https://www.ensembl.org/id/ENSP00000413316.1"
}
]
}
},
{
"isoform_ac": "P09601-1",
"url": "",
"sequence": {
"sequence": "MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM",
"length": 288,
"header": "sp|P09601-1|HMOX1_HUMAN Isoform 1 of Heme oxygenase 1 OS=Homo sapiens OX=9606 GN=HMOX1 PE=1 SV=1 CANONICAL=P09601-1"
},
"locus": {
"chromosome": "22",
"start_pos": 35393595,
"end_pos": 35381174,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000216117.9",
"url": "https://www.ensembl.org/id/ENST00000216117.9"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000216117.8",
"url": "https://www.ensembl.org/id/ENSP00000216117.8"
}
]
}
}
],
"glycosylation": [
{
"glytoucan_ac": "G49108TO",
"type": "O-linked",
"subtype": "O-GlcNAcylation",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "O-GlcNAcylation",
"evidence": [
{
"id": "P09601",
"database": "O-GlcNAc Database",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09601"
},
{
"id": "30379171",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30379171"
},
{
"id": "28510447",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/28510447"
}
]
}
],
"phosphorylation": [
{
"start_pos": 137,
"end_pos": 137,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Tyr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P09601",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09601"
},
{
"database": "PubMed",
"id": "20068231",
"url": "https://glygen.org/publication/PubMed/20068231"
}
],
"site_lbl": "Tyr137"
},
{
"start_pos": 188,
"end_pos": 188,
"kinase_uniprot_canonical_ac": "P31749-1",
"kinase_gene_name": "AKT1",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P09601",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09601"
},
{
"database": "PubMed",
"id": "15581622",
"url": "https://glygen.org/publication/PubMed/15581622"
}
],
"site_lbl": "Ser188"
},
{
"start_pos": 188,
"end_pos": 188,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P09601",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09601"
},
{
"database": "PubMed",
"id": "15581622",
"url": "https://glygen.org/publication/PubMed/15581622"
}
],
"site_lbl": "Ser188"
},
{
"start_pos": 229,
"end_pos": 229,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
},
{
"database": "PubMed",
"id": "20068231",
"url": "https://glygen.org/publication/PubMed/20068231"
},
{
"database": "iPTMnet",
"id": "P09601",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09601"
},
{
"database": "PubMed",
"id": "17081983",
"url": "https://glygen.org/publication/PubMed/17081983"
},
{
"database": "PubMed",
"id": "18578522",
"url": "https://glygen.org/publication/PubMed/18578522"
},
{
"database": "PubMed",
"id": "18767875",
"url": "https://glygen.org/publication/PubMed/18767875"
},
{
"database": "PubMed",
"id": "19651622",
"url": "https://glygen.org/publication/PubMed/19651622"
},
{
"database": "phospho.ELM",
"id": "P09601",
"url": "http://phospho.elm.eu.org/byAccession/P09601.html"
}
],
"site_lbl": "Ser229"
},
{
"start_pos": 231,
"end_pos": 231,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P09601",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09601"
},
{
"database": "PubMed",
"id": "17081983",
"url": "https://glygen.org/publication/PubMed/17081983"
},
{
"database": "PubMed",
"id": "18578522",
"url": "https://glygen.org/publication/PubMed/18578522"
},
{
"database": "PubMed",
"id": "18767875",
"url": "https://glygen.org/publication/PubMed/18767875"
},
{
"database": "PubMed",
"id": "19651622",
"url": "https://glygen.org/publication/PubMed/19651622"
},
{
"database": "PubMed",
"id": "20068231",
"url": "https://glygen.org/publication/PubMed/20068231"
},
{
"database": "phospho.ELM",
"id": "P09601",
"url": "http://phospho.elm.eu.org/byAccession/P09601.html"
}
],
"site_lbl": "Ser231"
}
],
"glycation": [],
"keywords": [
"enzyme",
"glycoprotein",
"glycoprotein_reported_with_glycan"
],
"publication": [
{
"title": "Constitutive activation of Stat3 signaling confers resistance to apoptosis in human U266 myeloma cells.",
"journal": "Immunity",
"date": "1999",
"authors": "Catlett-Falcone R, Landowski TH, Oshiro MM, Turkson J, Levitzki A, Savino R, Ciliberto G, Moscinski L, Fernandez-Luna JL, Nunez G, Dalton WS, Jove R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "10023775",
"url": "https://glygen.org/publication/PubMed/10023775"
}
]
},
{
"title": "Crystal structure of the interleukin-4/receptor alpha chain complex reveals a mosaic binding interface.",
"journal": "Cell",
"date": "1999",
"authors": "Hage T, Sebald W, Reinemer P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "10219247",
"url": "https://glygen.org/publication/PubMed/10219247"
}
]
},
{
"title": "Regulation of the germline immunoglobulin Cgamma1 promoter by CD40 ligand and IL-4: dual role for tandem NF-kappaB binding sites.",
"journal": "Molecular immunology",
"date": "1999",
"authors": "Warren WD, Roberts KL, Linehan LA, Berton MT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "10369418",
"url": "https://glygen.org/publication/PubMed/10369418"
}
]
},
{
"title": "Kinetics of hemin distribution in plasma reveals its role in lipoprotein oxidation.",
"journal": "Biochimica et biophysica acta",
"date": "1999",
"authors": "Miller YI, Shaklai N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707616",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616"
}
],
"reference": [
{
"type": "PubMed",
"id": "10381560",
"url": "https://glygen.org/publication/PubMed/10381560"
}
]
},
{
"title": "Transport of monoglucuronosyl and bisglucuronosyl bilirubin by recombinant human and rat multidrug resistance protein 2.",
"journal": "Hepatology (Baltimore, Md.)",
"date": "1999",
"authors": "Kamisako T, Leier I, Cui Y, Konig J, Buchholz U, Hummel-Eisenbeiss J, Keppler D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "10421658",
"url": "https://glygen.org/publication/PubMed/10421658"
}
]
},
{
"title": "Crystal structure of human heme oxygenase-1.",
"journal": "Nat. Struct. Biol.",
"date": "1999",
"authors": "Schuller D J, Wilks A, Ortiz de Montellano P R, Poulos T L",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"reference": [
{
"type": "PubMed",
"id": "10467099",
"url": "https://glygen.org/publication/PubMed/10467099"
}
]
},
{
"title": "Functional synergism of STAT6 with either NF-kappa B or PU.1 to mediate IL-4-induced activation of IgE germline gene transcription.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "1999",
"authors": "Stutz AM, Woisetschlager M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "10510379",
"url": "https://glygen.org/publication/PubMed/10510379"
}
]
},
{
"title": "Activation of eotaxin gene transcription by NF-kappa B and STAT6 in human airway epithelial cells.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "1999",
"authors": "Matsukura S, Stellato C, Plitt JR, Bickel C, Miura K, Georas SN, Casolaro V, Schleimer RP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "10586089",
"url": "https://glygen.org/publication/PubMed/10586089"
}
]
},
{
"title": "Covalent modification of all members of human cullin family proteins by NEDD8.",
"journal": "Oncogene",
"date": "1999",
"authors": "Hori T, Osaka F, Chiba T, Miyamoto C, Okabayashi K, Shimbara N, Kato S, Tanaka K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "10597293",
"url": "https://glygen.org/publication/PubMed/10597293"
}
]
},
{
"title": "Initial-rate kinetics of the flavin reductase reaction catalysed by human biliverdin-IXbeta reductase (BVR-B).",
"journal": "The Biochemical journal",
"date": "2000",
"authors": "Cunningham O, Gore MG, Mantle TJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "10620517",
"url": "https://glygen.org/publication/PubMed/10620517"
}
]
},
{
"title": "A novel human organic anion transporting polypeptide localized to the basolateral hepatocyte membrane.",
"journal": "American journal of physiology. Gastrointestinal and liver physiology",
"date": "2000",
"authors": "Konig J, Cui Y, Nies AT, Keppler D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "10644574",
"url": "https://glygen.org/publication/PubMed/10644574"
}
]
},
{
"title": "Structures of recombinant human and mouse NAD(P)H:quinone oxidoreductases: species comparison and structural changes with substrate binding and release.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2000",
"authors": "Faig M, Bianchet MA, Talalay P, Chen S, Winski S, Ross D, Amzel LM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "10706635",
"url": "https://glygen.org/publication/PubMed/10706635"
}
]
},
{
"title": "Inhibition of the 26S proteasome induces expression of GLCLC, the catalytic subunit for gamma-glutamylcysteine synthetase.",
"journal": "Biochemical and biophysical research communications",
"date": "2000",
"authors": "Sekhar KR, Soltaninassab SR, Borrelli MJ, Xu ZQ, Meredith MJ, Domann FE, Freeman ML",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "10733945",
"url": "https://glygen.org/publication/PubMed/10733945"
}
]
},
{
"title": "Transcription factor Nrf2 coordinately regulates a group of oxidative stress-inducible genes in macrophages.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Ishii T, Itoh K, Takahashi S, Sato H, Yanagawa T, Katoh Y, Bannai S, Yamamoto M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "10821856",
"url": "https://glygen.org/publication/PubMed/10821856"
}
]
},
{
"title": "Signal transducer and activator of transcription 3 activates CCAAT enhancer-binding protein delta gene transcription in G0 growth-arrested mouse mammary epithelial cells and in involuting mouse mammary gland.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Hutt JA, O'Rourke JP, DeWille J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "10867011",
"url": "https://glygen.org/publication/PubMed/10867011"
}
]
},
{
"title": "Recent advances in bilirubin metabolism research: the molecular mechanism of hepatocyte bilirubin transport and its clinical relevance.",
"journal": "Journal of gastroenterology",
"date": "2000",
"authors": "Kamisako T, Kobayashi Y, Takeuchi K, Ishihara T, Higuchi K, Tanaka Y, Gabazza EC, Adachi Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "11023036",
"url": "https://glygen.org/publication/PubMed/11023036"
}
]
},
{
"title": "Characterization of IL-4 and IL-13 signals dependent on the human IL-13 receptor alpha chain 1: redundancy of requirement of tyrosine residue for STAT3 activation.",
"journal": "International immunology",
"date": "2000",
"authors": "Umeshita-Suyama R, Sugimoto R, Akaiwa M, Arima K, Yu B, Wada M, Kuwano M, Nakajima K, Hamasaki N, Izuhara K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11058569",
"url": "https://glygen.org/publication/PubMed/11058569"
}
]
},
{
"title": "A stat-responsive element in the promoter of the episialin/MUC1 gene is involved in its overexpression in carcinoma cells.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Gaemers IC, Vos HL, Volders HH, van der Valk SW, Hilkens J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11084045",
"url": "https://glygen.org/publication/PubMed/11084045"
}
]
},
{
"title": "Direct regulation of pituitary proopiomelanocortin by STAT3 provides a novel mechanism for immuno-neuroendocrine interfacing.",
"journal": "The Journal of clinical investigation",
"date": "2000",
"authors": "Bousquet C, Zatelli MC, Melmed S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11104795",
"url": "https://glygen.org/publication/PubMed/11104795"
}
]
},
{
"title": "Suppression of signal transducer and activator of transcription 3-dependent B lymphocyte terminal differentiation by BCL-6.",
"journal": "The Journal of experimental medicine",
"date": "2000",
"authors": "Reljic R, Wagner SD, Peakman LJ, Fearon DT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11120780",
"url": "https://glygen.org/publication/PubMed/11120780"
}
]
},
{
"title": "Disruption of an active site hydrogen bond converts human heme oxygenase-1 into a peroxidase.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Lightning LK, Huang H, Moenne-Loccoz P, Loehr TM, Schuller DJ, Poulos TL, de Montellano PR",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"reference": [
{
"type": "PubMed",
"id": "11121422",
"url": "https://glygen.org/publication/PubMed/11121422"
}
]
},
{
"title": "Hepatic uptake of bilirubin and its conjugates by the human organic anion transporter SLC21A6.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Cui Y, Konig J, Leier I, Buchholz U, Keppler D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "11134001",
"url": "https://glygen.org/publication/PubMed/11134001"
}
]
},
{
"title": "Nucleotide receptors: an emerging family of regulatory molecules in blood cells.",
"journal": "Blood",
"date": "2001",
"authors": "Di Virgilio F, Chiozzi P, Ferrari D, Falzoni S, Sanz JM, Morelli A, Torboli M, Bolognesi G, Baricordi OR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-844456",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456"
}
],
"reference": [
{
"type": "PubMed",
"id": "11157473",
"url": "https://glygen.org/publication/PubMed/11157473"
}
]
},
{
"title": "Thrombin regulates vascular smooth muscle cell growth and heat shock proteins via the JAK-STAT pathway.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Madamanchi NR, Li S, Patterson C, Runge MS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11278437",
"url": "https://glygen.org/publication/PubMed/11278437"
}
]
},
{
"title": "Co-operative effect of c-Src tyrosine kinase and Stat3 in activation of hepatocyte growth factor expression in mammary carcinoma cells.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Hung W, Elliott B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11278729",
"url": "https://glygen.org/publication/PubMed/11278729"
}
]
},
{
"title": "The Cap'n'Collar basic leucine zipper transcription factor Nrf2 (NF-E2 p45-related factor 2) controls both constitutive and inducible expression of intestinal detoxification and glutathione biosynthetic enzymes.",
"journal": "Cancer research",
"date": "2001",
"authors": "McMahon M, Itoh K, Yamamoto M, Chanas SA, Henderson CJ, McLellan LI, Wolf CR, Cavin C, Hayes JD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "11309284",
"url": "https://glygen.org/publication/PubMed/11309284"
}
]
},
{
"title": "Differential assembly of rat purinergic P2X7 receptor in immune cells of the brain and periphery.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Kim M, Spelta V, Sim J, North RA, Surprenant A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9660826",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9660826"
}
],
"reference": [
{
"type": "PubMed",
"id": "11313357",
"url": "https://glygen.org/publication/PubMed/11313357"
}
]
},
{
"title": "A human mitochondrial ferritin encoded by an intronless gene.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Levi S, Corsi B, Bosisio M, Invernizzi R, Volz A, Sanford D, Arosio P, Drysdale J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "11323407",
"url": "https://glygen.org/publication/PubMed/11323407"
}
]
},
{
"title": "c-Jun and c-Fos cooperate with STAT3 in IL-6-induced transactivation of the IL-6 respone element (IRE).",
"journal": "Cytokine",
"date": "2001",
"authors": "Schuringa JJ, Timmer H, Luttickhuizen D, Vellenga E, Kruijer W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11356008",
"url": "https://glygen.org/publication/PubMed/11356008"
}
]
},
{
"title": "Heme mediates derepression of Maf recognition element through direct binding to transcription repressor Bach1.",
"journal": "The EMBO journal",
"date": "2001",
"authors": "Ogawa K, Sun J, Taketani S, Nakajima O, Nishitani C, Sassa S, Hayashi N, Yamamoto M, Shibahara S, Fujita H, Igarashi K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707616",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616"
}
],
"reference": [
{
"type": "PubMed",
"id": "11387216",
"url": "https://glygen.org/publication/PubMed/11387216"
}
]
},
{
"title": "Affinity of human serum albumin for bilirubin varies with albumin concentration and buffer composition: results of a novel ultrafiltration method.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Weisiger RA, Ostrow JD, Koehler RK, Webster CC, Mukerjee P, Pascolo L, Tiribelli C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "11397817",
"url": "https://glygen.org/publication/PubMed/11397817"
}
]
},
{
"title": "Stat3-mediated Myc expression is required for Src transformation and PDGF-induced mitogenesis.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2001",
"authors": "Bowman T, Broome MA, Sinibaldi D, Wharton W, Pledger WJ, Sedivy JM, Irby R, Yeatman T, Courtneidge SA, Jove R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11404481",
"url": "https://glygen.org/publication/PubMed/11404481"
}
]
},
{
"title": "Cooperation between STAT3 and c-jun suppresses Fas transcription.",
"journal": "Molecular cell",
"date": "2001",
"authors": "Ivanov VN, Bhoumik A, Krasilnikov M, Raz R, Owen-Schaub LB, Levy D, Horvath CM, Ronai Z",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11463377",
"url": "https://glygen.org/publication/PubMed/11463377"
}
]
},
{
"title": "Interaction between pyrin and the apoptotic speck protein (ASC) modulates ASC-induced apoptosis.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Richards N, Schaner P, Diaz A, Stuckey J, Shelden E, Wadhwa A, Gumucio DL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-844456",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456"
}
],
"reference": [
{
"type": "PubMed",
"id": "11498534",
"url": "https://glygen.org/publication/PubMed/11498534"
}
]
},
{
"title": "The albumin binding of unconjugated bilirubin in serum.",
"journal": "Clinical biochemistry",
"date": "1975",
"authors": "Griffiths WC, Diamond I, Dextraze P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "1157293",
"url": "https://glygen.org/publication/PubMed/1157293"
}
]
},
{
"title": "PYPAF1, a PYRIN-containing Apaf1-like protein that assembles with ASC and regulates activation of NF-kappa B.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Manji GA, Wang L, Geddes BJ, Brown M, Merriam S, Al-Garawi A, Mak S, Lora JM, Briskin M, Jurman M, Cao J, DiStefano PS, Bertin J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-844456",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456"
}
],
"reference": [
{
"type": "PubMed",
"id": "11786556",
"url": "https://glygen.org/publication/PubMed/11786556"
}
]
},
{
"title": "Constitutive Stat3 activity up-regulates VEGF expression and tumor angiogenesis.",
"journal": "Oncogene",
"date": "2002",
"authors": "Niu G, Wright KL, Huang M, Song L, Haura E, Turkson J, Zhang S, Wang T, Sinibaldi D, Coppola D, Heller R, Ellis LM, Karras J, Bromberg J, Pardoll D, Jove R, Yu H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11960372",
"url": "https://glygen.org/publication/PubMed/11960372"
}
]
},
{
"title": "The PYRIN-CARD protein ASC is an activating adaptor for caspase-1.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Srinivasula SM, Poyet JL, Razmara M, Datta P, Zhang Z, Alnemri ES",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-844456",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456"
}
],
"reference": [
{
"type": "PubMed",
"id": "11967258",
"url": "https://glygen.org/publication/PubMed/11967258"
}
]
},
{
"title": "Pro-oxidant and cytotoxic effects of circulating heme.",
"journal": "Blood",
"date": "2002",
"authors": "Jeney V, Balla J, Yachie A, Varga Z, Vercellotti GM, Eaton JW, Balla G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707616",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616"
}
],
"reference": [
{
"type": "PubMed",
"id": "12130498",
"url": "https://glygen.org/publication/PubMed/12130498"
}
]
},
{
"title": "The inflammasome: a molecular platform triggering activation of inflammatory caspases and processing of proIL-beta.",
"journal": "Molecular cell",
"date": "2002",
"authors": "Martinon F, Burns K, Tschopp J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-844456",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456"
}
],
"reference": [
{
"type": "PubMed",
"id": "12191486",
"url": "https://glygen.org/publication/PubMed/12191486"
}
]
},
{
"title": "IL-13 signal transduction in human monocytes: phosphorylation of receptor components, association with Jaks, and phosphorylation/activation of Stats.",
"journal": "Journal of leukocyte biology",
"date": "2002",
"authors": "Roy B, Bhattacharjee A, Xu B, Ford D, Maizel AL, Cathcart MK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "12223527",
"url": "https://glygen.org/publication/PubMed/12223527"
}
]
},
{
"title": "Identification of Nrf2-regulated genes induced by the chemopreventive agent sulforaphane by oligonucleotide microarray.",
"journal": "Cancer research",
"date": "2002",
"authors": "Thimmulappa RK, Mai KH, Srisuma S, Kensler TW, Yamamoto M, Biswal S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "12234984",
"url": "https://glygen.org/publication/PubMed/12234984"
}
]
},
{
"title": "Electrophile response element-mediated induction of the cystine/glutamate exchange transporter gene expression.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Sasaki H, Sato H, Kuriyama-Matsumura K, Sato K, Maebara K, Wang H, Tamba M, Itoh K, Yamamoto M, Bannai S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "12235164",
"url": "https://glygen.org/publication/PubMed/12235164"
}
]
},
{
"title": "Expression of the suppressor of cytokine signaling-5 (SOCS5) negatively regulates IL-4-dependent STAT6 activation and Th2 differentiation.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2002",
"authors": "Seki Y, Hayashi K, Matsumoto A, Seki N, Tsukada J, Ransom J, Naka T, Kishimoto T, Yoshimura A, Kubo M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "12242343",
"url": "https://glygen.org/publication/PubMed/12242343"
}
]
},
{
"title": "Hemoprotein Bach1 regulates enhancer availability of heme oxygenase-1 gene.",
"journal": "The EMBO journal",
"date": "2002",
"authors": "Sun J, Hoshino H, Takaku K, Nakajima O, Muto A, Suzuki H, Tashiro S, Takahashi S, Shibahara S, Alam J, Taketo MM, Yamamoto M, Igarashi K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707616",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616"
}
],
"reference": [
{
"type": "PubMed",
"id": "12356737",
"url": "https://glygen.org/publication/PubMed/12356737"
}
]
},
{
"title": "The neutrophil lipocalin NGAL is a bacteriostatic agent that interferes with siderophore-mediated iron acquisition.",
"journal": "Molecular cell",
"date": "2002",
"authors": "Goetz DH, Holmes MA, Borregaard N, Bluhm ME, Raymond KN, Strong RK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "12453412",
"url": "https://glygen.org/publication/PubMed/12453412"
}
]
},
{
"title": "CAND1 binds to unneddylated CUL1 and regulates the formation of SCF ubiquitin E3 ligase complex.",
"journal": "Molecular cell",
"date": "2002",
"authors": "Zheng J, Yang X, Harrell JM, Ryzhikov S, Shim EH, Lykke-Andersen K, Wei N, Sun H, Kobayashi R, Zhang H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "12504026",
"url": "https://glygen.org/publication/PubMed/12504026"
}
]
},
{
"title": "Modulation of gene expression by cancer chemopreventive dithiolethiones through the Keap1-Nrf2 pathway. Identification of novel gene clusters for cell survival.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Kwak MK, Wakabayashi N, Itoh K, Motohashi H, Yamamoto M, Kensler TW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "12506115",
"url": "https://glygen.org/publication/PubMed/12506115"
}
]
},
{
"title": "Bach1 functions as a hypoxia-inducible repressor for the heme oxygenase-1 gene in human cells.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Kitamuro T, Takahashi K, Ogawa K, Udono-Fujimori R, Takeda K, Furuyama K, Nakayama M, Sun J, Fujita H, Hida W, Hattori T, Shirato K, Igarashi K, Shibahara S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707616",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616"
}
],
"reference": [
{
"type": "PubMed",
"id": "12511571",
"url": "https://glygen.org/publication/PubMed/12511571"
}
]
},
{
"title": "Independent and cooperative activation of chromosomal c-fos promoter by STAT3.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Yang E, Lerner L, Besser D, Darnell JE Jr",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "12600988",
"url": "https://glygen.org/publication/PubMed/12600988"
}
]
},
{
"title": "Regulation of cryopyrin/Pypaf1 signaling by pyrin, the familial Mediterranean fever gene product.",
"journal": "Biochemical and biophysical research communications",
"date": "2003",
"authors": "Dowds TA, Masumoto J, Chen FF, Ogura Y, Inohara N, Nunez G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-844456",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456"
}
],
"reference": [
{
"type": "PubMed",
"id": "12615073",
"url": "https://glygen.org/publication/PubMed/12615073"
}
]
},
{
"title": "STATs dimerize in the absence of phosphorylation.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Braunstein J, Brutsaert S, Olson R, Schindler C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "12832402",
"url": "https://glygen.org/publication/PubMed/12832402"
}
]
},
{
"title": "Crystal structures of the ferric, ferrous, and ferrous-NO forms of the Asp140Ala mutant of human heme oxygenase-1: catalytic implications.",
"journal": "Journal of molecular biology",
"date": "2003",
"authors": "Lad L, Wang J, Li H, Friedman J, Bhaskar B, Ortiz de Montellano PR, Poulos TL",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"reference": [
{
"type": "PubMed",
"id": "12842469",
"url": "https://glygen.org/publication/PubMed/12842469"
}
]
},
{
"title": "The expression and functional characterization of ABCG2 in brain endothelial cells and vessels.",
"journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology",
"date": "2003",
"authors": "Zhang W, Mojsilovic-Petrovic J, Andrade MF, Zhang H, Ball M, Stanimirovic DB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "12958161",
"url": "https://glygen.org/publication/PubMed/12958161"
}
]
},
{
"title": "Carbon monoxide specifically inhibits cytochrome c oxidase of human mitochondrial respiratory chain.",
"journal": "Pharmacology & toxicology",
"date": "2003",
"authors": "Alonso JR, Cardellach F, Lopez S, Casademont J, Miro O",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "12969439",
"url": "https://glygen.org/publication/PubMed/12969439"
}
]
},
{
"title": "Multidrug resistance mediated by the breast cancer resistance protein BCRP (ABCG2).",
"journal": "Oncogene",
"date": "2003",
"authors": "Doyle L, Ross DD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "14576842",
"url": "https://glygen.org/publication/PubMed/14576842"
}
]
},
{
"title": "Pyrin binds the PSTPIP1/CD2BP1 protein, defining familial Mediterranean fever and PAPA syndrome as disorders in the same pathway.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2003",
"authors": "Shoham NG, Centola M, Mansfield E, Hull KM, Wood G, Wise CA, Kastner DL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-844456",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456"
}
],
"reference": [
{
"type": "PubMed",
"id": "14595024",
"url": "https://glygen.org/publication/PubMed/14595024"
}
]
},
{
"title": "IL-4 and IL-13 induce SOCS-1 gene expression in A549 cells by three functional STAT6-binding motifs located upstream of the transcription initiation site.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "2003",
"authors": "Hebenstreit D, Luft P, Schmiedlechner A, Regl G, Frischauf AM, Aberger F, Duschl A, Horejs-Hoeck J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "14634100",
"url": "https://glygen.org/publication/PubMed/14634100"
}
]
},
{
"title": "Stat3 enhances vimentin gene expression by binding to the antisilencer element and interacting with the repressor protein, ZBP-89.",
"journal": "Oncogene",
"date": "2004",
"authors": "Wu Y, Diab I, Zhang X, Izmailova ES, Zehner ZE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "14712222",
"url": "https://glygen.org/publication/PubMed/14712222"
}
]
},
{
"title": "Human Sgt1 binds HSP90 through the CHORD-Sgt1 domain and not the tetratricopeptide repeat domain.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Lee YT, Jacob J, Michowski W, Nowotny M, Kuznicki J, Chazin WJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-844456",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456"
}
],
"reference": [
{
"type": "PubMed",
"id": "14761955",
"url": "https://glygen.org/publication/PubMed/14761955"
}
]
},
{
"title": "Characterization of oligomeric human half-ABC transporter ATP-binding cassette G2.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Xu J, Liu Y, Yang Y, Bates S, Zhang JT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "15001581",
"url": "https://glygen.org/publication/PubMed/15001581"
}
]
},
{
"title": "The stem cell marker Bcrp/ABCG2 enhances hypoxic cell survival through interactions with heme.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Krishnamurthy P, Ross DD, Nakanishi T, Bailey-Dell K, Zhou S, Mercer KE, Sarkadi B, Sorrentino BP, Schuetz JD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "15044468",
"url": "https://glygen.org/publication/PubMed/15044468"
}
]
},
{
"title": "Stat3 activation regulates the expression of matrix metalloproteinase-2 and tumor invasion and metastasis.",
"journal": "Oncogene",
"date": "2004",
"authors": "Xie TX, Wei D, Liu M, Gao AC, Ali-Osman F, Sawaya R, Huang S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "15116091",
"url": "https://glygen.org/publication/PubMed/15116091"
}
]
},
{
"title": "Heme regulates gene expression by triggering Crm1-dependent nuclear export of Bach1.",
"journal": "The EMBO journal",
"date": "2004",
"authors": "Suzuki H, Tashiro S, Hira S, Sun J, Yamazaki C, Zenke Y, Ikeda-Saito M, Yoshida M, Igarashi K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707616",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616"
}
],
"reference": [
{
"type": "PubMed",
"id": "15175654",
"url": "https://glygen.org/publication/PubMed/15175654"
}
]
},
{
"title": "Crystal structure and biochemical properties of the human mitochondrial ferritin and its mutant Ser144Ala.",
"journal": "Journal of molecular biology",
"date": "2004",
"authors": "Langlois d'Estaintot B, Santambrogio P, Granier T, Gallois B, Chevalier JM, Precigoux G, Levi S, Arosio P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "15201052",
"url": "https://glygen.org/publication/PubMed/15201052"
}
]
},
{
"title": "The human multidrug-resistance-associated protein MRP1 mediates ATP-dependent transport of unconjugated bilirubin.",
"journal": "The Biochemical journal",
"date": "2004",
"authors": "Rigato I, Pascolo L, Fernetti C, Ostrow JD, Tiribelli C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "15245331",
"url": "https://glygen.org/publication/PubMed/15245331"
}
]
},
{
"title": "STAT-1 is activated by IL-4 and IL-13 in multiple cell types.",
"journal": "Molecular immunology",
"date": "2004",
"authors": "Wang IM, Lin H, Goldman SJ, Kobayashi M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "15261459",
"url": "https://glygen.org/publication/PubMed/15261459"
}
]
},
{
"title": "Characterization of mammalian sulfiredoxin and its reactivation of hyperoxidized peroxiredoxin through reduction of cysteine sulfinic acid in the active site to cysteine.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Chang TS, Jeong W, Woo HA, Lee SM, Park S, Rhee SG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "15448164",
"url": "https://glygen.org/publication/PubMed/15448164"
}
]
},
{
"title": "Genetic ablation of Nrf2 enhances susceptibility to cigarette smoke-induced emphysema in mice.",
"journal": "The Journal of clinical investigation",
"date": "2004",
"authors": "Rangasamy T, Cho CY, Thimmulappa RK, Zhen L, Srisuma SS, Kensler TW, Yamamoto M, Petrache I, Tuder RM, Biswal S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "15520857",
"url": "https://glygen.org/publication/PubMed/15520857"
}
]
},
{
"title": "Lipocalin 2 mediates an innate immune response to bacterial infection by sequestrating iron.",
"journal": "Nature",
"date": "2004",
"authors": "Flo TH, Smith KD, Sato S, Rodriguez DJ, Holmes MA, Strong RK, Akira S, Aderem A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "15531878",
"url": "https://glygen.org/publication/PubMed/15531878"
}
]
},
{
"title": "Structure of the Cand1-Cul1-Roc1 complex reveals regulatory mechanisms for the assembly of the multisubunit cullin-dependent ubiquitin ligases.",
"journal": "Cell",
"date": "2004",
"authors": "Goldenberg SJ, Cascio TC, Shumway SD, Garbutt KC, Liu J, Xiong Y, Zheng N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "15537541",
"url": "https://glygen.org/publication/PubMed/15537541"
}
]
},
{
"title": "Protein kinase Akt/PKB phosphorylates heme oxygenase-1 in vitro and in vivo.",
"journal": "FEBS letters",
"date": "2004",
"authors": "Salinas M, Wang J, Rosa de Sagarra M, Martin D, Rojo AI, Martin-Perez J, Ortiz de Montellano PR, Cuadrado A",
"evidence": [
{
"database": "iPTMnet",
"id": "P09601",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09601"
}
],
"reference": [
{
"type": "PubMed",
"id": "15581622",
"url": "https://glygen.org/publication/PubMed/15581622"
}
]
},
{
"title": "STAT6 transcription factor binding sites with mismatches within the canonical 5'-TTC...GAA-3' motif involved in regulation of delta- and mu-opioid receptors.",
"journal": "Journal of neurochemistry",
"date": "2004",
"authors": "Borner C, Woltje M, Hollt V, Kraus J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "15584925",
"url": "https://glygen.org/publication/PubMed/15584925"
}
]
},
{
"title": "Reduction of cysteine sulfinic acid by sulfiredoxin is specific to 2-cys peroxiredoxins.",
"journal": "The Journal of biological chemistry",
"date": "2005",
"authors": "Woo HA, Jeong W, Chang TS, Park KJ, Park SJ, Yang JS, Rhee SG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "15590625",
"url": "https://glygen.org/publication/PubMed/15590625"
}
]
},
{
"title": "Small glutamine-rich tetratricopeptide repeat-containing protein is composed of three structural units with distinct functions.",
"journal": "Archives of biochemistry and biophysics",
"date": "2005",
"authors": "Liou ST, Wang C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9609523",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523"
}
],
"reference": [
{
"type": "PubMed",
"id": "15708368",
"url": "https://glygen.org/publication/PubMed/15708368"
}
]
},
{
"title": "Sulforaphane induces thioredoxin through the antioxidant-responsive element and attenuates retinal light damage in mice.",
"journal": "Investigative ophthalmology & visual science",
"date": "2005-03",
"authors": "Tanito Masaki, Masutani Hiroshi, Kim Yong-Chul, Nishikawa Mai, Ohira Akihiro, Yodoi Junji",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "15728556",
"url": "https://glygen.org/publication/PubMed/15728556"
}
]
},
{
"title": "Aberrant Stat3 signaling by interleukin-4 in malignant glioma cells: involvement of IL-13Ralpha2.",
"journal": "Cancer research",
"date": "2005",
"authors": "Rahaman SO, Vogelbaum MA, Haque SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "15805299",
"url": "https://glygen.org/publication/PubMed/15805299"
}
]
},
{
"title": "Gene expression alterations of human peripheral blood monocytes induced by medium-term treatment with the TH2-cytokines interleukin-4 and -13.",
"journal": "Cytokine",
"date": "2005",
"authors": "Chaitidis P, O'Donnell V, Kuban RJ, Bermudez-Fajardo A, Ungethuem U, Kuhn H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "15869882",
"url": "https://glygen.org/publication/PubMed/15869882"
}
]
},
{
"title": "Nuclear interaction of EGFR and STAT3 in the activation of the iNOS/NO pathway.",
"journal": "Cancer cell",
"date": "2005",
"authors": "Lo HW, Hsu SC, Ali-Seyed M, Gunduz M, Xia W, Wei Y, Bartholomeusz G, Shih JY, Hung MC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "15950906",
"url": "https://glygen.org/publication/PubMed/15950906"
}
]
},
{
"title": "Targeting Stat3 blocks both HIF-1 and VEGF expression induced by multiple oncogenic growth signaling pathways.",
"journal": "Oncogene",
"date": "2005",
"authors": "Xu Q, Briggs J, Park S, Niu G, Kortylewski M, Zhang S, Gritsko T, Turkson J, Kay H, Semenza GL, Cheng JQ, Jove R, Yu H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16007214",
"url": "https://glygen.org/publication/PubMed/16007214"
}
]
},
{
"title": "STAT3-mediated transcription of Bcl-2, Mcl-1 and c-IAP2 prevents apoptosis in polyamine-depleted cells.",
"journal": "The Biochemical journal",
"date": "2005",
"authors": "Bhattacharya S, Ray RM, Johnson LR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16048438",
"url": "https://glygen.org/publication/PubMed/16048438"
}
]
},
{
"title": "Role of Stat3 in regulating p53 expression and function.",
"journal": "Molecular and cellular biology",
"date": "2005",
"authors": "Niu G, Wright KL, Ma Y, Wright GM, Huang M, Irby R, Briggs J, Karras J, Cress WD, Pardoll D, Jove R, Chen J, Yu H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16107692",
"url": "https://glygen.org/publication/PubMed/16107692"
}
]
},
{
"title": "Identification of an intestinal heme transporter.",
"journal": "Cell",
"date": "2005",
"authors": "Shayeghi M, Latunde-Dada GO, Oakhill JS, Laftah AH, Takeuchi K, Halliday N, Khan Y, Warley A, McCann FE, Hider RC, Frazer DM, Anderson GJ, Vulpe CD, Simpson RJ, McKie AT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "16143108",
"url": "https://glygen.org/publication/PubMed/16143108"
}
]
},
{
"title": "Requirement of STAT3 activation for maximal collagenase-1 (MMP-1) induction by epidermal growth factor and malignant characteristics in T24 bladder cancer cells.",
"journal": "Oncogene",
"date": "2006",
"authors": "Itoh M, Murata T, Suzuki T, Shindoh M, Nakajima K, Imai K, Yoshida K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16205632",
"url": "https://glygen.org/publication/PubMed/16205632"
}
]
},
{
"title": "Essential role of STAT3 in cytokine-driven NF-kappaB-mediated serum amyloid A gene expression.",
"journal": "Genes to cells : devoted to molecular & cellular mechanisms",
"date": "2005",
"authors": "Hagihara K, Nishikawa T, Sugamata Y, Song J, Isobe T, Taga T, Yoshizaki K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16236134",
"url": "https://glygen.org/publication/PubMed/16236134"
}
]
},
{
"title": "Recombinant expression and functional characterization of human hephaestin: a multicopper oxidase with ferroxidase activity.",
"journal": "Biochemistry",
"date": "2005",
"authors": "Griffiths TA, Mauk AG, MacGillivray RT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "16274220",
"url": "https://glygen.org/publication/PubMed/16274220"
}
]
},
{
"title": "A cell-surface receptor for lipocalin 24p3 selectively mediates apoptosis and iron uptake.",
"journal": "Cell",
"date": "2005",
"authors": "Devireddy LR, Gazin C, Zhu X, Green MR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "16377569",
"url": "https://glygen.org/publication/PubMed/16377569"
}
]
},
{
"title": "Persistent activation of stat3 signaling induces survivin gene expression and confers resistance to apoptosis in human breast cancer cells.",
"journal": "Clinical cancer research : an official journal of the American Association for Cancer Research",
"date": "2006",
"authors": "Gritsko T, Williams A, Turkson J, Kaneko S, Bowman T, Huang M, Nam S, Eweis I, Diaz N, Sullivan D, Yoder S, Enkemann S, Eschrich S, Lee JH, Beam CA, Cheng J, Minton S, Muro-Cacho CA, Jove R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16397018",
"url": "https://glygen.org/publication/PubMed/16397018"
}
]
},
{
"title": "Crystal structure of human iron regulatory protein 1 as cytosolic aconitase.",
"journal": "Structure (London, England : 1993)",
"date": "2006",
"authors": "Dupuy J, Volbeda A, Carpentier P, Darnault C, Moulis JM, Fontecilla-Camps JC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "16407072",
"url": "https://glygen.org/publication/PubMed/16407072"
}
]
},
{
"title": "SOCS1: a potent and multifaceted regulator of cytokines and cell-mediated inflammation.",
"journal": "Tissue antigens",
"date": "2006",
"authors": "Davey GM, Heath WR, Starr R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16451196",
"url": "https://glygen.org/publication/PubMed/16451196"
}
]
},
{
"title": "Duodenal cytochrome b: a novel ferrireductase in airway epithelial cells.",
"journal": "American journal of physiology. Lung cellular and molecular physiology",
"date": "2006",
"authors": "Turi JL, Wang X, McKie AT, Nozik-Grayck E, Mamo LB, Crissman K, Piantadosi CA, Ghio AJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "16510471",
"url": "https://glygen.org/publication/PubMed/16510471"
}
]
},
{
"title": "Cyclin D1 is transcriptionally regulated by and required for transformation by activated signal transducer and activator of transcription 3.",
"journal": "Cancer research",
"date": "2006",
"authors": "Leslie K, Lang C, Devgan G, Azare J, Berishaj M, Gerald W, Kim YB, Paz K, Darnell JE, Albanese C, Sakamaki T, Pestell R, Bromberg J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16510571",
"url": "https://glygen.org/publication/PubMed/16510571"
}
]
},
{
"title": "Signaling mechanisms, interaction partners, and target genes of STAT6.",
"journal": "Cytokine & growth factor reviews",
"date": "2006",
"authors": "Hebenstreit D, Wirnsberger G, Horejs-Hoeck J, Duschl A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16540365",
"url": "https://glygen.org/publication/PubMed/16540365"
}
]
},
{
"title": "Identification of STAT3 as a specific substrate of breast tumor kinase.",
"journal": "Oncogene",
"date": "2006",
"authors": "Liu L, Gao Y, Qiu H, Miller WT, Poli V, Reich NC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "16568091",
"url": "https://glygen.org/publication/PubMed/16568091"
}
]
},
{
"title": "Loss of SOCS3 in T helper cells resulted in reduced immune responses and hyperproduction of interleukin 10 and transforming growth factor-beta 1.",
"journal": "The Journal of experimental medicine",
"date": "2006",
"authors": "Kinjyo I, Inoue H, Hamano S, Fukuyama S, Yoshimura T, Koga K, Takaki H, Himeno K, Takaesu G, Kobayashi T, Yoshimura A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16606674",
"url": "https://glygen.org/publication/PubMed/16606674"
}
]
},
{
"title": "Human SGT interacts with Bag-6/Bat-3/Scythe and cells with reduced levels of either protein display persistence of few misaligned chromosomes and mitotic arrest.",
"journal": "Experimental cell research",
"date": "2006",
"authors": "Winnefeld M, Grewenig A, Schnolzer M, Spring H, Knoch TA, Gan EC, Rommelaere J, Cziepluch C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9609523",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523"
}
],
"reference": [
{
"type": "PubMed",
"id": "16777091",
"url": "https://glygen.org/publication/PubMed/16777091"
}
]
},
{
"title": "Pannexin-1 mediates large pore formation and interleukin-1beta release by the ATP-gated P2X7 receptor.",
"journal": "The EMBO journal",
"date": "2006",
"authors": "Pelegrin P, Surprenant A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-844456",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456"
}
],
"reference": [
{
"type": "PubMed",
"id": "17036048",
"url": "https://glygen.org/publication/PubMed/17036048"
}
]
},
{
"title": "Mitochondrial localization and function of heme oxygenase-1 in cigarette smoke-induced cell death.",
"journal": "American journal of respiratory cell and molecular biology",
"date": "2007",
"authors": "Slebos DJ, Ryter SW, van der Toorn M, Liu F, Guo F, Baty CJ, Karlsson JM, Watkins SC, Kim HP, Wang X, Lee JS, Postma DS, Kauffman HF, Choi AM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707587",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707587"
}
],
"reference": [
{
"type": "PubMed",
"id": "17079780",
"url": "https://glygen.org/publication/PubMed/17079780"
}
]
},
{
"title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.",
"journal": "Cell",
"date": "2006",
"authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
},
{
"database": "iPTMnet",
"id": "P09601",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09601"
}
],
"reference": [
{
"type": "PubMed",
"id": "17081983",
"url": "https://glygen.org/publication/PubMed/17081983"
}
]
},
{
"title": "Human prx1 gene is a target of Nrf2 and is up-regulated by hypoxia/reoxygenation: implication to tumor biology.",
"journal": "Cancer research",
"date": "2007",
"authors": "Kim YJ, Ahn JY, Liang P, Ip C, Zhang Y, Park YM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "17234762",
"url": "https://glygen.org/publication/PubMed/17234762"
}
]
},
{
"title": "Carbon monoxide signals via inhibition of cytochrome c oxidase and generation of mitochondrial reactive oxygen species.",
"journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology",
"date": "2007",
"authors": "Zuckerbraun BS, Chin BY, Bilban M, d'Avila JC, Rao J, Billiar TR, Otterbein LE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "17264172",
"url": "https://glygen.org/publication/PubMed/17264172"
}
]
},
{
"title": "Reconstituted NALP1 inflammasome reveals two-step mechanism of caspase-1 activation.",
"journal": "Molecular cell",
"date": "2007",
"authors": "Faustin B, Lartigue L, Bruey JM, Luciano F, Sergienko E, Bailly-Maitre B, Volkmann N, Hanein D, Rouiller I, Reed JC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-844456",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456"
}
],
"reference": [
{
"type": "PubMed",
"id": "17349957",
"url": "https://glygen.org/publication/PubMed/17349957"
}
]
},
{
"title": "Identification of a targeting factor for posttranslational membrane protein insertion into the ER.",
"journal": "Cell",
"date": "2007",
"authors": "Stefanovic S, Hegde RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9609523",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523"
}
],
"reference": [
{
"type": "PubMed",
"id": "17382883",
"url": "https://glygen.org/publication/PubMed/17382883"
}
]
},
{
"title": "Diverse effects of Stat1 on the regulation of hsp90alpha gene under heat shock.",
"journal": "Journal of cellular biochemistry",
"date": "2007",
"authors": "Chen XS, Zhang Y, Wang JS, Li XY, Cheng XK, Zhang Y, Wu NH, Shen YF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "17427945",
"url": "https://glygen.org/publication/PubMed/17427945"
}
]
},
{
"title": "Heme oxygenase-1 protein localizes to the nucleus and activates transcription factors important in oxidative stress.",
"journal": "The Journal of biological chemistry",
"date": "2007",
"authors": "Lin Q, Weis S, Yang G, Weng YH, Helston R, Rish K, Smith A, Bordner J, Polte T, Gaunitz F, Dennery PA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707587",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707587"
}
],
"reference": [
{
"type": "PubMed",
"id": "17430897",
"url": "https://glygen.org/publication/PubMed/17430897"
}
]
},
{
"title": "A crucial function of SGT1 and HSP90 in inflammasome activity links mammalian and plant innate immune responses.",
"journal": "Nature immunology",
"date": "2007",
"authors": "Mayor A, Martinon F, De Smedt T, Petrilli V, Tschopp J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-844456",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456"
}
],
"reference": [
{
"type": "PubMed",
"id": "17435760",
"url": "https://glygen.org/publication/PubMed/17435760"
}
]
},
{
"title": "IL-13 induces expression of CD36 in human monocytes through PPARgamma activation.",
"journal": "European journal of immunology",
"date": "2007",
"authors": "Berry A, Balard P, Coste A, Olagnier D, Lagane C, Authier H, Benoit-Vical F, Lepert JC, Seguela JP, Magnaval JF, Chambon P, Metzger D, Desvergne B, Wahli W, Auwerx J, Pipy B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "17458857",
"url": "https://glygen.org/publication/PubMed/17458857"
}
]
},
{
"title": "Fra-1 and Stat3 synergistically regulate activation of human MMP-9 gene.",
"journal": "Molecular immunology",
"date": "2008",
"authors": "Song Y, Qian L, Song S, Chen L, Zhang Y, Yuan G, Zhang H, Xia Q, Hu M, Yu M, Shi M, Jiang Z, Guo N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "17572495",
"url": "https://glygen.org/publication/PubMed/17572495"
}
]
},
{
"title": "Regulation of the bioavailability of thioredoxin in the lens by a specific thioredoxin-binding protein (TBP-2).",
"journal": "Experimental eye research",
"date": "2007",
"authors": "Liyanage NP, Fernando MR, Lou MF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-844456",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456"
}
],
"reference": [
{
"type": "PubMed",
"id": "17603038",
"url": "https://glygen.org/publication/PubMed/17603038"
}
]
},
{
"title": "NALP inflammasomes: a central role in innate immunity.",
"journal": "Seminars in immunopathology",
"date": "2007",
"authors": "Martinon F, Gaide O, Petrilli V, Mayor A, Tschopp J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-844456",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456"
}
],
"reference": [
{
"type": "PubMed",
"id": "17703304",
"url": "https://glygen.org/publication/PubMed/17703304"
}
]
},
{
"title": "Heme oxygenase-1 induction by NRF2 requires inactivation of the transcriptional repressor BACH1.",
"journal": "Nucleic acids research",
"date": "2007",
"authors": "Reichard JF, Motz GT, Puga A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "17942419",
"url": "https://glygen.org/publication/PubMed/17942419"
}
]
},
{
"title": "Functional characterization of human duodenal cytochrome b (Cybrd1): Redox properties in relation to iron and ascorbate metabolism.",
"journal": "Biochimica et biophysica acta",
"date": "2008",
"authors": "Oakhill JS, Marritt SJ, Gareta EG, Cammack R, McKie AT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "18194661",
"url": "https://glygen.org/publication/PubMed/18194661"
}
]
},
{
"title": "Molecular and structural basis of cytokine receptor pleiotropy in the interleukin-4/13 system.",
"journal": "Cell",
"date": "2008",
"authors": "LaPorte SL, Juo ZS, Vaclavikova J, Colf LA, Qi X, Heller NM, Keegan AD, Garcia KC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "18243101",
"url": "https://glygen.org/publication/PubMed/18243101"
}
]
},
{
"title": "Twist is transcriptionally induced by activation of STAT3 and mediates STAT3 oncogenic function.",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Cheng GZ, Zhang WZ, Sun M, Wang Q, Coppola D, Mansour M, Xu LM, Costanzo C, Cheng JQ, Wang LH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "18353781",
"url": "https://glygen.org/publication/PubMed/18353781"
}
]
},
{
"title": "Regulation of Sox2 by STAT3 initiates commitment to the neural precursor cell fate.",
"journal": "Stem cells and development",
"date": "2008",
"authors": "Foshay KM, Gallicano GI",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "18447642",
"url": "https://glygen.org/publication/PubMed/18447642"
}
]
},
{
"title": "Distinct targeting pathways for the membrane insertion of tail-anchored (TA) proteins.",
"journal": "Journal of cell science",
"date": "2008",
"authors": "Favaloro V, Spasic M, Schwappach B, Dobberstein B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9609523",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523"
}
],
"reference": [
{
"type": "PubMed",
"id": "18477612",
"url": "https://glygen.org/publication/PubMed/18477612"
}
]
},
{
"title": "TiO(2)-based phosphoproteomic analysis of the plasma membrane and the effects of phosphatase inhibitor treatment.",
"journal": "Journal of proteome research",
"date": "2008",
"authors": "Thingholm TE, Larsen MR, Ingrell CR, Kassem M, Jensen ON",
"evidence": [
{
"database": "iPTMnet",
"id": "P09601",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09601"
}
],
"reference": [
{
"type": "PubMed",
"id": "18578522",
"url": "https://glygen.org/publication/PubMed/18578522"
}
]
},
{
"title": "Signal transducer and activator of transcription 3 is required for hypoxia-inducible factor-1alpha RNA expression in both tumor cells and tumor-associated myeloid cells.",
"journal": "Molecular cancer research : MCR",
"date": "2008",
"authors": "Niu G, Briggs J, Deng J, Ma Y, Lee H, Kortylewski M, Kujawski M, Kay H, Cress WD, Jove R, Yu H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "18644974",
"url": "https://glygen.org/publication/PubMed/18644974"
}
]
},
{
"title": "Successive and selective release of phosphorylated peptides captured by hydroxy acid-modified metal oxide chromatography.",
"journal": "Journal of proteome research",
"date": "2008",
"authors": "Kyono Y, Sugiyama N, Imami K, Tomita M, Ishihama Y",
"evidence": [
{
"database": "iPTMnet",
"id": "P09601",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09601"
}
],
"reference": [
{
"type": "PubMed",
"id": "18767875",
"url": "https://glygen.org/publication/PubMed/18767875"
}
]
},
{
"title": "Nrf2-regulated glutathione recycling independent of biosynthesis is critical for cell survival during oxidative stress.",
"journal": "Free radical biology & medicine",
"date": "2009",
"authors": "Harvey CJ, Thimmulappa RK, Singh A, Blake DJ, Ling G, Wakabayashi N, Fujii J, Myers A, Biswal S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "19028565",
"url": "https://glygen.org/publication/PubMed/19028565"
}
]
},
{
"title": "Mechanism of interferon-gamma mediated down-regulation of interleukin-10 gene expression.",
"journal": "Molecular immunology",
"date": "2009",
"authors": "Schaefer A, Unterberger C, Frankenberger M, Lohrum M, Staples KJ, Werner T, Stunnenberg H, Ziegler-Heitbrock L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "19124156",
"url": "https://glygen.org/publication/PubMed/19124156"
}
]
},
{
"title": "Regulation of the IL-23 and IL-12 balance by Stat3 signaling in the tumor microenvironment.",
"journal": "Cancer cell",
"date": "2009",
"authors": "Kortylewski M, Xin H, Kujawski M, Lee H, Liu Y, Harris T, Drake C, Pardoll D, Yu H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "19185846",
"url": "https://glygen.org/publication/PubMed/19185846"
}
]
},
{
"title": "Acetylation of Nrf2 by p300/CBP augments promoter-specific DNA binding of Nrf2 during the antioxidant response.",
"journal": "Molecular and cellular biology",
"date": "2009",
"authors": "Sun Z, Chin YE, Zhang DD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "19273602",
"url": "https://glygen.org/publication/PubMed/19273602"
}
]
},
{
"title": "The RhoU/Wrch1 Rho GTPase gene is a common transcriptional target of both the gp130/STAT3 and Wnt-1 pathways.",
"journal": "The Biochemical journal",
"date": "2009",
"authors": "Schiavone D, Dewilde S, Vallania F, Turkson J, Di Cunto F, Poli V",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "19397496",
"url": "https://glygen.org/publication/PubMed/19397496"
}
]
},
{
"title": "A regulated RNA binding protein also possesses aconitase activity.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1991",
"authors": "Kaptain S, Downey WE, Tang C, Philpott C, Haile D, Orloff DG, Harford JB, Rouault TA, Klausner RD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "1946430",
"url": "https://glygen.org/publication/PubMed/1946430"
}
]
},
{
"title": "Oligomerization is crucial for the stability and function of heme oxygenase-1 in the endoplasmic reticulum.",
"journal": "The Journal of biological chemistry",
"date": "2009-08-21",
"authors": "Hwang Hsuan-Wen, Lee Jay-Ron, Chou Kuan-Yu, Suen Ching-Shu, Hwang Ming-Jing, Chen Chinpan, Shieh Ru-Chi, Chau Lee-Young",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"reference": [
{
"type": "PubMed",
"id": "19556236",
"url": "https://glygen.org/publication/PubMed/19556236"
}
]
},
{
"title": "Cutting edge: NF-kappaB activating pattern recognition and cytokine receptors license NLRP3 inflammasome activation by regulating NLRP3 expression.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "2009",
"authors": "Bauernfeind FG, Horvath G, Stutz A, Alnemri ES, MacDonald K, Speert D, Fernandes-Alnemri T, Wu J, Monks BG, Fitzgerald KA, Hornung V, Latz E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-844456",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456"
}
],
"reference": [
{
"type": "PubMed",
"id": "19570822",
"url": "https://glygen.org/publication/PubMed/19570822"
}
]
},
{
"title": "Characterization of the cancer chemopreventive NRF2-dependent gene battery in human keratinocytes: demonstration that the KEAP1-NRF2 pathway, and not the BACH1-NRF2 pathway, controls cytoprotection against electrophiles as well as redox-cycling compounds.",
"journal": "Carcinogenesis",
"date": "2009",
"authors": "MacLeod AK, McMahon M, Plummer SM, Higgins LG, Penning TM, Igarashi K, Hayes JD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "19608619",
"url": "https://glygen.org/publication/PubMed/19608619"
}
]
},
{
"title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.",
"journal": "Molecular & cellular proteomics : MCP",
"date": "2009",
"authors": "Pan C, Olsen JV, Daub H, Mann M",
"evidence": [
{
"database": "iPTMnet",
"id": "P09601",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09601"
}
],
"reference": [
{
"type": "PubMed",
"id": "19651622",
"url": "https://glygen.org/publication/PubMed/19651622"
}
]
},
{
"title": "Limited role for the bilirubin-biliverdin redox amplification cycle in the cellular antioxidant protection by biliverdin reductase.",
"journal": "The Journal of biological chemistry",
"date": "2009",
"authors": "Maghzal GJ, Leck MC, Collinson E, Li C, Stocker R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "19690164",
"url": "https://glygen.org/publication/PubMed/19690164"
}
]
},
{
"title": "Control of iron homeostasis by an iron-regulated ubiquitin ligase.",
"journal": "Science (New York, N.Y.)",
"date": "2009",
"authors": "Vashisht AA, Zumbrennen KB, Huang X, Powers DN, Durazo A, Sun D, Bhaskaran N, Persson A, Uhlen M, Sangfelt O, Spruck C, Leibold EA, Wohlschlegel JA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "19762596",
"url": "https://glygen.org/publication/PubMed/19762596"
}
]
},
{
"title": "An E3 ligase possessing an iron-responsive hemerythrin domain is a regulator of iron homeostasis.",
"journal": "Science (New York, N.Y.)",
"date": "2009",
"authors": "Salahudeen AA, Thompson JW, Ruiz JC, Ma HW, Kinch LN, Li Q, Grishin NV, Bruick RK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "19762597",
"url": "https://glygen.org/publication/PubMed/19762597"
}
]
},
{
"title": "Biopreservation of red blood cells--the struggle with hemoglobin oxidation.",
"journal": "The FEBS journal",
"date": "2010",
"authors": "Kanias T, Acker JP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "19968714",
"url": "https://glygen.org/publication/PubMed/19968714"
}
]
},
{
"title": "Thioredoxin-interacting protein links oxidative stress to inflammasome activation.",
"journal": "Nature immunology",
"date": "2010",
"authors": "Zhou R, Tardivel A, Thorens B, Choi I, Tschopp J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-844456",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456"
}
],
"reference": [
{
"type": "PubMed",
"id": "20023662",
"url": "https://glygen.org/publication/PubMed/20023662"
}
]
},
{
"title": "Mechanisms of cell protection by heme oxygenase-1.",
"journal": "Annual review of pharmacology and toxicology",
"date": "2010",
"authors": "Gozzelino Raffaella, Jeney Viktoria, Soares Miguel P",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"reference": [
{
"type": "PubMed",
"id": "20055707",
"url": "https://glygen.org/publication/PubMed/20055707"
}
]
},
{
"title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.",
"journal": "Science signaling",
"date": "2010",
"authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
},
{
"database": "iPTMnet",
"id": "P09601",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09601"
}
],
"reference": [
{
"type": "PubMed",
"id": "20068231",
"url": "https://glygen.org/publication/PubMed/20068231"
}
]
},
{
"title": "The inflammasomes.",
"journal": "Cell",
"date": "2010",
"authors": "Schroder K, Tschopp J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-844456",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456"
}
],
"reference": [
{
"type": "PubMed",
"id": "20303873",
"url": "https://glygen.org/publication/PubMed/20303873"
}
]
},
{
"title": "Asna1/TRC40-mediated membrane insertion of tail-anchored proteins.",
"journal": "Journal of cell science",
"date": "2010",
"authors": "Favaloro V, Vilardi F, Schlecht R, Mayer MP, Dobberstein B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9609523",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523"
}
],
"reference": [
{
"type": "PubMed",
"id": "20375064",
"url": "https://glygen.org/publication/PubMed/20375064"
}
]
},
{
"title": "Global mapping of binding sites for Nrf2 identifies novel targets in cell survival response through ChIP-Seq profiling and network analysis.",
"journal": "Nucleic acids research",
"date": "2010",
"authors": "Malhotra D, Portales-Casamar E, Singh A, Srivastava S, Arenillas D, Happel C, Shyr C, Wakabayashi N, Kensler TW, Wasserman WW, Biswal S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "20460467",
"url": "https://glygen.org/publication/PubMed/20460467"
}
]
},
{
"title": "Diverse targets of the transcription factor STAT3 contribute to T cell pathogenicity and homeostasis.",
"journal": "Immunity",
"date": "2010",
"authors": "Durant L, Watford WT, Ramos HL, Laurence A, Vahedi G, Wei L, Takahashi H, Sun HW, Kanno Y, Powrie F, O'Shea JJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "20493732",
"url": "https://glygen.org/publication/PubMed/20493732"
}
]
},
{
"title": "A mammalian siderophore synthesized by an enzyme with a bacterial homolog involved in enterobactin production.",
"journal": "Cell",
"date": "2010",
"authors": "Devireddy LR, Hart DO, Goetz DH, Green MR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "20550936",
"url": "https://glygen.org/publication/PubMed/20550936"
}
]
},
{
"title": "A ribosome-associating factor chaperones tail-anchored membrane proteins.",
"journal": "Nature",
"date": "2010",
"authors": "Mariappan M, Li X, Stefanovic S, Sharma A, Mateja A, Keenan RJ, Hegde RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9609523",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523"
}
],
"reference": [
{
"type": "PubMed",
"id": "20676083",
"url": "https://glygen.org/publication/PubMed/20676083"
}
]
},
{
"title": "CXCR3-B can mediate growth-inhibitory signals in human renal cancer cells by down-regulating the expression of heme oxygenase-1.",
"journal": "J. Biol. Chem.",
"date": "2010",
"authors": "Datta Dipak, Banerjee Pallavi, Gasser Martin, Waaga-Gasser Ana Maria, Pal Soumitro",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"reference": [
{
"type": "PubMed",
"id": "20855888",
"url": "https://glygen.org/publication/PubMed/20855888"
}
]
},
{
"title": "Interactions of STAP-2 with Brk and STAT3 participate in cell growth of human breast cancer cells.",
"journal": "The Journal of biological chemistry",
"date": "2010",
"authors": "Ikeda O, Sekine Y, Mizushima A, Nakasuji M, Miyasaka Y, Yamamoto C, Muromoto R, Nanbo A, Oritani K, Yoshimura A, Matsuda T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "20929863",
"url": "https://glygen.org/publication/PubMed/20929863"
}
]
},
{
"title": "STAT3-induced S1PR1 expression is crucial for persistent STAT3 activation in tumors.",
"journal": "Nature medicine",
"date": "2010",
"authors": "Lee H, Deng J, Kujawski M, Yang C, Liu Y, Herrmann A, Kortylewski M, Horne D, Somlo G, Forman S, Jove R, Yu H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "21102457",
"url": "https://glygen.org/publication/PubMed/21102457"
}
]
},
{
"title": "alphaMbeta(2) integrin activation prevents alternative activation of human and murine macrophages and impedes foam cell formation.",
"journal": "Circulation research",
"date": "2011",
"authors": "Yakubenko VP, Bhattacharjee A, Pluskota E, Cathcart MK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "21252155",
"url": "https://glygen.org/publication/PubMed/21252155"
}
]
},
{
"title": "WRB is the receptor for TRC40/Asna1-mediated insertion of tail-anchored proteins into the ER membrane.",
"journal": "Journal of cell science",
"date": "2011",
"authors": "Vilardi F, Lorenz H, Dobberstein B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9609523",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523"
}
],
"reference": [
{
"type": "PubMed",
"id": "21444755",
"url": "https://glygen.org/publication/PubMed/21444755"
}
]
},
{
"title": "A biochemical analysis of the constraints of tail-anchored protein biogenesis.",
"journal": "The Biochemical journal",
"date": "2011",
"authors": "Leznicki P, Warwicker J, High S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9609523",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523"
}
],
"reference": [
{
"type": "PubMed",
"id": "21466504",
"url": "https://glygen.org/publication/PubMed/21466504"
}
]
},
{
"title": "Detection of multiple forms of human ceruloplasmin. A novel Mr 200,000 form.",
"journal": "The Journal of biological chemistry",
"date": "1990",
"authors": "Sato M, Schilsky ML, Stockert RJ, Morell AG, Sternlieb I",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "2154449",
"url": "https://glygen.org/publication/PubMed/2154449"
}
]
},
{
"title": "A ubiquitin ligase-associated chaperone holdase maintains polypeptides in soluble states for proteasome degradation.",
"journal": "Molecular cell",
"date": "2011",
"authors": "Wang Q, Liu Y, Soetandyo N, Baek K, Hegde R, Ye Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9609523",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523"
}
],
"reference": [
{
"type": "PubMed",
"id": "21636303",
"url": "https://glygen.org/publication/PubMed/21636303"
}
]
},
{
"title": "TRIM8 regulates Nanog via Hsp90beta-mediated nuclear translocation of STAT3 in embryonic stem cells.",
"journal": "Biochimica et biophysica acta",
"date": "2011",
"authors": "Okumura F, Okumura AJ, Matsumoto M, Nakayama KI, Hatakeyama S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "21689689",
"url": "https://glygen.org/publication/PubMed/21689689"
}
]
},
{
"title": "STAT3 protein promotes T-cell survival and inhibits interleukin-2 production through up-regulation of Class O Forkhead transcription factors.",
"journal": "The Journal of biological chemistry",
"date": "2011",
"authors": "Oh HM, Yu CR, Golestaneh N, Amadi-Obi A, Lee YS, Eseonu A, Mahdi RM, Egwuagu CE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "21730069",
"url": "https://glygen.org/publication/PubMed/21730069"
}
]
},
{
"title": "Protein targeting and degradation are coupled for elimination of mislocalized proteins.",
"journal": "Nature",
"date": "2011",
"authors": "Hessa T, Sharma A, Mariappan M, Eshleman HD, Gutierrez E, Hegde RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9609523",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523"
}
],
"reference": [
{
"type": "PubMed",
"id": "21743475",
"url": "https://glygen.org/publication/PubMed/21743475"
}
]
},
{
"title": "Beneficial role of Nrf2 in regulating NADPH generation and consumption.",
"journal": "Toxicological sciences : an official journal of the Society of Toxicology",
"date": "2011",
"authors": "Wu KC, Cui JY, Klaassen CD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "21775727",
"url": "https://glygen.org/publication/PubMed/21775727"
}
]
},
{
"title": "ATP-induced pore formation in the plasma membrane of rat peritoneal mast cells.",
"journal": "The Journal of general physiology",
"date": "1990",
"authors": "Tatham PE, Lindau M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-844456",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456"
}
],
"reference": [
{
"type": "PubMed",
"id": "2182768",
"url": "https://glygen.org/publication/PubMed/2182768"
}
]
},
{
"title": "Signal transducers and activators of transcription 3 (STAT3) directly regulates cytokine-induced fascin expression and is required for breast cancer cell migration.",
"journal": "The Journal of biological chemistry",
"date": "2011",
"authors": "Snyder M, Huang XY, Zhang JJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "21937440",
"url": "https://glygen.org/publication/PubMed/21937440"
}
]
},
{
"title": "Cytokine induction of tumor necrosis factor receptor 2 is mediated by STAT3 in colon cancer cells.",
"journal": "Molecular cancer research : MCR",
"date": "2011",
"authors": "Hamilton KE, Simmons JG, Ding S, Van Landeghem L, Lund PK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "21994466",
"url": "https://glygen.org/publication/PubMed/21994466"
}
]
},
{
"title": "Necdin, a negative growth regulator, is a novel STAT3 target gene down-regulated in human cancer.",
"journal": "PloS one",
"date": "2011",
"authors": "Haviland R, Eschrich S, Bloom G, Ma Y, Minton S, Jove R, Cress WD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "22046235",
"url": "https://glygen.org/publication/PubMed/22046235"
}
]
},
{
"title": "Roles of STAT3 and ZEB1 proteins in E-cadherin down-regulation and human colorectal cancer epithelial-mesenchymal transition.",
"journal": "The Journal of biological chemistry",
"date": "2012",
"authors": "Xiong H, Hong J, Du W, Lin YW, Ren LL, Wang YC, Su WY, Wang JL, Cui Y, Wang ZH, Fang JY",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "22205702",
"url": "https://glygen.org/publication/PubMed/22205702"
}
]
},
{
"title": "Complete OATP1B1 and OATP1B3 deficiency causes human Rotor syndrome by interrupting conjugated bilirubin reuptake into the liver.",
"journal": "The Journal of clinical investigation",
"date": "2012",
"authors": "van de Steeg E, Stranecky V, Hartmannova H, Noskova L, Hrebicek M, Wagenaar E, van Esch A, de Waart DR, Oude Elferink RP, Kenworthy KE, Sticova E, al-Edreesi M, Knisely AS, Kmoch S, Jirsa M, Schinkel AH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "22232210",
"url": "https://glygen.org/publication/PubMed/22232210"
}
]
},
{
"title": "The Jak/STAT pathway.",
"journal": "Cold Spring Harbor perspectives in biology",
"date": "2012",
"authors": "Harrison DA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "22383755",
"url": "https://glygen.org/publication/PubMed/22383755"
}
]
},
{
"title": "Endoplasmic reticulum anchored heme-oxygenase 1 faces the cytosol.",
"journal": "Haematologica",
"date": "2012",
"authors": "Gottlieb Yehonatan, Truman Marianna, Cohen Lyora A, Leichtmann-Bardoogo Yael, Meyron-Holtz Esther G",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"reference": [
{
"type": "PubMed",
"id": "22419571",
"url": "https://glygen.org/publication/PubMed/22419571"
}
]
},
{
"title": "Carbon monoxide promotes respiratory hemoproteins iron reduction using peroxides as electron donors.",
"journal": "PloS one",
"date": "2012",
"authors": "Sher EA, Shaklai M, Shaklai N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "22427940",
"url": "https://glygen.org/publication/PubMed/22427940"
}
]
},
{
"title": "The cystine/glutamate antiporter system x(c)(-) in health and disease: from molecular mechanisms to novel therapeutic opportunities.",
"journal": "Antioxidants & redox signaling",
"date": "2013",
"authors": "Lewerenz J, Hewett SJ, Huang Y, Lambros M, Gout PW, Kalivas PW, Massie A, Smolders I, Methner A, Pergande M, Smith SB, Ganapathy V, Maher P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "22667998",
"url": "https://glygen.org/publication/PubMed/22667998"
}
]
},
{
"title": "STAT1 gene expression is enhanced by nuclear EGFR and HER2 via cooperation with STAT3.",
"journal": "Molecular carcinogenesis",
"date": "2013",
"authors": "Han W, Carpenter RL, Cao X, Lo HW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "22693070",
"url": "https://glygen.org/publication/PubMed/22693070"
}
]
},
{
"title": "Molecular modeling to provide insight into the substrate binding and catalytic mechanism of human biliverdin-IXalpha reductase.",
"journal": "The journal of physical chemistry. B",
"date": "2012",
"authors": "Fu G, Liu H, Doerksen RJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "22823425",
"url": "https://glygen.org/publication/PubMed/22823425"
}
]
},
{
"title": "Interleukin-10-induced neutrophil gelatinase-associated lipocalin production in macrophages with consequences for tumor growth.",
"journal": "Molecular and cellular biology",
"date": "2012",
"authors": "Jung M, Weigert A, Tausendschon M, Mora J, Oren B, Sola A, Hotter G, Muta T, Brune B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "22851691",
"url": "https://glygen.org/publication/PubMed/22851691"
}
]
},
{
"title": "Glutathione synthesis.",
"journal": "Biochimica et biophysica acta",
"date": "2013",
"authors": "Lu SC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "22995213",
"url": "https://glygen.org/publication/PubMed/22995213"
}
]
},
{
"title": "Superoxide dismutase 3 is induced by antioxidants, inhibits oxidative DNA damage and is associated with inhibition of estrogen-induced breast cancer.",
"journal": "Carcinogenesis",
"date": "2012-12",
"authors": "Singh Bhupendra, Bhat Hari K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "23027624",
"url": "https://glygen.org/publication/PubMed/23027624"
}
]
},
{
"title": "Molecular machinery for insertion of tail-anchored membrane proteins into the endoplasmic reticulum membrane in mammalian cells.",
"journal": "Molecular cell",
"date": "2012",
"authors": "Yamamoto Y, Sakisaka T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9609523",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523"
}
],
"reference": [
{
"type": "PubMed",
"id": "23041287",
"url": "https://glygen.org/publication/PubMed/23041287"
}
]
},
{
"title": "STAT1 activation by venous malformations mutant Tie2-R849W antagonizes VEGF-A-mediated angiogenic response partly via reduced bFGF production.",
"journal": "Angiogenesis",
"date": "2013",
"authors": "Huang YH, Wu MP, Pan SC, Su WC, Chen YW, Wu LW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "23086340",
"url": "https://glygen.org/publication/PubMed/23086340"
}
]
},
{
"title": "IL-4 and IL-13 employ discrete signaling pathways for target gene expression in alternatively activated monocytes/macrophages.",
"journal": "Free radical biology & medicine",
"date": "2013",
"authors": "Bhattacharjee A, Shukla M, Yakubenko VP, Mulya A, Kundu S, Cathcart MK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "23124025",
"url": "https://glygen.org/publication/PubMed/23124025"
}
]
},
{
"title": "SGTA antagonizes BAG6-mediated protein triage.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2012",
"authors": "Leznicki P, High S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9609523",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523"
}
],
"reference": [
{
"type": "PubMed",
"id": "23129660",
"url": "https://glygen.org/publication/PubMed/23129660"
}
]
},
{
"title": "Structures of the Sgt2/SGTA dimerization domain with the Get5/UBL4A UBL domain reveal an interaction that forms a conserved dynamic interface.",
"journal": "Cell reports",
"date": "2012",
"authors": "Chartron JW, VanderVelde DG, Clemons WM Jr",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9609523",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523"
}
],
"reference": [
{
"type": "PubMed",
"id": "23142665",
"url": "https://glygen.org/publication/PubMed/23142665"
}
]
},
{
"title": "STAT3 is involved in esophageal carcinogenesis through regulation of Oct-1.",
"journal": "Carcinogenesis",
"date": "2013",
"authors": "Wang Z, Zhu S, Shen M, Liu J, Wang M, Li C, Wang Y, Deng A, Mei Q",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "23172665",
"url": "https://glygen.org/publication/PubMed/23172665"
}
]
},
{
"title": "SGTA recognizes a noncanonical ubiquitin-like domain in the Bag6-Ubl4A-Trc35 complex to promote endoplasmic reticulum-associated degradation.",
"journal": "Cell reports",
"date": "2012",
"authors": "Xu Y, Cai M, Yang Y, Huang L, Ye Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9609523",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523"
}
],
"reference": [
{
"type": "PubMed",
"id": "23246001",
"url": "https://glygen.org/publication/PubMed/23246001"
}
]
},
{
"title": "Mutant B-RAF-Mcl-1 survival signaling depends on the STAT3 transcription factor.",
"journal": "Oncogene",
"date": "2014",
"authors": "Becker TM, Boyd SC, Mijatov B, Gowrishankar K, Snoyman S, Pupo GM, Scolyer RA, Mann GJ, Kefford RF, Zhang XD, Rizos H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "23455323",
"url": "https://glygen.org/publication/PubMed/23455323"
}
]
},
{
"title": "The association of BAG6 with SGTA and tail-anchored proteins.",
"journal": "PloS one",
"date": "2013",
"authors": "Leznicki P, Roebuck QP, Wunderley L, Clancy A, Krysztofinska EM, Isaacson RL, Warwicker J, Schwappach B, High S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9609523",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523"
}
],
"reference": [
{
"type": "PubMed",
"id": "23533635",
"url": "https://glygen.org/publication/PubMed/23533635"
}
]
},
{
"title": "Tissue inhibitor of metalloproteinase 1 is preferentially expressed in Th1 and Th17 T-helper cell subsets and is a direct STAT target gene.",
"journal": "PloS one",
"date": "2013",
"authors": "Adamson A, Ghoreschi K, Rittler M, Chen Q, Sun HW, Vahedi G, Kanno Y, Stetler-Stevenson WG, O'Shea JJ, Laurence A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "23555662",
"url": "https://glygen.org/publication/PubMed/23555662"
}
]
},
{
"title": "Crucial function of vertebrate glutaredoxin 3 (PICOT) in iron homeostasis and hemoglobin maturation.",
"journal": "Molecular biology of the cell",
"date": "2013",
"authors": "Haunhorst P, Hanschmann EM, Brautigam L, Stehling O, Hoffmann B, Muhlenhoff U, Lill R, Berndt C, Lillig CH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "23615448",
"url": "https://glygen.org/publication/PubMed/23615448"
}
]
},
{
"title": "Cutting edge: the NLRP3 inflammasome links complement-mediated inflammation and IL-1beta release.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "2013",
"authors": "Laudisi F, Spreafico R, Evrard M, Hughes TR, Mandriani B, Kandasamy M, Morgan BP, Sivasankar B, Mortellaro A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9660826",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9660826"
}
],
"reference": [
{
"type": "PubMed",
"id": "23817414",
"url": "https://glygen.org/publication/PubMed/23817414"
}
]
},
{
"title": "C3a modulates IL-1beta secretion in human monocytes by regulating ATP efflux and subsequent NLRP3 inflammasome activation.",
"journal": "Blood",
"date": "2013",
"authors": "Asgari E, Le Friec G, Yamamoto H, Perucha E, Sacks SS, Kohl J, Cook HT, Kemper C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9660826",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9660826"
}
],
"reference": [
{
"type": "PubMed",
"id": "23878142",
"url": "https://glygen.org/publication/PubMed/23878142"
}
]
},
{
"title": "STAT3 regulates MMP3 in heme-induced endothelial cell apoptosis.",
"journal": "PloS one",
"date": "2013",
"authors": "Liu M, Wilson NO, Hibbert JM, Stiles JK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "23967200",
"url": "https://glygen.org/publication/PubMed/23967200"
}
]
},
{
"title": "Regulation of the human thioredoxin gene promoter and its key substrates: a study of functional and putative regulatory elements.",
"journal": "Biochimica et biophysica acta",
"date": "2014-01",
"authors": "Hawkes Hye-Jin Kim, Karlenius Therese C, Tonissen Kathryn F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "24041992",
"url": "https://glygen.org/publication/PubMed/24041992"
}
]
},
{
"title": "The signal transducers Stat1 and Stat3 and their novel target Jmjd3 drive the expression of inflammatory genes in microglia.",
"journal": "Journal of molecular medicine (Berlin, Germany)",
"date": "2014",
"authors": "Przanowski P, Dabrowski M, Ellert-Miklaszewska A, Kloss M, Mieczkowski J, Kaza B, Ronowicz A, Hu F, Piotrowski A, Kettenmann H, Komorowski J, Kaminska B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "24097101",
"url": "https://glygen.org/publication/PubMed/24097101"
}
]
},
{
"title": "WRB and CAML are necessary and sufficient to mediate tail-anchored protein targeting to the ER membrane.",
"journal": "PloS one",
"date": "2014",
"authors": "Vilardi F, Stephan M, Clancy A, Janshoff A, Schwappach B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9609523",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523"
}
],
"reference": [
{
"type": "PubMed",
"id": "24392163",
"url": "https://glygen.org/publication/PubMed/24392163"
}
]
},
{
"title": "STAT3 Target Genes Relevant to Human Cancers.",
"journal": "Cancers",
"date": "2014",
"authors": "Carpenter RL, Lo HW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "24743777",
"url": "https://glygen.org/publication/PubMed/24743777"
}
]
},
{
"title": "Cleavage by signal peptide peptidase is required for the degradation of selected tail-anchored proteins.",
"journal": "The Journal of cell biology",
"date": "2014",
"authors": "Boname JM, Bloor S, Wandel MP, Nathan JA, Antrobus R, Dingwell KS, Thurston TL, Smith DL, Smith JC, Randow F, Lehner PJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707587",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707587"
}
],
"reference": [
{
"type": "PubMed",
"id": "24958774",
"url": "https://glygen.org/publication/PubMed/24958774"
}
]
},
{
"title": "Nrf2- and ATF4-dependent upregulation of xCT modulates the sensitivity of T24 bladder carcinoma cells to proteasome inhibition.",
"journal": "Molecular and cellular biology",
"date": "2014",
"authors": "Ye P, Mimura J, Okada T, Sato H, Liu T, Maruyama A, Ohyama C, Itoh K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "25002527",
"url": "https://glygen.org/publication/PubMed/25002527"
}
]
},
{
"title": "SGTA regulates the cytosolic quality control of hydrophobic substrates.",
"journal": "Journal of cell science",
"date": "2014",
"authors": "Wunderley L, Leznicki P, Payapilly A, High S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9609523",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523"
}
],
"reference": [
{
"type": "PubMed",
"id": "25179605",
"url": "https://glygen.org/publication/PubMed/25179605"
}
]
},
{
"title": "Liver is the major source of elevated serum lipocalin-2 levels after bacterial infection or partial hepatectomy: a critical role for IL-6/STAT3.",
"journal": "Hepatology (Baltimore, Md.)",
"date": "2015",
"authors": "Xu MJ, Feng D, Wu H, Wang H, Chan Y, Kolls J, Borregaard N, Porse B, Berger T, Mak TW, Cowland JB, Kong X, Gao B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "25234944",
"url": "https://glygen.org/publication/PubMed/25234944"
}
]
},
{
"title": "Structural organization of the human heme oxygenase gene and the function of its promoter.",
"journal": "Eur. J. Biochem.",
"date": "1989",
"authors": "Shibahara S, Sato M, Muller RM, Yoshida T",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"reference": [
{
"type": "PubMed",
"id": "2537723",
"url": "https://glygen.org/publication/PubMed/2537723"
}
]
},
{
"title": "Solution structure of the SGTA dimerisation domain and investigation of its interactions with the ubiquitin-like domains of BAG6 and UBL4A.",
"journal": "PloS one",
"date": "2014",
"authors": "Darby JF, Krysztofinska EM, Simpson PJ, Simon AC, Leznicki P, Sriskandarajah N, Bishop DS, Hale LR, Alfano C, Conte MR, Martinez-Lumbreras S, Thapaliya A, High S, Isaacson RL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9609523",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523"
}
],
"reference": [
{
"type": "PubMed",
"id": "25415308",
"url": "https://glygen.org/publication/PubMed/25415308"
}
]
},
{
"title": "Bag6 complex contains a minimal tail-anchor-targeting module and a mock BAG domain.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2015",
"authors": "Mock JY, Chartron JW, Zaslaver M, Xu Y, Ye Y, Clemons WM Jr",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9609523",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523"
}
],
"reference": [
{
"type": "PubMed",
"id": "25535373",
"url": "https://glygen.org/publication/PubMed/25535373"
}
]
},
{
"title": "Structure of a BAG6 (Bcl-2-associated athanogene 6)-Ubl4a (ubiquitin-like protein 4a) complex reveals a novel binding interface that functions in tail-anchored protein biogenesis.",
"journal": "The Journal of biological chemistry",
"date": "2015",
"authors": "Kuwabara N, Minami R, Yokota N, Matsumoto H, Senda T, Kawahara H, Kato R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9609523",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523"
}
],
"reference": [
{
"type": "PubMed",
"id": "25713138",
"url": "https://glygen.org/publication/PubMed/25713138"
}
]
},
{
"title": "IL-1beta production is dependent on the activation of purinergic receptors and NLRP3 pathway in human macrophages.",
"journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology",
"date": "2015",
"authors": "Gicquel T, Robert S, Loyer P, Victoni T, Bodin A, Ribault C, Gleonnec F, Couillin I, Boichot E, Lagente V",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9660826",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9660826"
}
],
"reference": [
{
"type": "PubMed",
"id": "26116704",
"url": "https://glygen.org/publication/PubMed/26116704"
}
]
},
{
"title": "Molecular mechanisms regulating NLRP3 inflammasome activation.",
"journal": "Cellular & molecular immunology",
"date": "2016",
"authors": "Jo EK, Kim JK, Shin DM, Sasakawa C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-844456",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456"
}
],
"reference": [
{
"type": "PubMed",
"id": "26549800",
"url": "https://glygen.org/publication/PubMed/26549800"
}
]
},
{
"title": "Emery-Dreifuss muscular dystrophy mutations impair TRC40-mediated targeting of emerin to the inner nuclear membrane.",
"journal": "Journal of cell science",
"date": "2016",
"authors": "Pfaff J, Rivera Monroy J, Jamieson C, Rajanala K, Vilardi F, Schwappach B, Kehlenbach RH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9609523",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523"
}
],
"reference": [
{
"type": "PubMed",
"id": "26675233",
"url": "https://glygen.org/publication/PubMed/26675233"
}
]
},
{
"title": "Role of Nrf2/HO-1 system in development, oxidative stress response and diseases: an evolutionarily conserved mechanism.",
"journal": "Cellular and molecular life sciences : CMLS",
"date": "2016",
"authors": "Loboda A, Damulewicz M, Pyza E, Jozkowicz A, Dulak J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "27100828",
"url": "https://glygen.org/publication/PubMed/27100828"
}
]
},
{
"title": "APEX Fingerprinting Reveals the Subcellular Localization of Proteins of Interest.",
"journal": "Cell Rep.",
"date": "2016",
"authors": "Lee Song-Yi, Kang Myeong-Gyun, Park Jong-Seok, Lee Geunsik, Ting Alice Y, Rhee Hyun-Woo",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"reference": [
{
"type": "PubMed",
"id": "27184847",
"url": "https://glygen.org/publication/PubMed/27184847"
}
]
},
{
"title": "Structural and functional insights into the E3 ligase, RNF126.",
"journal": "Scientific reports",
"date": "2016",
"authors": "Krysztofinska EM, Martinez-Lumbreras S, Thapaliya A, Evans NJ, High S, Isaacson RL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9609523",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523"
}
],
"reference": [
{
"type": "PubMed",
"id": "27193484",
"url": "https://glygen.org/publication/PubMed/27193484"
}
]
},
{
"title": "Tail-anchored Protein Insertion in Mammals: FUNCTION AND RECIPROCAL INTERACTIONS OF THE TWO SUBUNITS OF THE TRC40 RECEPTOR.",
"journal": "The Journal of biological chemistry",
"date": "2016",
"authors": "Colombo SF, Cardani S, Maroli A, Vitiello A, Soffientini P, Crespi A, Bram RF, Benfante R, Borgese N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9609523",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523"
}
],
"reference": [
{
"type": "PubMed",
"id": "27226539",
"url": "https://glygen.org/publication/PubMed/27226539"
}
]
},
{
"title": "Tryptophan-rich basic protein (WRB) mediates insertion of the tail-anchored protein otoferlin and is required for hair cell exocytosis and hearing.",
"journal": "The EMBO journal",
"date": "2016",
"authors": "Vogl C, Panou I, Yamanbaeva G, Wichmann C, Mangosing SJ, Vilardi F, Indzhykulian AA, Pangrsic T, Santarelli R, Rodriguez-Ballesteros M, Weber T, Jung S, Cardenas E, Wu X, Wojcik SM, Kwan KY, Del Castillo I, Schwappach B, Strenzke N, Corey DP, Lin SY, Moser T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9609523",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523"
}
],
"reference": [
{
"type": "PubMed",
"id": "27458190",
"url": "https://glygen.org/publication/PubMed/27458190"
}
]
},
{
"title": "Peroxiredoxin 1 - an antioxidant enzyme in cancer.",
"journal": "Journal of cellular and molecular medicine",
"date": "2017",
"authors": "Ding C, Fan X, Wu G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "27653015",
"url": "https://glygen.org/publication/PubMed/27653015"
}
]
},
{
"title": "Identification of a novel putative interaction partner of the nucleoporin ALADIN.",
"journal": "Biology open",
"date": "2016",
"authors": "Juhlen R, Landgraf D, Huebner A, Koehler K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707616",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616"
}
],
"reference": [
{
"type": "PubMed",
"id": "27754849",
"url": "https://glygen.org/publication/PubMed/27754849"
}
]
},
{
"title": "The role of peroxiredoxin 1 in redox sensing and transducing.",
"journal": "Archives of biochemistry and biophysics",
"date": "2017",
"authors": "Ledgerwood EC, Marshall JW, Weijman JF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "27756681",
"url": "https://glygen.org/publication/PubMed/27756681"
}
]
},
{
"title": "Mechanistic basis for a molecular triage reaction.",
"journal": "Science (New York, N.Y.)",
"date": "2017",
"authors": "Shao S, Rodrigo-Brenni MC, Kivlen MH, Hegde RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9609523",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523"
}
],
"reference": [
{
"type": "PubMed",
"id": "28104892",
"url": "https://glygen.org/publication/PubMed/28104892"
}
]
},
{
"title": "Ligand and Target Discovery by Fragment-Based Screening in Human Cells.",
"journal": "Cell",
"date": "2017",
"authors": "Parker CG, Galmozzi A, Wang Y, Correia BE, Sasaki K, Joslyn CM, Kim AS, Cavallaro CL, Lawrence RM, Johnson SR, Narvaiza I, Saez E, Cravatt BF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707616",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616"
}
],
"reference": [
{
"type": "PubMed",
"id": "28111073",
"url": "https://glygen.org/publication/PubMed/28111073"
}
]
},
{
"title": "Synthesis of a Highly Azide-Reactive and Thermosensitive Biofunctional Reagent for Efficient Enrichment and Large-Scale Identification of O-GlcNAc Proteins by Mass Spectrometry.",
"journal": "Analytical chemistry",
"date": "2017",
"authors": "Zhang W, Liu T, Dong H, Bai H, Tian F, Shi Z, Chen M, Wang J, Qin W, Qian X",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P09601",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09601"
}
],
"reference": [
{
"type": "PubMed",
"id": "28510447",
"url": "https://glygen.org/publication/PubMed/28510447"
}
]
},
{
"title": "Crystal structure of CO-bound cytochrome c oxidase determined by serial femtosecond X-ray crystallography at room temperature.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2017",
"authors": "Ishigami I, Zatsepin NA, Hikita M, Conrad CE, Nelson G, Coe JD, Basu S, Grant TD, Seaberg MH, Sierra RG, Hunter MS, Fromme P, Fromme R, Yeh SR, Rousseau DL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "28698372",
"url": "https://glygen.org/publication/PubMed/28698372"
}
]
},
{
"title": "NRF2 Is a Major Target of ARF in p53-Independent Tumor Suppression.",
"journal": "Molecular cell",
"date": "2017",
"authors": "Chen D, Tavana O, Chu B, Erber L, Chen Y, Baer R, Gu W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "28985506",
"url": "https://glygen.org/publication/PubMed/28985506"
}
]
},
{
"title": "Heme oxygenase is the major 32-kDa stress protein induced in human skin fibroblasts by UVA radiation, hydrogen peroxide, and sodium arsenite.",
"journal": "Proc. Natl. Acad. Sci. U.S.A.",
"date": "1989",
"authors": "Keyse SM, Tyrrell RM",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"reference": [
{
"type": "PubMed",
"id": "2911585",
"url": "https://glygen.org/publication/PubMed/2911585"
}
]
},
{
"title": "Insights into the mechanism of isoenzyme-specific signal peptide peptidase-mediated translocation of heme oxygenase.",
"journal": "PloS one",
"date": "2017",
"authors": "Schaefer B, Moriishi K, Behrends S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707587",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707587"
}
],
"reference": [
{
"type": "PubMed",
"id": "29155886",
"url": "https://glygen.org/publication/PubMed/29155886"
}
]
},
{
"title": "The ER membrane protein complex is a transmembrane domain insertase.",
"journal": "Science (New York, N.Y.)",
"date": "2018",
"authors": "Guna A, Volkmar N, Christianson JC, Hegde RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9609523",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523"
}
],
"reference": [
{
"type": "PubMed",
"id": "29242231",
"url": "https://glygen.org/publication/PubMed/29242231"
}
]
},
{
"title": "A review on heme oxygenase-1 induction: is it a necessary evil.",
"journal": "Inflammation research : official journal of the European Histamine Research Society ... [et al.]",
"date": "2018",
"authors": "Waza AA, Hamid Z, Ali S, Bhat SA, Bhat MA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "29693710",
"url": "https://glygen.org/publication/PubMed/29693710"
}
]
},
{
"title": "Hsp90 inhibition as a means to inhibit activation of the NLRP3 inflammasome.",
"journal": "Scientific reports",
"date": "2018",
"authors": "Piippo N, Korhonen E, Hytti M, Skottman H, Kinnunen K, Josifovska N, Petrovski G, Kaarniranta K, Kauppinen A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-844456",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456"
}
],
"reference": [
{
"type": "PubMed",
"id": "29712950",
"url": "https://glygen.org/publication/PubMed/29712950"
}
]
},
{
"title": "The multifaceted role of glutathione S-transferases in cancer.",
"journal": "Cancer letters",
"date": "2018",
"authors": "Chatterjee A, Gupta S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "29959055",
"url": "https://glygen.org/publication/PubMed/29959055"
}
]
},
{
"title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.",
"journal": "Chemical communications (Cambridge, England)",
"date": "2018",
"authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P09601",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09601"
}
],
"reference": [
{
"type": "PubMed",
"id": "30379171",
"url": "https://glygen.org/publication/PubMed/30379171"
}
]
},
{
"title": "Programmed Cell-Death by Ferroptosis: Antioxidants as Mitigators.",
"journal": "International journal of molecular sciences",
"date": "2019",
"authors": "Kajarabille N, Latunde-Dada GO",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "31597407",
"url": "https://glygen.org/publication/PubMed/31597407"
}
]
},
{
"title": "PGRMC2 is an intracellular haem chaperone critical for adipocyte function.",
"journal": "Nature",
"date": "2019",
"authors": "Galmozzi A, Kok BP, Kim AS, Montenegro-Burke JR, Lee JY, Spreafico R, Mosure S, Albert V, Cintron-Colon R, Godio C, Webb WR, Conti B, Solt LA, Kojetin D, Parker CG, Peluso JJ, Pru JK, Siuzdak G, Cravatt BF, Saez E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707616",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616"
}
],
"reference": [
{
"type": "PubMed",
"id": "31748741",
"url": "https://glygen.org/publication/PubMed/31748741"
}
]
},
{
"title": "The Molecular Mechanisms Regulating the KEAP1-NRF2 Pathway.",
"journal": "Molecular and cellular biology",
"date": "2020",
"authors": "Baird L, Yamamoto M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "32284348",
"url": "https://glygen.org/publication/PubMed/32284348"
}
]
},
{
"title": "Heme induces human and mouse platelet activation through C-type-lectin-like receptor-2.",
"journal": "Haematologica",
"date": "2021",
"authors": "Bourne JH, Colicchia M, Di Y, Martin E, Slater A, Roumenina LT, Dimitrov JD, Watson SP, Rayes J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707616",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616"
}
],
"reference": [
{
"type": "PubMed",
"id": "32354867",
"url": "https://glygen.org/publication/PubMed/32354867"
}
]
},
{
"title": "Nrf2 inhibits ferroptosis and protects against acute lung injury due to intestinal ischemia reperfusion via regulating SLC7A11 and HO-1.",
"journal": "Aging",
"date": "2020",
"authors": "Dong H, Qiang Z, Chai D, Peng J, Xia Y, Hu R, Jiang H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "32601262",
"url": "https://glygen.org/publication/PubMed/32601262"
}
]
},
{
"title": "Identification of a Heme Activation Site on the MD-2/TLR4 Complex.",
"journal": "Frontiers in immunology",
"date": "2020",
"authors": "Belcher JD, Zhang P, Nguyen J, Kiser ZM, Nath KA, Hu J, Trent JO, Vercellotti GM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707616",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616"
}
],
"reference": [
{
"type": "PubMed",
"id": "32695117",
"url": "https://glygen.org/publication/PubMed/32695117"
}
]
},
{
"title": "Oxidative Damage and Antioxidant Defense in Ferroptosis.",
"journal": "Frontiers in cell and developmental biology",
"date": "2020",
"authors": "Kuang F, Liu J, Tang D, Kang R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "33043019",
"url": "https://glygen.org/publication/PubMed/33043019"
}
]
},
{
"title": "Human heme oxygenase cDNA and induction of its mRNA by hemin.",
"journal": "Eur. J. Biochem.",
"date": "1988",
"authors": "Yoshida T, Biro P, Cohen T, Muller RM, Shibahara S",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
},
{
"database": "Reactome",
"id": "R-HSA-9707616",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616"
}
],
"reference": [
{
"type": "PubMed",
"id": "3345742",
"url": "https://glygen.org/publication/PubMed/3345742"
}
]
},
{
"title": "Cellular degradation systems in ferroptosis.",
"journal": "Cell death and differentiation",
"date": "2021",
"authors": "Chen X, Yu C, Kang R, Kroemer G, Tang D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "33462411",
"url": "https://glygen.org/publication/PubMed/33462411"
}
]
},
{
"title": "The diverse functionality of NQO1 and its roles in redox control.",
"journal": "Redox biology",
"date": "2021",
"authors": "Ross D, Siegel D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "33774477",
"url": "https://glygen.org/publication/PubMed/33774477"
}
]
},
{
"title": "Carbon monoxide binding to human hemoglobin A0.",
"journal": "Biochemistry",
"date": "1987",
"authors": "Di Cera E, Doyle ML, Connelly PR, Gill SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "3427020",
"url": "https://glygen.org/publication/PubMed/3427020"
}
]
},
{
"title": "Antioxidant activity of albumin-bound bilirubin.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1987",
"authors": "Stocker R, Glazer AN, Ames BN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "3475708",
"url": "https://glygen.org/publication/PubMed/3475708"
}
]
},
{
"title": "SARS-CoV-2 ORF3a induces RETREG1/FAM134B-dependent reticulophagy and triggers sequential ER stress and inflammatory responses during SARS-CoV-2 infection.",
"journal": "Autophagy",
"date": "2022-11",
"authors": "Zhang Xiaolin, Yang Ziwei, Pan Ting, Long Xubing, Sun Qinqin, Wang Pei-Hui, Li Xiaojuan, Kuang Ersheng",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"reference": [
{
"type": "PubMed",
"id": "35239449",
"url": "https://glygen.org/publication/PubMed/35239449"
}
]
},
{
"title": "SNP (A\u2009>\u2009G - rs13057211) but not GT(n) polymorphism in HMOX-1 promotor gene is associated with COVID-19 mortality.",
"journal": "BMC pulmonary medicine",
"date": "2023-12-21",
"authors": "Fares Kerolos, El-Deeb Mona K, Elsammak Omar, Ouf Amged, Saeed Hesham Mahmoud Sayd, Baess Ayman, Elsammak Mohamed, El-Attar Eman",
"evidence": [
{
"database": "RefSeq",
"id": "NP_002124",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002124"
}
],
"reference": [
{
"type": "PubMed",
"id": "38129860",
"url": "https://glygen.org/publication/PubMed/38129860"
}
]
},
{
"title": "Inhibition of heme oxygenase 1 alleviates thoracic aortic aneurysm via restoration of extracellular matrix.",
"journal": "Biochemical and biophysical research communications",
"date": "2024-01-29",
"authors": "Song Wenyu, Shen Kangjie, Fu Guangguo, Qin Lieyang, Bagaber Ghufran, Chen Jinmiao, Wei Lai",
"evidence": [
{
"database": "RefSeq",
"id": "NP_002124",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002124"
}
],
"reference": [
{
"type": "PubMed",
"id": "38147696",
"url": "https://glygen.org/publication/PubMed/38147696"
}
]
},
{
"title": "IL-38 alleviates atherogenic responses via SIRT6/HO-1 signaling: A promising strategy against obesity-related atherosclerosis.",
"journal": "Biochemical and biophysical research communications",
"date": "2024-01-29",
"authors": "Cho Wonjun, Oh Heeseung, Abd El-Aty A M, Mobarak Enas H, Jeong Ji Hoon, Jung Tae Woo",
"evidence": [
{
"database": "RefSeq",
"id": "NP_002124",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002124"
}
],
"reference": [
{
"type": "PubMed",
"id": "38154209",
"url": "https://glygen.org/publication/PubMed/38154209"
}
]
},
{
"title": "Mechanisms by which silencing long-stranded noncoding RNA KCNQ1OT1 alleviates myocardial ischemia/reperfusion injury (MI/RI)-induced cardiac injury via miR-377-3p/HMOX1.",
"journal": "BMC cardiovascular disorders",
"date": "2024-01-03",
"authors": "Tan Tongcai, Tu Liang, Yu Yanmei, He MinJie, Zhou Xingchao, Yang Lei",
"evidence": [
{
"database": "RefSeq",
"id": "NP_002124",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002124"
}
],
"reference": [
{
"type": "PubMed",
"id": "38172743",
"url": "https://glygen.org/publication/PubMed/38172743"
}
]
},
{
"title": "Associations between UGT1A1, SLCO1B1, SLCO1B3, BLVRA and HMOX1 polymorphisms and susceptibility to neonatal severe hyperbilirubinemia in Chinese Han population.",
"journal": "BMC pediatrics",
"date": "2024-01-26",
"authors": "Fan Juan, He Hua-Yun, Li Huan-Huan, Wu Pi-Liu, Tang Lei, Deng Bo-Yin, Dong Wen-Hui, Wang Jian-Hui",
"evidence": [
{
"database": "RefSeq",
"id": "NP_002124",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002124"
}
],
"reference": [
{
"type": "PubMed",
"id": "38279097",
"url": "https://glygen.org/publication/PubMed/38279097"
}
]
},
{
"title": "ATP induces nucleotide permeability in rat mast cells.",
"journal": "Nature",
"date": "1979",
"authors": "Cockcroft S, Gomperts BD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-844456",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456"
}
],
"reference": [
{
"type": "PubMed",
"id": "450099",
"url": "https://glygen.org/publication/PubMed/450099"
}
]
},
{
"title": "Two hepatic cytoplasmic protein fractions, Y and Z, and their possible role in the hepatic uptake of bilirubin, sulfobromophthalein, and other anions.",
"journal": "The Journal of clinical investigation",
"date": "1969",
"authors": "Levi AJ, Gatmaitan Z, Arias IM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "4980931",
"url": "https://glygen.org/publication/PubMed/4980931"
}
]
},
{
"title": "Hemoglobin. A biologic fenton reagent.",
"journal": "The Journal of biological chemistry",
"date": "1984",
"authors": "Sadrzadeh SM, Graf E, Panter SS, Hallaway PE, Eaton JW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707564",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564"
}
],
"reference": [
{
"type": "PubMed",
"id": "6094553",
"url": "https://glygen.org/publication/PubMed/6094553"
}
]
},
{
"title": "Bilirubin binding to human liver ligandin (glutathione S-transferase).",
"journal": "The Journal of biological chemistry",
"date": "1980",
"authors": "Simons PC, Jagt DL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "7372607",
"url": "https://glygen.org/publication/PubMed/7372607"
}
]
},
{
"title": "Interferon activation of the transcription factor Stat91 involves dimerization through SH2-phosphotyrosyl peptide interactions.",
"journal": "Cell",
"date": "1994",
"authors": "Shuai K, Horvath CM, Huang LH, Qureshi SA, Cowburn D, Darnell JE Jr",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "7510216",
"url": "https://glygen.org/publication/PubMed/7510216"
}
]
},
{
"title": "Molecular cloning of APRF, a novel IFN-stimulated gene factor 3 p91-related transcription factor involved in the gp130-mediated signaling pathway.",
"journal": "Cell",
"date": "1994",
"authors": "Akira S, Nishio Y, Inoue M, Wang XJ, Wei S, Matsusaka T, Yoshida K, Sudo T, Naruto M, Kishimoto T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "7512451",
"url": "https://glygen.org/publication/PubMed/7512451"
}
]
},
{
"title": "IL-13 selectively induces vascular cell adhesion molecule-1 expression in human endothelial cells.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "1995",
"authors": "Bochner BS, Klunk DA, Sterbinsky SA, Coffman RL, Schleimer RP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "7529288",
"url": "https://glygen.org/publication/PubMed/7529288"
}
]
},
{
"title": "Expression and characterization of truncated human heme oxygenase (hHO-1) and a fusion protein of hHO-1 with human cytochrome P450 reductase.",
"journal": "Biochemistry",
"date": "1995",
"authors": "Wilks A, Black SM, Miller WL, Ortiz de Montellano PR",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"reference": [
{
"type": "PubMed",
"id": "7703255",
"url": "https://glygen.org/publication/PubMed/7703255"
}
]
},
{
"title": "Direct evidence of a heterotrimeric complex of human interleukin-4 with its receptors.",
"journal": "Protein science : a publication of the Protein Society",
"date": "1995",
"authors": "Hoffman RC, Castner BJ, Gerhart M, Gibson MG, Rasmussen BD, March CJ, Weatherbee J, Tsang M, Gustchina A, Schalk-Hihi C, et al.",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "7795521",
"url": "https://glygen.org/publication/PubMed/7795521"
}
]
},
{
"title": "Components of a Stat recognition code: evidence for two layers of molecular selectivity.",
"journal": "Immunity",
"date": "1995",
"authors": "Schindler U, Wu P, Rothe M, Brasseur M, McKnight SL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "7796300",
"url": "https://glygen.org/publication/PubMed/7796300"
}
]
},
{
"title": "Transcriptional regulation of the junB promoter: analysis of STAT-mediated signal transduction.",
"journal": "Oncogene",
"date": "1995",
"authors": "Coffer P, Lutticken C, van Puijenbroek A, Klop-de Jonge M, Horn F, Kruijer W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "7898939",
"url": "https://glygen.org/publication/PubMed/7898939"
}
]
},
{
"title": "Interleukin 13, an interleukin 4-like cytokine that acts on monocytes and B cells, but not on T cells.",
"journal": "Immunology today",
"date": "1994",
"authors": "Zurawski G, de Vries JE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "7907877",
"url": "https://glygen.org/publication/PubMed/7907877"
}
]
},
{
"title": "Extracellular superoxide dismutase (SOD3): tissue-specific expression, genomic characterization, and computer-assisted sequence analysis of the human EC SOD gene.",
"journal": "Genomics",
"date": "1994-07-01",
"authors": "Folz R J, Crapo J D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "7959763",
"url": "https://glygen.org/publication/PubMed/7959763"
}
]
},
{
"title": "Molecular characterization of a second iron-responsive element binding protein, iron regulatory protein 2. Structure, function, and post-translational regulation.",
"journal": "The Journal of biological chemistry",
"date": "1994",
"authors": "Samaniego F, Chin J, Iwai K, Rouault TA, Klausner RD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "7983023",
"url": "https://glygen.org/publication/PubMed/7983023"
}
]
},
{
"title": "The bifunctional iron-responsive element binding protein/cytosolic aconitase: the role of active-site residues in ligand binding and regulation.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1994",
"authors": "Philpott CC, Klausner RD, Rouault TA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "8041788",
"url": "https://glygen.org/publication/PubMed/8041788"
}
]
},
{
"title": "An interleukin-4-induced transcription factor: IL-4 Stat.",
"journal": "Science (New York, N.Y.)",
"date": "1994",
"authors": "Hou J, Schindler U, Henzel WJ, Ho TC, Brasseur M, McKnight SL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "8085155",
"url": "https://glygen.org/publication/PubMed/8085155"
}
]
},
{
"title": "Endothelial-cell heme uptake from heme proteins: induction of sensitization and desensitization to oxidant damage.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1993",
"authors": "Balla J, Jacob HS, Balla G, Nath K, Eaton JW, Vercellotti GM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707616",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616"
}
],
"reference": [
{
"type": "PubMed",
"id": "8415693",
"url": "https://glygen.org/publication/PubMed/8415693"
}
]
},
{
"title": "Essential role of Stat6 in IL-4 signalling.",
"journal": "Nature",
"date": "1996",
"authors": "Takeda K, Tanaka T, Shi W, Matsumoto M, Minami M, Kashiwamura S, Nakanishi K, Yoshida N, Kishimoto T, Akira S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "8602263",
"url": "https://glygen.org/publication/PubMed/8602263"
}
]
},
{
"title": "STAT3 participates in transcriptional activation of the C-reactive protein gene by interleukin-6.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Zhang D, Sun M, Samols D, Kushner I",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "8621622",
"url": "https://glygen.org/publication/PubMed/8621622"
}
]
},
{
"title": "Cloning and characterization of a specific interleukin (IL)-13 binding protein structurally related to the IL-5 receptor alpha chain.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Caput D, Laurent P, Kaghad M, Lelias JM, Lefort S, Vita N, Ferrara P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "8663118",
"url": "https://glygen.org/publication/PubMed/8663118"
}
]
},
{
"title": "The lipopolysaccharide-binding protein is a secretory class 1 acute-phase protein whose gene is transcriptionally activated by APRF/STAT/3 and other cytokine-inducible nuclear proteins.",
"journal": "Molecular and cellular biology",
"date": "1996",
"authors": "Schumann RR, Kirschning CJ, Unbehaun A, Aberle HP, Knope HP, Lamping N, Ulevitch RJ, Herrmann F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "8668165",
"url": "https://glygen.org/publication/PubMed/8668165"
}
]
},
{
"title": "The ferritins: molecular properties, iron storage function and cellular regulation.",
"journal": "Biochimica et biophysica acta",
"date": "1996",
"authors": "Harrison PM, Arosio P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-917937",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937"
}
],
"reference": [
{
"type": "PubMed",
"id": "8695634",
"url": "https://glygen.org/publication/PubMed/8695634"
}
]
},
{
"title": "Global and local determinants for the kinetics of interleukin-4/interleukin-4 receptor alpha chain interaction. A biosensor study employing recombinant interleukin-4-binding protein.",
"journal": "European journal of biochemistry",
"date": "1996",
"authors": "Shen BJ, Hage T, Sebald W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "8797861",
"url": "https://glygen.org/publication/PubMed/8797861"
}
]
},
{
"title": "Requirements for interleukin-4-induced gene expression and functional characterization of Stat6.",
"journal": "Molecular and cellular biology",
"date": "1996",
"authors": "Mikita T, Campbell D, Wu P, Williamson K, Schindler U",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "8816495",
"url": "https://glygen.org/publication/PubMed/8816495"
}
]
},
{
"title": "Bach proteins belong to a novel family of BTB-basic leucine zipper transcription factors that interact with MafK and regulate transcription through the NF-E2 site.",
"journal": "Molecular and cellular biology",
"date": "1996",
"authors": "Oyake T, Itoh K, Motohashi H, Hayashi N, Hoshino H, Nishizawa M, Yamamoto M, Igarashi K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9707616",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616"
}
],
"reference": [
{
"type": "PubMed",
"id": "8887638",
"url": "https://glygen.org/publication/PubMed/8887638"
}
]
},
{
"title": "Cloning of the human IL-13R alpha1 chain and reconstitution with the IL4R alpha of a functional IL-4/IL-13 receptor complex.",
"journal": "FEBS letters",
"date": "1997",
"authors": "Miloux B, Laurent P, Bonnin O, Lupker J, Caput D, Vita N, Ferrara P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "9013879",
"url": "https://glygen.org/publication/PubMed/9013879"
}
]
},
{
"title": "Purinoceptor-operated cationic channels in human B lymphocytes.",
"journal": "The Journal of physiology",
"date": "1997",
"authors": "Markwardt F, Lohn M, Bohm T, Klapperstuck M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-844456",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456"
}
],
"reference": [
{
"type": "PubMed",
"id": "9023774",
"url": "https://glygen.org/publication/PubMed/9023774"
}
]
},
{
"title": "An Nrf2/small Maf heterodimer mediates the induction of phase II detoxifying enzyme genes through antioxidant response elements.",
"journal": "Biochemical and biophysical research communications",
"date": "1997",
"authors": "Itoh K, Chiba T, Takahashi S, Ishii T, Igarashi K, Katoh Y, Oyake T, Hayashi N, Satoh K, Hatayama I, Yamamoto M, Nabeshima Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "9240432",
"url": "https://glygen.org/publication/PubMed/9240432"
}
]
},
{
"title": "Mutational analysis of the STAT6 SH2 domain.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Mikita T, Daniel C, Wu P, Schindler U",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "9651359",
"url": "https://glygen.org/publication/PubMed/9651359"
}
]
},
{
"title": "The role of IL-13 and its receptor in allergy and inflammatory responses.",
"journal": "The Journal of allergy and clinical immunology",
"date": "1998",
"authors": "de Vries JE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "9723655",
"url": "https://glygen.org/publication/PubMed/9723655"
}
]
},
{
"title": "Interferon-gamma-induced factor binding to the interleukin-4-responsive element of CD23b promoter in human tonsillar mononuclear cells: role in transient up-regulation of the interleukin-4-induced CD23b mRNA.",
"journal": "Molecular immunology",
"date": "1998",
"authors": "Park HJ, So EY, Lee CE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "9736340",
"url": "https://glygen.org/publication/PubMed/9736340"
}
]
},
{
"title": "Induction of 15-lipoxygenase expression by IL-13 requires tyrosine phosphorylation of Jak2 and Tyk2 in human monocytes.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Roy B, Cathcart MK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "9822675",
"url": "https://glygen.org/publication/PubMed/9822675"
}
]
},
{
"title": "STAT3 is required for the gp130-mediated full activation of the c-myc gene.",
"journal": "The Journal of experimental medicine",
"date": "1999",
"authors": "Kiuchi N, Nakajima K, Ichiba M, Fukada T, Narimatsu M, Mizuno K, Hibi M, Hirano T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "9874564",
"url": "https://glygen.org/publication/PubMed/9874564"
}
]
},
{
"title": "Oxidative stress causes enhanced endothelial cell injury in human heme oxygenase-1 deficiency.",
"journal": "J. Clin. Invest.",
"date": "1999",
"authors": "Yachie A, Niida Y, Wada T, Igarashi N, Kaneda H, Toma T, Ohta K, Kasahara Y, Koizumi S",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"reference": [
{
"type": "PubMed",
"id": "9884342",
"url": "https://glygen.org/publication/PubMed/9884342"
}
]
}
],
"pathway": [
{
"id": "hsa:3162",
"name": "",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3162",
"resource": "KEGG Pathway"
},
{
"id": "R-HSA-189483",
"name": "Heme degradation",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483",
"resource": "Reactome",
"description": "Heme degradation"
},
{
"id": "R-HSA-6785807",
"name": "Interleukin-4 and Interleukin-13 signaling",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807",
"resource": "Reactome",
"description": "Interleukin-4 and Interleukin-13 signaling"
},
{
"id": "R-HSA-844456",
"name": "The NLRP3 inflammasome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456",
"resource": "Reactome",
"description": "The NLRP3 inflammasome"
},
{
"id": "R-HSA-917937",
"name": "Iron uptake and transport",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937",
"resource": "Reactome",
"description": "Iron uptake and transport"
},
{
"id": "R-HSA-9609523",
"name": "Insertion of tail-anchored proteins into the endoplasmic reticulum membrane",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523",
"resource": "Reactome",
"description": "Insertion of tail-anchored proteins into the endoplasmic reticulum membrane"
},
{
"id": "R-HSA-9660826",
"name": "Purinergic signaling in leishmaniasis infection",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9660826",
"resource": "Reactome",
"description": "Purinergic signaling in leishmaniasis infection"
},
{
"id": "R-HSA-9707564",
"name": "Cytoprotection by HMOX1",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707564",
"resource": "Reactome",
"description": "Cytoprotection by HMOX1"
},
{
"id": "R-HSA-9707587",
"name": "Regulation of HMOX1 expression and activity",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707587",
"resource": "Reactome",
"description": "Regulation of HMOX1 expression and activity"
},
{
"id": "R-HSA-9707616",
"name": "Heme signaling",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616",
"resource": "Reactome",
"description": "Heme signaling"
},
{
"id": "R-HSA-9818027",
"name": "NFE2L2 regulating anti-oxidant/detoxification enzymes",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027",
"resource": "Reactome",
"description": "NFE2L2 regulating anti-oxidant/detoxification enzymes"
}
],
"orthologs": [
{
"uniprot_canonical_ac": "P06762-1",
"protein_name": "Heme oxygenase 1",
"gene_name": "Hmox1",
"tax_id": 10116,
"organism": "Rattus norvegicus",
"sequence": {
"sequence": "MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLATVAVGIYAM",
"length": 289
},
"evidence": [
{
"id": "45928229",
"url": "http://www.informatics.jax.org/homology/45928229",
"database": "MGI"
}
],
"common_name": "Rat"
},
{
"uniprot_canonical_ac": "P14901-1",
"protein_name": "Heme oxygenase 1",
"gene_name": "Hmox1",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQTPLLQWVLTLSFLLATVAVGIYAM",
"length": 289
},
"evidence": [
{
"id": "45928229",
"url": "http://www.informatics.jax.org/homology/45928229",
"database": "MGI"
},
{
"id": "P09601",
"url": "https://omabrowser.org/oma/group/P09601/",
"database": "OMA"
}
],
"common_name": "Mouse"
}
],
"go_annotation": {
"categories": [
{
"name": "Molecular Function",
"total": 7,
"go_terms": [
{
"name": "metal ion binding",
"id": "GO:0046872",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "heme oxygenase (decyclizing) activity",
"id": "GO:0004392",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004392",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "enzyme binding",
"id": "GO:0019899",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "identical protein binding",
"id": "GO:0042802",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "protein homodimerization activity",
"id": "GO:0042803",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "structural molecule activity",
"id": "GO:0005198",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005198",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "heme binding",
"id": "GO:0020037",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0020037",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
}
]
},
{
"name": "Biological Process",
"total": 37,
"go_terms": [
{
"name": "heme oxidation",
"id": "GO:0006788",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006788",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "wound healing involved in inflammatory response",
"id": "GO:0002246",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002246",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "smooth muscle hyperplasia",
"id": "GO:0014806",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014806",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "regulation of transcription from RNA polymerase II promoter in response to iron",
"id": "GO:0034395",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034395",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "angiogenesis",
"id": "GO:0001525",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001525",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "response to oxidative stress",
"id": "GO:0006979",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006979",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "response to nicotine",
"id": "GO:0035094",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035094",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "intracellular signal transduction",
"id": "GO:0035556",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035556",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "negative regulation of leukocyte migration",
"id": "GO:0002686",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002686",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "intracellular iron ion homeostasis",
"id": "GO:0006879",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006879",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "macroautophagy",
"id": "GO:0016236",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016236",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "positive regulation of chemokine production",
"id": "GO:0032722",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032722",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "cellular response to heat",
"id": "GO:0034605",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034605",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "positive regulation of angiogenesis",
"id": "GO:0045766",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045766",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "response to hydrogen peroxide",
"id": "GO:0042542",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042542",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "cellular response to hypoxia",
"id": "GO:0071456",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071456",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "positive regulation of canonical NF-kappaB signal transduction",
"id": "GO:0043123",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043123",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "positive regulation of smooth muscle cell proliferation",
"id": "GO:0048661",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048661",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "positive regulation of cell migration involved in sprouting angiogenesis",
"id": "GO:0090050",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090050",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "cellular response to cisplatin",
"id": "GO:0072719",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072719",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "positive regulation of macroautophagy",
"id": "GO:0016239",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016239",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "low-density lipoprotein particle clearance",
"id": "GO:0034383",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034383",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "negative regulation of smooth muscle cell proliferation",
"id": "GO:0048662",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048662",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "regulation of angiogenesis",
"id": "GO:0045765",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045765",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "endothelial cell proliferation",
"id": "GO:0001935",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001935",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "negative regulation of macroautophagy",
"id": "GO:0016242",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016242",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "cellular response to cadmium ion",
"id": "GO:0071276",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071276",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "heme catabolic process",
"id": "GO:0042167",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042167",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "erythrocyte homeostasis",
"id": "GO:0034101",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034101",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "negative regulation of extrinsic apoptotic signaling pathway via death domain receptors",
"id": "GO:1902042",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902042",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "regulation of transcription from RNA polymerase II promoter in response to oxidative stress",
"id": "GO:0043619",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043619",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "regulation of DNA-binding transcription factor activity",
"id": "GO:0051090",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051090",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "multicellular organismal-level iron ion homeostasis",
"id": "GO:0060586",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060586",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "cellular response to arsenic-containing substance",
"id": "GO:0071243",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071243",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "positive regulation of epithelial cell apoptotic process",
"id": "GO:1904037",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904037",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis",
"id": "GO:1903589",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903589",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "epithelial cell apoptotic process",
"id": "GO:1904019",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904019",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
}
]
},
{
"name": "Cellular Component",
"total": 9,
"go_terms": [
{
"name": "membrane",
"id": "GO:0016020",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "extracellular space",
"id": "GO:0005615",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "nucleus",
"id": "GO:0005634",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "nucleoplasm",
"id": "GO:0005654",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "mitochondrial outer membrane",
"id": "GO:0005741",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005741",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "endoplasmic reticulum",
"id": "GO:0005783",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "cytosol",
"id": "GO:0005829",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "perinuclear region of cytoplasm",
"id": "GO:0048471",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
},
{
"name": "endoplasmic reticulum membrane",
"id": "GO:0005789",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
}
],
"pmid": ""
}
]
}
]
},
"pro_annotation": [],
"site_annotation": [],
"ptm_annotation": [
{
"annotation": "A soluble form arises by proteolytic removal of the membrane anchor.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09601",
"url": "https://www.uniprot.org/uniprot/P09601"
},
{
"database": "PubMed",
"id": "7703255",
"url": "https://glygen.org/publication/PubMed/7703255"
}
]
}
],
"interactions": [],
"reactions": [
{
"id": "21764",
"name": "",
"equation": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P06762-1",
"O70453-1",
"P23711-1",
"P30519-1",
"P09601-1",
"O70252-1",
"P14901-1",
"Q9VGJ9-1"
],
"evidence": [
{
"id": "21764",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/21764"
}
]
},
{
"id": "R-HSA-1250272",
"name": "TXNIP binds NLRP3",
"equation": "",
"summary": "Thioredoxin-interacting protein (TXNIP) binds NLRP3. Reactive oxygen species (ROS) such as H2O2 increase this interaction, while the ROS inhibitor APDC blocks it (Zhou et al. 2010). This interaction is proposed to activate the NLRP3 inflammasome.
Heme oxygenase (HMOX1), besides its enzymatic activity of the dimeric membrane protein isoform, also occurs as soluble cytosolic protein. It is probably this form that binds to the NACHT domain of NLRP3, suppressing production of epithelial cell-derived cytokines induced by activation of the NLRP3 inflammasome, and protecting airway epithelium in asthma (Lv et al, 2018).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09601-1",
"Q96P20-1"
],
"evidence": [
{
"id": "R-HSA-1250272",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1250272"
}
]
},
{
"id": "R-HSA-189398",
"name": "HMOX1 dimer, HMOX2 cleave heme",
"equation": "",
"summary": "Heme oxygenases (HMOXs) cleaves the heme ring at the alpha-methene bridge to form bilverdin. This reaction forms the only endogenous source of carbon monoxide. HMOX1 is inducible and is thought to have an antioxidant role as it is activated in virtually all cell types and by many types of \\oxidative stress\\ (Poss & Tonegawa 1997). HMOX1 forms dimers/oligomers in the endoplasmatic reticulum. This oligomerization is crucial for the stabilization and function of HMOX1 in the ER (Hwang et al. 2009). HMOX2 is non-inducible.",
"cellular_location": "cytosol, endoplasmic reticulum membrane",
"input_participant_list": [
"R-ALL-71185"
],
"output_participant_list": [
"R-ALL-71067",
"R-ALL-189385"
],
"enzyme_list": [
"P09601-1",
"P30519-1"
],
"evidence": [
{
"id": "R-HSA-189398",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189398"
}
]
},
{
"id": "R-HSA-6797268",
"name": "Expression of HMOX1",
"equation": "",
"summary": "In human peripheral blood monocytes Interleukin-4 (IL4) and IL13 significantly upregulate the levels of proteins involved in inflammatory resolution, including the ER membrane protein 15-lipoxygenase (ALOX15) (Chaitidis et al. 2005).",
"cellular_location": "endoplasmic reticulum membrane, nucleoplasm",
"input_participant_list": [
"R-HSA-6789487"
],
"output_participant_list": [
"R-HSA-189395"
],
"enzyme_list": [
"P09601-1"
],
"evidence": [
{
"id": "R-HSA-6797268",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6797268"
}
]
},
{
"id": "R-HSA-9609860",
"name": "Tail-anchored protein:SGTA:BAG6:GET4:UBL4A:ASNA1:ATP dissociates and ASNA1 hydrolyzes ATP yielding Tail-anchored protein:ASNA1:ADP",
"equation": "",
"summary": "A properly folded tail-anchored (TA) protein is transferred from SGTA to ASNA1 via the BAG6 complex (BAG6:UBL4A:GET4 also known at BAT3:GET5:TRC35) (Marriapan et al. 2010, Leznicki et al. 2011, Mock et al. 2015, Shao et al. 2017, Guna et al. 2018). The TA protein bound to ASNA1 is then presumed to dissociate from the BAG6 complex (inferred from yeast homologs). At some point during or shortly after dissociation, ASNA1 hydrolyzes bound ATP to yield ADP (inferred from yeast homologs).
Improperly folded proteins and improperly localized hydrophobic proteins are transferred from SGTA to BAG6 rather than to ASNA1 (Shao et al. 2017). BAG6 then recruits RNF126 and facilitates the ubiquitination and consequent degradation of the defective protein. The selection of transferring a substrate protein from SGTA to ASNA1 or to BAG6 thereby acts as a \\molecular triage\\. Proteins with less hydrophobic tail-anchors appear to be inserted into the endoplasmic reticulum membrane by a separate system comprising calmodulin and the ER membrane protein complex (Guna et al. 2018).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09601-1",
"O43681-1"
],
"evidence": [
{
"id": "R-HSA-9609860",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609860"
}
]
},
{
"id": "R-HSA-9609899",
"name": "Tail-anchored protein:ASNA1:ADP binds WRB:CAMLG at the endoplasmic reticulum membrane",
"equation": "",
"summary": "A tail-anchored protein bound to ASNA1 dimer (TRC40 dimer) in the cytosol (Stefanovic and Hegde 2007, Favaloro et al. 2008, Favaloro et al. 2010) docks at the WRB:CAMLG complex located in the endoplasmic reticulum membrane (Vilardi et al. 2011, Yamamoto and Sakisaka 2012, Vilardi et al. 2014, Colombo et al. 2016, Pfaff et al. 2016, Vogl et al. 2016). The cytoplasmic coiled coil domain of WRB and the cytoplasmic N-terminal domain of CAMLG compete for binding to ASNA1 (Vilardi et al. 2011, Yamamoto and Sakisaka 2012). As inferred from yeast homologs, ASNA1 hydrolyzes bound ATP at some point, resulting in a change of conformation of ASNA1. This may transfer the tail-anchored protein to WRB:CAMLG, which functions as an insertase.",
"cellular_location": "endoplasmic reticulum membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09601-1",
"O43681-1"
],
"evidence": [
{
"id": "R-HSA-9609899",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609899"
}
]
},
{
"id": "R-HSA-9609917",
"name": "Tail-anchored protein:ASNA1:ADP:WRB:CAMLG dissociates yielding Tail-anchored protein in the endoplasmic reticulum membrane",
"equation": "",
"summary": "A tail-anchored protein bound to ASNA1 (TRC40) (Stefanovic and Hegde 2007, Favaloro et al. 2008, Favaloro et al. 2010) docked at the WRB:CAMLG complex (also known as the WRB:CAML complex) located in the endoplasmic reticulum membrane is released into the ER membrane in an incompletely characterized reaction (Vilardi et al. 2011, Yamamoto and Sakisaka 2012, Vilardi et al. 2014, Colombo et al. 2016, Pfaff et al. 2016, Vogl et al. 2016). Experiments with yeast homologs (GET1 is the homologue of WRB and GET2 is the homologue of CAMLG) indicate that docking of ASNA1:ADP with WRB:CAMLG results in a conformational change in ASNA1 that causes release of the tail-anchored protein to WRB:CAMLG and then into the membrane (inferred from yeast homologs), ADP dissociates from ASNA1 at some point during the reaction. Exchange of ADP for ATP by ASNA1 then recycles ASNA1 back into the cytosol (inferred from yeast homologs).",
"cellular_location": "endoplasmic reticulum membrane",
"input_participant_list": [
"R-HSA-9609912"
],
"output_participant_list": [],
"enzyme_list": [
"P09601-1",
"O43681-1"
],
"evidence": [
{
"id": "R-HSA-9609917",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609917"
}
]
},
{
"id": "R-HSA-9609921",
"name": "SGTA binds Tail-anchored protein",
"equation": "",
"summary": "The C-terminal domains of a SGTA dimer bind the C-terminal hydrophobic transmembrane domain (TMD) of a tail-anchored (TA) protein shortly after it emerges from the ribosome (Liou and Wang 2005, Leznicki et al. 2011, Wunderley et al. 2014, Shao et al. 2017). Binding of SGTA shields the TMD of the TA protein and stabilizes the TA protein by preventing it from being targeted for degradation (Leznicki and High 2012).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09601-1"
],
"evidence": [
{
"id": "R-HSA-9609921",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609921"
}
]
},
{
"id": "R-HSA-9610442",
"name": "Tail-anchored protein:SGTA dimer binds BAG6:GET4:UBL4A and ASNA1:ATP",
"equation": "",
"summary": "A SGTA dimer bound to a tail-anchored (TA) protein binds the BAG6 complex (BAG6:GET4:UBL4A) via UBL4A (Winnefeld et al. 2006, Chartron et al. 2012, Xu et al. 2012, Leznicki et al. 2013, Darby et al. 2014, Kuwabara et al. 2015, Mock et al. 2015, Shao et al. 2017, also inferred from rabbit homologs in Mariappan et al. 2010). At some point, ASNA1 (TRC40) also binds the complex (Shao et al. 2017). SGTA interacts with the ubiquitin-like domain (UBL) of BAG6 and the UBL of UBL4A competes with BAG6 for binding to SGTA (Chartron et al. 2012, Xu et al. 2012, Leznicki et al. 2013, Darby et al. 2014, Shao et al. 2017).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09601-1",
"O43681-1"
],
"evidence": [
{
"id": "R-HSA-9610442",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9610442"
}
]
},
{
"id": "R-HSA-9707645",
"name": "HMOX1 gene produces HMOX1 dimer",
"equation": "",
"summary": "Transcription regulator protein BACH1 is a critical physiological repressor of heme oxygenase 1 (HMOX1). BACH1 binds to the multiple Maf recognition elements (MAREs) of HMOX1 enhancer MafK in vitro and represses its activity in vivo. BACH1 is inducible by hypoxia and IFN-gamma (Kitamuro et al, 2003; Sun et al, 2002).
NFE2L2 (nuclear factor erythroid 2-related factor 2) is a transcription factor that activates transcription of a battery of cytoprotective genes by binding to the ARE (antioxidant response element). It is considered not only as a cytoprotective factor regulating the expression of genes coding for anti-oxidant, anti-inflammatory and detoxifying proteins, but it is also a powerful modulator of species longevity. HMOX1 is one of the genes whose expression it activates (Huang et al, 2000; Reichard et al, 2007).",
"cellular_location": "endoplasmic reticulum membrane, nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09601-1"
],
"evidence": [
{
"id": "R-HSA-9707645",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707645"
}
]
},
{
"id": "R-HSA-9708457",
"name": "HM13 cleaves HMOX1 dimer",
"equation": "",
"summary": "Cleavage of heme oxygenase 1 (HMOX1) by HM13 (Signal peptide peptidase) takes place in the ER membrane and removes the membrane domain from HMOX1, making it soluble in the cytosol. The reaction only occurs under conditions of hypoxia (Schaefer et al, 2017; Boname et al, 2014).",
"cellular_location": "cytosol, endoplasmic reticulum membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q8TCT9-1",
"P09601-1"
],
"evidence": [
{
"id": "R-HSA-9708457",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9708457"
}
]
},
{
"id": "R-HSA-9708536",
"name": "HMOX1 translocates from the cytosol to the nucleoplasm",
"equation": "",
"summary": "After exposure to hypoxia and heme or heme/hemopexin, soluble heme oxygenase 1 (HMOX1) is detected in the nucleus. Nuclear localization is also associated with reduction of HMOX1 activity. HMOX1 protein, whether it s enzymatically active or not, mediates activation of oxidant-responsive transcription factors, including activator protein-1 (AP-1). Nevertheless, nuclear HMOX1 protects cells against hydrogen peroxide-mediated injury equally as well as cytoplasmic HMOX1 (Lin et al, 2007).",
"cellular_location": "cytosol, nucleoplasm",
"input_participant_list": [
"R-HSA-9609901"
],
"output_participant_list": [
"R-HSA-9708567"
],
"enzyme_list": [
"P09601-1"
],
"evidence": [
{
"id": "R-HSA-9708536",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9708536"
}
]
},
{
"id": "R-HSA-9708558",
"name": "HMOX1 dimer translocates from ER membrane to mitochondrial outer membrane",
"equation": "",
"summary": "Heme oxygenase 1 (HMOX1) expression increases dramatically in cytosolic and mitochondrial fractions of human alveolar (A549), or bronchial epithelial cells (Beas-2b) exposed to either heme, lipopolysaccharide, or cigarette smoke extract (CSE). Mitochondrial localization of HMOX1 is also observed in a primary culture of human small airway epithelial cells (Siebos et al, 2007).",
"cellular_location": "cytosol, mitochondrion",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09601-1"
],
"evidence": [
{
"id": "R-HSA-9708558",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9708558"
}
]
},
{
"id": "R-HSA-9709918",
"name": "PTK6 phosphorylates STAT3",
"equation": "",
"summary": "In humans, activated PTK6 (BRK) phosphorylates STAT3 on tyrosine residue Y705. PTK6-mediated phosphorylation of STAT3 is promoted by STAP2 and inhibited by SOCS3 (Liu et al. 2006, Ikeda et al. 2010).
In mouse, Ptk6-mediated phosphorylation of Stat3 is promoted by Stap2 and inhibited by Socs3. Heme oxygenase-1 (Hmox1) binds to tyrosine-705 and three domains on Stat3 (DNA-binding, linker, and transactivation domains), directly regulating Stat3 activation. Additionally it co-inhibits Socs3, a negative feedback factor of Stat3 activation, as well as ROR\u03b3t, thereby decreasing Th2 and Th17 immune responses, and alleviating airway inflammation (Lin et al, 2020; Lin et al, 2017).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q13882-1",
"P09601-1"
],
"evidence": [
{
"id": "R-HSA-9709918",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9709918"
}
]
},
{
"id": "R-HSA-9759176",
"name": "NFE2L2-dependent HMOX1 gene expression",
"equation": "",
"summary": "NFE2L2 (nuclear factor erythroid 2-related factor 2) is a transcription factor that activates transcription of a battery of cytoprotective genes by binding to the ARE (antioxidant response element). It is considered not only as a cytoprotective factor regulating the expression of genes coding for anti-oxidant, anti-inflammatory and detoxifying proteins, but it is also a powerful modulator of species longevity. HMOX1 is one of the genes whose expression it activates (Reichard et al, 2007; Ishii et al, 2002; reviewed in Baird and Yamamoto, 2020).",
"cellular_location": "endoplasmic reticulum membrane, nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09601-1"
],
"evidence": [
{
"id": "R-HSA-9759176",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9759176"
}
]
}
],
"reaction_participants": [
{
"participant_id": "R-ALL-189385",
"participant_name": "CO [cytosol]",
"crossref": [
{
"id": "C00237",
"database": "COMPOUND",
"url": ""
},
{
"id": "17245",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0001361",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "9531",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "17245",
"database": "ChEBI",
"url": ""
},
{
"id": "9531",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "HMDB0001361",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "C00237",
"database": "COMPOUND",
"url": ""
},
{
"id": "17245",
"database": "ChEBI",
"url": ""
},
{
"id": "9531",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "HMDB0001361",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "C00237",
"database": "COMPOUND",
"url": ""
},
{
"id": "C00237",
"database": "COMPOUND",
"url": ""
},
{
"id": "17245",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0001361",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "9531",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "C00237",
"database": "COMPOUND",
"url": ""
},
{
"id": "17245",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0001361",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "9531",
"database": "Guide to Pharmacology - Ligands",
"url": ""
}
]
},
{
"participant_id": "R-ALL-71067",
"participant_name": "Fe2+ [cytosol]",
"crossref": [
{
"id": "C00023",
"database": "COMPOUND",
"url": ""
},
{
"id": "29033",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0000692",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "C14818",
"database": "COMPOUND",
"url": ""
},
{
"id": "FE+2",
"database": "AraCyc",
"url": ""
},
{
"id": "27284",
"database": "PubChem Compound",
"url": ""
},
{
"id": "C14818",
"database": "KEGG Gene",
"url": ""
},
{
"id": "29033",
"database": "ChEBI",
"url": ""
},
{
"id": "27284",
"database": "PubChem Compound",
"url": ""
},
{
"id": "C14818",
"database": "COMPOUND",
"url": ""
},
{
"id": "C00023",
"database": "COMPOUND",
"url": ""
},
{
"id": "HMDB0000692",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "C14818",
"database": "KEGG Gene",
"url": ""
},
{
"id": "FE+2",
"database": "AraCyc",
"url": ""
},
{
"id": "C00023",
"database": "COMPOUND",
"url": ""
},
{
"id": "29033",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0000692",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "C14818",
"database": "COMPOUND",
"url": ""
},
{
"id": "FE+2",
"database": "AraCyc",
"url": ""
},
{
"id": "27284",
"database": "PubChem Compound",
"url": ""
},
{
"id": "C14818",
"database": "KEGG Gene",
"url": ""
},
{
"id": "C14818",
"database": "COMPOUND",
"url": ""
},
{
"id": "29033",
"database": "ChEBI",
"url": ""
},
{
"id": "27284",
"database": "PubChem Compound",
"url": ""
},
{
"id": "C14818",
"database": "KEGG Gene",
"url": ""
},
{
"id": "FE+2",
"database": "AraCyc",
"url": ""
},
{
"id": "C00023",
"database": "COMPOUND",
"url": ""
},
{
"id": "HMDB0000692",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "C00023",
"database": "COMPOUND",
"url": ""
},
{
"id": "29033",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0000692",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "C14818",
"database": "COMPOUND",
"url": ""
},
{
"id": "FE+2",
"database": "AraCyc",
"url": ""
},
{
"id": "27284",
"database": "PubChem Compound",
"url": ""
},
{
"id": "C14818",
"database": "KEGG Gene",
"url": ""
},
{
"id": "C00023",
"database": "COMPOUND",
"url": ""
},
{
"id": "29033",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0000692",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "C14818",
"database": "COMPOUND",
"url": ""
},
{
"id": "FE+2",
"database": "AraCyc",
"url": ""
},
{
"id": "27284",
"database": "PubChem Compound",
"url": ""
},
{
"id": "C14818",
"database": "KEGG Gene",
"url": ""
}
]
},
{
"participant_id": "R-ALL-71185",
"participant_name": "heme [cytosol]",
"crossref": [
{
"id": "C00032",
"database": "COMPOUND",
"url": ""
},
{
"id": "17627",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0003178",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "8145503",
"database": "PubChem Substance",
"url": ""
},
{
"id": "C00032",
"database": "COMPOUND",
"url": ""
},
{
"id": "17627",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0003178",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "8145503",
"database": "PubChem Substance",
"url": ""
},
{
"id": "C00032",
"database": "COMPOUND",
"url": ""
},
{
"id": "17627",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0003178",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "8145503",
"database": "PubChem Substance",
"url": ""
},
{
"id": "C00032",
"database": "COMPOUND",
"url": ""
},
{
"id": "17627",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0003178",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "8145503",
"database": "PubChem Substance",
"url": ""
},
{
"id": "C00032",
"database": "COMPOUND",
"url": ""
},
{
"id": "17627",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0003178",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "8145503",
"database": "PubChem Substance",
"url": ""
},
{
"id": "C00032",
"database": "COMPOUND",
"url": ""
},
{
"id": "17627",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0003178",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "8145503",
"database": "PubChem Substance",
"url": ""
},
{
"id": "C00032",
"database": "COMPOUND",
"url": ""
},
{
"id": "17627",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0003178",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "8145503",
"database": "PubChem Substance",
"url": ""
}
]
},
{
"participant_id": "R-HSA-189395",
"participant_name": "HMOX1 [endoplasmic reticulum membrane]",
"crossref": [
{
"id": "1S8C",
"database": "PDB",
"url": ""
},
{
"id": "1OZL",
"database": "PDB",
"url": ""
},
{
"id": "1N3U",
"database": "PDB",
"url": ""
},
{
"id": "P09601",
"database": "ZINC target",
"url": ""
},
{
"id": "3TGM",
"database": "PDB",
"url": ""
},
{
"id": "1OZW",
"database": "PDB",
"url": ""
},
{
"id": "1OYK",
"database": "PDB",
"url": ""
},
{
"id": "1NI6",
"database": "PDB",
"url": ""
},
{
"id": "1OZE",
"database": "PDB",
"url": ""
},
{
"id": "1XK3",
"database": "PDB",
"url": ""
},
{
"id": "HMDBP00198",
"database": "HMDB Protein",
"url": ""
},
{
"id": "NP_002124.1",
"database": "RefSeq",
"url": ""
},
{
"id": "ENSG00000100292",
"database": "Ensembl",
"url": ""
},
{
"id": "6EHA",
"database": "PDB",
"url": ""
},
{
"id": "3K4F",
"database": "PDB",
"url": ""
},
{
"id": "P09601",
"database": "PRO",
"url": ""
},
{
"id": "ENSG00000100292",
"database": "OpenTargets",
"url": ""
},
{
"id": "24601",
"database": "Orphanet",
"url": ""
},
{
"id": "4WD4",
"database": "PDB",
"url": ""
},
{
"id": "1OYL",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000216117",
"database": "Ensembl",
"url": ""
},
{
"id": "HMOX1_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "1T5P",
"database": "PDB",
"url": ""
},
{
"id": "P09601",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "ENSP00000216117",
"database": "Ensembl",
"url": ""
},
{
"id": "1N45",
"database": "PDB",
"url": ""
},
{
"id": "1S13",
"database": "PDB",
"url": ""
},
{
"id": "3CZY",
"database": "PDB",
"url": ""
},
{
"id": "1XK0",
"database": "PDB",
"url": ""
},
{
"id": "1441",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "1TWN",
"database": "PDB",
"url": ""
},
{
"id": "P09601",
"database": "UniProt",
"url": ""
},
{
"id": "P09601",
"database": "GeneCards",
"url": ""
},
{
"id": "1XJZ",
"database": "PDB",
"url": ""
},
{
"id": "1OZR",
"database": "PDB",
"url": ""
},
{
"id": "3HOK",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000100292-HMOX1",
"database": "HPA",
"url": ""
},
{
"id": "5BTQ",
"database": "PDB",
"url": ""
},
{
"id": "HMOX1_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "1XK2",
"database": "PDB",
"url": ""
},
{
"id": "1XK1",
"database": "PDB",
"url": ""
},
{
"id": "1TWR",
"database": "PDB",
"url": ""
}
]
},
{
"participant_id": "R-HSA-6789487",
"participant_name": "HMOX1 gene [nucleoplasm]",
"crossref": [
{
"id": "ENSG00000100292",
"database": "ENSEMBL",
"url": ""
}
]
},
{
"participant_id": "R-HSA-9609901",
"participant_name": "HMOX1 [cytosol]",
"crossref": [
{
"id": "P09601",
"database": "UniProt",
"url": ""
},
{
"id": "HMDBP00198",
"database": "HMDB Protein",
"url": ""
},
{
"id": "1S13",
"database": "PDB",
"url": ""
},
{
"id": "1N3U",
"database": "PDB",
"url": ""
},
{
"id": "1XK2",
"database": "PDB",
"url": ""
},
{
"id": "4WD4",
"database": "PDB",
"url": ""
},
{
"id": "P09601",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "1OZE",
"database": "PDB",
"url": ""
},
{
"id": "1XJZ",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000100292",
"database": "Ensembl",
"url": ""
},
{
"id": "1XK0",
"database": "PDB",
"url": ""
},
{
"id": "1OZL",
"database": "PDB",
"url": ""
},
{
"id": "5BTQ",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000100292",
"database": "OpenTargets",
"url": ""
},
{
"id": "HMOX1_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "1OYK",
"database": "PDB",
"url": ""
},
{
"id": "3HOK",
"database": "PDB",
"url": ""
},
{
"id": "3K4F",
"database": "PDB",
"url": ""
},
{
"id": "1TWN",
"database": "PDB",
"url": ""
},
{
"id": "3TGM",
"database": "PDB",
"url": ""
},
{
"id": "1TWR",
"database": "PDB",
"url": ""
},
{
"id": "1OYL",
"database": "PDB",
"url": ""
},
{
"id": "1N45",
"database": "PDB",
"url": ""
},
{
"id": "1XK3",
"database": "PDB",
"url": ""
},
{
"id": "P09601",
"database": "GeneCards",
"url": ""
},
{
"id": "NP_002124.1",
"database": "RefSeq",
"url": ""
},
{
"id": "3CZY",
"database": "PDB",
"url": ""
},
{
"id": "1S8C",
"database": "PDB",
"url": ""
},
{
"id": "HMOX1_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "24601",
"database": "Orphanet",
"url": ""
},
{
"id": "1T5P",
"database": "PDB",
"url": ""
},
{
"id": "1NI6",
"database": "PDB",
"url": ""
},
{
"id": "1OZR",
"database": "PDB",
"url": ""
},
{
"id": "6EHA",
"database": "PDB",
"url": ""
},
{
"id": "1441",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "P09601",
"database": "ZINC target",
"url": ""
},
{
"id": "1XK1",
"database": "PDB",
"url": ""
},
{
"id": "P09601",
"database": "PRO",
"url": ""
},
{
"id": "ENSP00000216117",
"database": "Ensembl",
"url": ""
},
{
"id": "1OZW",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000100292-HMOX1",
"database": "HPA",
"url": ""
},
{
"id": "ENST00000216117",
"database": "Ensembl",
"url": ""
}
]
},
{
"participant_id": "R-HSA-9609912",
"participant_name": "Tail-anchored protein:ASNA1:ADP:WRB:CAMLG [endoplasmic reticulum membrane]",
"crossref": [
{
"id": "CPX-6464",
"database": "ComplexPortal",
"url": ""
}
]
},
{
"participant_id": "R-HSA-9708567",
"participant_name": "HMOX1 [nucleoplasm]",
"crossref": [
{
"id": "1NI6",
"database": "PDB",
"url": ""
},
{
"id": "1OYK",
"database": "PDB",
"url": ""
},
{
"id": "1OZE",
"database": "PDB",
"url": ""
},
{
"id": "1OZW",
"database": "PDB",
"url": ""
},
{
"id": "1XK3",
"database": "PDB",
"url": ""
},
{
"id": "1N3U",
"database": "PDB",
"url": ""
},
{
"id": "1S8C",
"database": "PDB",
"url": ""
},
{
"id": "1OZL",
"database": "PDB",
"url": ""
},
{
"id": "P09601",
"database": "ZINC target",
"url": ""
},
{
"id": "3TGM",
"database": "PDB",
"url": ""
},
{
"id": "HMDBP00198",
"database": "HMDB Protein",
"url": ""
},
{
"id": "24601",
"database": "Orphanet",
"url": ""
},
{
"id": "ENSG00000100292",
"database": "OpenTargets",
"url": ""
},
{
"id": "P09601",
"database": "PRO",
"url": ""
},
{
"id": "4WD4",
"database": "PDB",
"url": ""
},
{
"id": "1OYL",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000216117",
"database": "Ensembl",
"url": ""
},
{
"id": "3K4F",
"database": "PDB",
"url": ""
},
{
"id": "6EHA",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000100292",
"database": "Ensembl",
"url": ""
},
{
"id": "NP_002124.1",
"database": "RefSeq",
"url": ""
},
{
"id": "P09601",
"database": "UniProt",
"url": ""
},
{
"id": "P09601",
"database": "GeneCards",
"url": ""
},
{
"id": "1XJZ",
"database": "PDB",
"url": ""
},
{
"id": "1OZR",
"database": "PDB",
"url": ""
},
{
"id": "3HOK",
"database": "PDB",
"url": ""
},
{
"id": "1XK1",
"database": "PDB",
"url": ""
},
{
"id": "5BTQ",
"database": "PDB",
"url": ""
},
{
"id": "HMOX1_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "1XK2",
"database": "PDB",
"url": ""
},
{
"id": "1TWR",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000100292-HMOX1",
"database": "HPA",
"url": ""
},
{
"id": "HMOX1_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "1T5P",
"database": "PDB",
"url": ""
},
{
"id": "P09601",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "ENSP00000216117",
"database": "Ensembl",
"url": ""
},
{
"id": "1N45",
"database": "PDB",
"url": ""
},
{
"id": "1S13",
"database": "PDB",
"url": ""
},
{
"id": "1TWN",
"database": "PDB",
"url": ""
},
{
"id": "1441",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "3CZY",
"database": "PDB",
"url": ""
},
{
"id": "1XK0",
"database": "PDB",
"url": ""
}
]
}
],
"reaction_enzymes": [
{
"uniprot_ac": "O43681",
"gene_name": "GET3",
"activity": [
{
"ec_number": "3.6.-.-",
"activity": "",
"evidence": [
{
"id": "O43681",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43681"
}
]
}
]
},
{
"uniprot_ac": "O70252",
"gene_name": "Hmox2",
"activity": [
{
"ec_number": "1.14.14.18",
"activity": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "O70252",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O70252"
}
]
},
{
"ec_number": "1.14.14.18",
"activity": "",
"evidence": [
{
"id": "O70252",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O70252"
}
]
}
]
},
{
"uniprot_ac": "O70453",
"gene_name": "Hmox3",
"activity": [
{
"ec_number": "1.14.14.18",
"activity": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "O70453",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O70453"
}
]
},
{
"ec_number": "1.14.14.18",
"activity": "",
"evidence": [
{
"id": "O70453",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O70453"
}
]
}
]
},
{
"uniprot_ac": "P06762",
"gene_name": "Hmox1",
"activity": [
{
"ec_number": "1.14.14.18",
"activity": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P06762",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06762"
}
]
},
{
"ec_number": "1.14.14.18",
"activity": "",
"evidence": [
{
"id": "P06762",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06762"
}
]
}
]
},
{
"uniprot_ac": "P09601",
"gene_name": "HMOX1",
"activity": [
{
"ec_number": "1.14.14.18",
"activity": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P09601",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09601"
}
]
},
{
"ec_number": "1.14.14.18",
"activity": "",
"evidence": [
{
"id": "P09601",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09601"
}
]
}
]
},
{
"uniprot_ac": "P14901",
"gene_name": "Hmox1",
"activity": [
{
"ec_number": "1.14.14.18",
"activity": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P14901",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14901"
}
]
},
{
"ec_number": "1.14.14.18",
"activity": "",
"evidence": [
{
"id": "P14901",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14901"
}
]
}
]
},
{
"uniprot_ac": "P23711",
"gene_name": "Hmox2",
"activity": [
{
"ec_number": "1.14.14.18",
"activity": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P23711",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P23711"
}
]
},
{
"ec_number": "1.14.14.18",
"activity": "",
"evidence": [
{
"id": "P23711",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P23711"
}
]
}
]
},
{
"uniprot_ac": "P30519",
"gene_name": "HMOX2",
"activity": [
{
"ec_number": "1.14.14.18",
"activity": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P30519",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30519"
}
]
},
{
"ec_number": "1.14.14.18",
"activity": "",
"evidence": [
{
"id": "P30519",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30519"
}
]
}
]
},
{
"uniprot_ac": "Q13882",
"gene_name": "PTK6",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "Q13882",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13882"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "Q13882",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13882"
}
]
}
]
},
{
"uniprot_ac": "Q8TCT9",
"gene_name": "HM13",
"activity": [
{
"ec_number": "3.4.23.-",
"activity": "",
"evidence": [
{
"id": "Q8TCT9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8TCT9"
}
]
}
]
},
{
"uniprot_ac": "Q96P20",
"gene_name": "NLRP3",
"activity": [
{
"ec_number": "3.6.4.-",
"activity": "",
"evidence": [
{
"id": "Q96P20",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96P20"
}
]
}
]
},
{
"uniprot_ac": "Q9VGJ9",
"gene_name": "Ho",
"activity": [
{
"ec_number": "1.14.14.18",
"activity": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q9VGJ9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VGJ9"
}
]
},
{
"ec_number": "1.14.14.18",
"activity": "",
"evidence": [
{
"id": "Q9VGJ9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VGJ9"
}
]
}
]
}
],
"biomarkers": [],
"synthesized_glycans": [],
"cluster_types": [
{
"name": "isoformset.uniprotkb",
"label": "Isoforms"
},
{
"name": "homologset.mgi",
"label": "MGI Homologs"
},
{
"name": "homologset.oma",
"label": "OMA Homologs"
}
],
"sequence_features": {
"n_linked_sites": [],
"o_linked_sites": [],
"snv_sites": [],
"glycation_sites": [],
"phosphorylation_sites": [
137,
188,
229,
231
],
"sequon_annotation_sites": []
},
"section_stats": [
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 1
},
{
"field": "total_sites",
"count": 1
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 1
},
{
"field": "o_linked_glycan_sites",
"count": 1
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment"
]
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 1
},
{
"field": "total_sites",
"count": 1
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 1
},
{
"field": "o_linked_glycan_sites",
"count": 1
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment"
]
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 5
},
{
"field": "total_sites",
"count": 4
}
],
"sort_fields": [
"start_pos",
"end_pos",
"kinase_uniprot_canonical_ac",
"kinase_gene_name",
"residue",
"comment",
"site_lbl"
]
},
{
"table_id": "snv",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv_non_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "publication",
"table_stats": [
{
"field": "total",
"count": 270
}
],
"sort_fields": [
"title",
"journal",
"date",
"authors"
]
}
]
}