{
    "uniprot_canonical_ac": "P09565-1",
    "uniprot_ac": "P09565",
    "uniprot_id": "IG2R_HUMAN",
    "mass": {
        "chemical_mass": 12087.0,
        "monoisotopic_mass": 12087.0
    },
    "refseq": {},
    "gene_names": [
        {
            "name": "GIG44",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/P09565",
            "id": "P09565"
        },
        {
            "name": "PP9974",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/P09565",
            "id": "P09565"
        }
    ],
    "protein_names": [
        {
            "name": "Putative insulin-like growth factor 2-associated protein",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "P09565"
        },
        {
            "name": "Cell growth-inhibiting gene 44 protein",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P09565"
        },
        {
            "name": "Insulin-like growth factor II-associated protein",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P09565"
        }
    ],
    "function": [],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Homo sapiens",
            "taxid": 9606,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P09565",
                    "url": "https://www.uniprot.org/uniprot/P09565"
                }
            ],
            "common_name": "Human"
        }
    ],
    "gene": [
        {
            "name": "",
            "url": "https://www.uniprot.org/uniprot/P09565",
            "locus": {}
        }
    ],
    "crossref": [
        {
            "id": "P09565",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:P09565*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "NX_P09565",
            "url": "https://www.nextprot.org/entry/NX_P09565",
            "database": "neXtProt",
            "categories": [
                "Protein",
                "Organism-specific"
            ]
        },
        {
            "id": "P09565",
            "url": "https://pharos.nih.gov/targets/P09565",
            "database": "PHAROS",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "P09565",
            "url": "https://www.uniprot.org/uniprot/P09565",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P09565-1",
            "url": "https://www.uniprot.org/uniprot/P09565-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MTPGVVHASPPQSQRVPRQAPCEWAIRNIGQKPKEPNCHNCGTHIGLRSKTLRGTPNYLPIRQDTHPPSVIFCLAGVGVPGGTCRPAPCVPRFAALPWATNHPGPGCLSDLRA",
        "length": 113,
        "header": "sp|P09565-1|IG2R_HUMAN Isoform 1 of Putative insulin-like growth factor 2-associated protein  OS=Homo sapiens OX=9606 GN= PE=1 SV=2 CANONICAL=P09565-1"
    },
    "isoforms": [
        {
            "isoform_ac": "P09565-1",
            "url": "",
            "sequence": {
                "sequence": "MTPGVVHASPPQSQRVPRQAPCEWAIRNIGQKPKEPNCHNCGTHIGLRSKTLRGTPNYLPIRQDTHPPSVIFCLAGVGVPGGTCRPAPCVPRFAALPWATNHPGPGCLSDLRA",
                "length": 113,
                "header": "sp|P09565-1|IG2R_HUMAN Isoform 1 of Putative insulin-like growth factor 2-associated protein  OS=Homo sapiens OX=9606 GN= PE=1 SV=2 CANONICAL=P09565-1"
            },
            "locus": {}
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Large-scale cDNA transfection screening for genes related to cancer development and progression.",
            "journal": "Proc. Natl. Acad. Sci. U.S.A.",
            "date": "2004",
            "authors": "Wan D, Gong Y, Qin W, Zhang P, Li J, Wei L, Zhou X, Li H, Qiu X, Zhong F, He L, Yu J, Yao G, Jiang H, Qian L, Yu Y, Shu H, Chen X, Xu H, Guo M, Pan Z, Chen Y, Ge C, Yang S, Gu J",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P09565",
                    "url": "https://www.uniprot.org/uniprot/P09565"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15498874",
                    "url": "https://glygen.org/publication/PubMed/15498874"
                }
            ]
        },
        {
            "title": "Differential expression of the human insulin-like growth factor II gene. Characterization of the IGF-II mRNAs and an mRNA encoding a putative IGF-II-associated protein.",
            "journal": "Biochim. Biophys. Acta",
            "date": "1988",
            "authors": "de Pagter-Holthuizen P, Jansen M, van der Kammen R A, van Schaik F M, Sussenbach J S",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P09565",
                    "url": "https://www.uniprot.org/uniprot/P09565"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "3167054",
                    "url": "https://glygen.org/publication/PubMed/3167054"
                }
            ]
        }
    ],
    "pathway": [],
    "orthologs": [],
    "go_annotation": {},
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [],
    "sequence_features": {
        "n_linked_sites": [],
        "o_linked_sites": [],
        "snv_sites": [],
        "glycation_sites": [],
        "phosphorylation_sites": [],
        "sequon_annotation_sites": []
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 2
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}