{ "uniprot_canonical_ac": "P09486-1", "uniprot_ac": "P09486", "uniprot_id": "SPRC_HUMAN", "mass": { "chemical_mass": 34632.0, "monoisotopic_mass": 34632.0 }, "refseq": { "ac": "NP_001296372", "name": "SPARC isoform 2 precursor", "summary": "This gene encodes a cysteine-rich acidic matrix-associated protein. The encoded protein is required for the collagen in bone to become calcified but is also involved in extracellular matrix synthesis and promotion of changes to cell shape. The gene product has been associated with tumor suppression but has also been correlated with metastasis based on changes to cell shape which can promote tumor cell invasion. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2015].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001296372" }, "gene_names": [ { "name": "SPARC", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P09486", "id": "P09486" }, { "name": "BM-40; OI17; ON; ONT", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001296372", "id": "NP_001296372" }, { "name": "ON", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P09486", "id": "P09486" }, { "name": "SPARC", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001296372", "id": "NP_001296372" } ], "protein_names": [ { "name": "SPARC", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P09486" }, { "name": "BM-40", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P09486" }, { "name": "Basement-membrane protein 40", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P09486" }, { "name": "ON", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P09486" }, { "name": "Osteonectin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P09486" }, { "name": "SPARC isoform 2 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001296372", "id": "NP_001296372" }, { "name": "Secreted protein acidic and rich in cysteine", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P09486" }, { "name": "basement-membrane protein 40; secreted protein, acidic, cysteine-rich (osteonectin)", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001296372", "id": "NP_001296372" } ], "function": [ { "annotation": "Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity.", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486#function" } ] }, { "annotation": "Hepatic SPARC Expression Is Associated with Inflammasome Activation during the Progression of Non-Alcoholic Fatty Liver Disease in Both Mice and Morbidly Obese Patients. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001296372", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001296372" }, { "database": "PubMed", "id": "37834291", "url": "https://glygen.org/publication/PubMed/37834291" } ] }, { "annotation": "Novel pathogenic variants in SPARC as cause of osteogenesis imperfecta: Two case reports.", "evidence": [ { "database": "RefSeq", "id": "NP_001296372", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001296372" }, { "database": "PubMed", "id": "37758164", "url": "https://glygen.org/publication/PubMed/37758164" } ] }, { "annotation": "Peritumoral SPARC expression induced by exosomes from nasopharyngeal carcinoma infected Epstein-Barr virus: A poor prognostic marker.", "evidence": [ { "database": "RefSeq", "id": "NP_001296372", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001296372" }, { "database": "PubMed", "id": "37907830", "url": "https://glygen.org/publication/PubMed/37907830" } ] }, { "annotation": "Serum CRP interacts with SPARC and regulate immune response in severe cases of COVID-19 infection. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001296372", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001296372" }, { "database": "PubMed", "id": "38077346", "url": "https://glygen.org/publication/PubMed/38077346" } ] }, { "annotation": "The association of SPARC with hypertension and its function in endothelial-dependent relaxation.", "evidence": [ { "database": "RefSeq", "id": "NP_001296372", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001296372" }, { "database": "PubMed", "id": "38048752", "url": "https://glygen.org/publication/PubMed/38048752" } ] }, { "annotation": "This gene encodes a cysteine-rich acidic matrix-associated protein. The encoded protein is required for the collagen in bone to become calcified but is also involved in extracellular matrix synthesis and promotion of changes to cell shape. The gene product has been associated with tumor suppression but has also been correlated with metastasis based on changes to cell shape which can promote tumor cell invasion. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2015].", "evidence": [ { "database": "RefSeq", "id": "NP_001296372", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001296372" } ] } ], "disease": [ { "disease_id": "DOID:0110338", "recommended_name": { "id": "DOID:0110338", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110338", "name": "osteogenesis imperfecta type 17", "description": "An osteogenesis imperfecta that has_material_basis_in mutation in the SPARC gene on chromosome 5q33." }, "synonyms": [ { "id": "DOID:0110338", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110338", "name": "OI17", "description": "" }, { "id": "DOID:0110338", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110338", "name": "osteogenesis imperfecta type XVII", "description": "" }, { "id": "MONDO:0014672", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014672", "name": "osteogenesis imperfecta type 17", "description": "Any osteogenesis imperfecta in which the cause of the disease is a mutation in the SPARC gene." }, { "id": "MONDO:0014672", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014672", "name": "OI17", "description": "" }, { "id": "MONDO:0014672", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014672", "name": "SPARC osteogenesis imperfecta", "description": "" }, { "id": "MONDO:0014672", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014672", "name": "osteogenesis imperfecta caused by mutation in SPARC", "description": "" }, { "id": "MONDO:0014672", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014672", "name": "osteogenesis imperfecta type XVII", "description": "" }, { "id": "MONDO:0014672", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014672", "name": "osteogenesis imperfecta, type 17", "description": "" }, { "id": "MONDO:0014672", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014672", "name": "osteogenesis imperfecta, type XVII", "description": "" }, { "id": "MIM:616507", "resource": "MIM", "url": "https://www.omim.org/entry/616507", "name": "Osteogenesis imperfecta 17", "description": "Osteogenesis imperfecta 17" } ], "evidence": [ { "id": "616507", "database": "MIM", "url": "https://www.omim.org/entry/616507" } ] } ], "snv": [ { "evidence": [ { "id": "P09486", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P09486" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 118, "end_pos": 118, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "A", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NKT->NKA).", "chr_id": "5", "chr_pos": "151669763", "ref_nt": "T", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "T118", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs536199375", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs536199375" }, { "id": "rs536199375", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs536199375" }, { "id": "rs536199375", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs536199375" }, { "id": "rs536199375", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs536199375" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 118, "end_pos": 118, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->NKN).", "chr_id": "5", "chr_pos": "151669762", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "T118", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1581522823", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1581522823" }, { "id": "rs1581522823", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1581522823" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 118, "end_pos": 118, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->NKP).", "chr_id": "5", "chr_pos": "151669763", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T118", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs201797309", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201797309" }, { "id": "rs201797309", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs201797309" }, { "id": "rs201797309", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201797309" }, { "id": "rs201797309", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs201797309#frequency_tab" }, { "id": "rs201797309", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201797309" }, { "id": "24145436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24145436" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 120, "end_pos": 120, "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DSS->NSS).", "chr_id": "5", "chr_pos": "151669757", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "D120", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "P09486", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P09486" }, { "id": "rs1235208794", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1235208794" }, { "id": "rs1235208794", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1235208794" }, { "id": "rs1235208794", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1235208794#frequency_tab" }, { "id": "rs1235208794", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1235208794" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 26, "end_pos": 26, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DET->NET).", "chr_id": "5", "chr_pos": "151674656", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "D26", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "P09486", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P09486" } ], "glycoeffect": [], "start_pos": 282, "end_pos": 282, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "A", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (4).", "chr_id": "5", "chr_pos": "151664126", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "A282", "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] }, { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1479470368", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1479470368" }, { "id": "rs1479470368", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1479470368" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 91, "end_pos": 91, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NTP->NTS).", "chr_id": "5", "chr_pos": "151671632", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P91", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 166, "end_pos": 166, "sequence_org": "R", "sequence_mut": "A", "comment": "Strongly reduced collagen binding.", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" }, { "database": "PubMed", "id": "9501084", "url": "https://glygen.org/publication/PubMed/9501084" } ] }, { "start_pos": 166, "end_pos": 166, "sequence_org": "R", "sequence_mut": "K", "comment": "Strongly reduced collagen binding.", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" }, { "database": "PubMed", "id": "9501084", "url": "https://glygen.org/publication/PubMed/9501084" } ] }, { "start_pos": 166, "end_pos": 166, "sequence_org": "R", "sequence_mut": "L", "comment": "Strongly reduced collagen binding.", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" }, { "database": "PubMed", "id": "9501084", "url": "https://glygen.org/publication/PubMed/9501084" } ] }, { "start_pos": 173, "end_pos": 173, "sequence_org": "N", "sequence_mut": "A", "comment": "Strongly reduced collagen binding.", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" }, { "database": "PubMed", "id": "9501084", "url": "https://glygen.org/publication/PubMed/9501084" } ] }, { "start_pos": 173, "end_pos": 173, "sequence_org": "N", "sequence_mut": "Q", "comment": "Strongly reduced collagen binding.", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" }, { "database": "PubMed", "id": "9501084", "url": "https://glygen.org/publication/PubMed/9501084" } ] }, { "start_pos": 259, "end_pos": 259, "sequence_org": "L", "sequence_mut": "A", "comment": "Loss of collagen binding.", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" }, { "database": "PubMed", "id": "9501084", "url": "https://glygen.org/publication/PubMed/9501084" } ] }, { "start_pos": 262, "end_pos": 262, "sequence_org": "M", "sequence_mut": "A", "comment": "Strongly reduced collagen binding.", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" }, { "database": "PubMed", "id": "9501084", "url": "https://glygen.org/publication/PubMed/9501084" } ] }, { "start_pos": 263, "end_pos": 263, "sequence_org": "E", "sequence_mut": "A", "comment": "Loss of collagen binding.", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" }, { "database": "PubMed", "id": "9501084", "url": "https://glygen.org/publication/PubMed/9501084" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "97.5", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000113140", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113140" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "95.31", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000113140", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113140" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "99.1", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000113140", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113140" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "99.53", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000113140", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113140" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.46", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000113140", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113140" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "99.31", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000113140", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113140" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "97.79", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000113140", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113140" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "99.26", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000113140", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113140" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "99.53", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000113140", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113140" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "99.68", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000113140", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113140" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "97.24", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000113140", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113140" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "99.25", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000113140", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113140" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "99.64", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000113140", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113140" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P09486", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09486" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P09486", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09486" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P09486", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09486" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P09486", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09486" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P09486", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09486" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P09486", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09486" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P09486", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09486" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P09486", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09486" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P09486", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09486" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P09486", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09486" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P09486", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09486" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P09486", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09486" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "common_name": "Human" } ], "gene": [ { "name": "SPARC", "url": "https://www.uniprot.org/uniprot/P09486", "locus": { "chromosome": "5", "start_pos": 151661096, "end_pos": 151686975, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000113140", "url": "https://www.ensembl.org/id/ENSG00000113140" } ] } } ], "crossref": [ { "id": "ENSG00000113140", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113140", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P09486", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P09486", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd01328", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01328", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd16231", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16231", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "SPARC", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=SPARC", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "6678", "url": "https://www.ncbi.nlm.nih.gov/gene/6678", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "706", "url": "https://glyconnect.expasy.org/browser/proteins/706", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "11219", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=11219", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P09486", "url": "https://www.ebi.ac.uk/intact/interactors/id:P09486*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001999", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001999", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002350", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002350", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003645", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003645", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011992", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011992", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015369", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015369", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018247", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018247", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019577", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019577", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036058", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036058", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037641", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037641", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:6678", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:6678", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "182120", "url": "http://www.omim.org/entry/182120", "database": "MIM", "categories": [ "Other" ] }, { "id": "616507", "url": "http://www.omim.org/entry/616507", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P09486", "url": "https://www.nextprot.org/entry/NX_P09486", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "IWKFCEL", "url": "https://omabrowser.org/oma/group/IWKFCEL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4695638at2759", "url": "http://www.orthodb.org/?query=4695638at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13866", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13866", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13866:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13866:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1BMO", "url": "https://www.rcsb.org/structure/1BMO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1NUB", "url": "https://www.rcsb.org/structure/1NUB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1SRA", "url": "https://www.rcsb.org/structure/1SRA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2V53", "url": "https://www.rcsb.org/structure/2V53", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00050", "url": "http://pfam.xfam.org/family/PF00050", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF09289", "url": "http://pfam.xfam.org/family/PF09289", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF10591", "url": "http://pfam.xfam.org/family/PF10591", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P09486", "url": "https://pharos.nih.gov/targets/P09486", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000054641", "url": "https://proconsortium.org/app/entry/PR:000054641", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054642", "url": "https://proconsortium.org/app/entry/PR:000054642", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054643", "url": "https://proconsortium.org/app/entry/PR:000054643", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054644", "url": "https://proconsortium.org/app/entry/PR:000054644", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054645", "url": "https://proconsortium.org/app/entry/PR:000054645", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054646", "url": "https://proconsortium.org/app/entry/PR:000054646", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054647", "url": "https://proconsortium.org/app/entry/PR:000054647", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054648", "url": "https://proconsortium.org/app/entry/PR:000054648", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054649", "url": "https://proconsortium.org/app/entry/PR:000054649", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054650", "url": "https://proconsortium.org/app/entry/PR:000054650", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P09486", "url": "http://purl.obolibrary.org/obo/PR_P09486", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001296372", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001296372", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P09486", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "E5RJA5", "url": "https://www.uniprot.org/uniprot/E5RJA5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RJA5-1", "url": "https://www.uniprot.org/uniprot/E5RJA5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RK62", "url": "https://www.uniprot.org/uniprot/E5RK62", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RK62-1", "url": "https://www.uniprot.org/uniprot/E5RK62-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5GY03", "url": "https://www.uniprot.org/uniprot/F5GY03", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5GY03-1", "url": "https://www.uniprot.org/uniprot/F5GY03-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H4E2", "url": "https://www.uniprot.org/uniprot/F5H4E2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H4E2-1", "url": "https://www.uniprot.org/uniprot/F5H4E2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P09486-1", "url": "https://www.uniprot.org/uniprot/P09486-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI", "length": 303, "header": "sp|P09486-1|SPRC_HUMAN Isoform 1 of SPARC OS=Homo sapiens OX=9606 GN=SPARC PE=1 SV=1 CANONICAL=P09486-1" }, "isoforms": [ { "isoform_ac": "E5RJA5-1", "url": "", "sequence": { "sequence": "MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVG", "length": 53, "header": "tr|E5RJA5-1|E5RJA5_HUMAN Computationally mapped isoform of Secreted protein acidic and cysteine rich OS=Homo sapiens OX=9606 GN=SPARC PE=4 SV=1 CANONICAL=P09486-1" }, "locus": { "chromosome": "5", "start_pos": 151676188, "end_pos": 151673178, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000522348.1", "url": "https://www.ensembl.org/id/ENST00000522348.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000429152.1", "url": "https://www.ensembl.org/id/ENSP00000429152.1" } ] } }, { "isoform_ac": "E5RK62-1", "url": "", "sequence": { "sequence": "MCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRL", "length": 115, "header": "tr|E5RK62-1|SPRC_HUMAN Computationally mapped isoform of SPARC OS=Homo sapiens OX=9606 GN=SPARC PE=1 SV=1 CANONICAL=P09486-1" }, "locus": { "chromosome": "5", "start_pos": 151671629, "end_pos": 151666477, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000521569.1", "url": "https://www.ensembl.org/id/ENST00000521569.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000428119.1", "url": "https://www.ensembl.org/id/ENSP00000428119.1" } ] } }, { "isoform_ac": "F5GY03-1", "url": "", "sequence": { "sequence": "MCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQ", "length": 149, "header": "tr|F5GY03-1|SPRC_HUMAN Computationally mapped isoform of SPARC OS=Homo sapiens OX=9606 GN=SPARC PE=1 SV=1 CANONICAL=P09486-1" }, "locus": { "chromosome": "5", "start_pos": 151671629, "end_pos": 151666375, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000538026.5", "url": "https://www.ensembl.org/id/ENST00000538026.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000440127.1", "url": "https://www.ensembl.org/id/ENSP00000440127.1" } ] } }, { "isoform_ac": "F5H4E2-1", "url": "", "sequence": { "sequence": "MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEK", "length": 110, "header": "tr|F5H4E2-1|F5H4E2_HUMAN Computationally mapped isoform of Secreted protein acidic and cysteine rich OS=Homo sapiens OX=9606 GN=SPARC PE=1 SV=2 CANONICAL=P09486-1" }, "locus": { "chromosome": "5", "start_pos": 151676188, "end_pos": 151671573, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000539687.6", "url": "https://www.ensembl.org/id/ENST00000539687.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000444998.2", "url": "https://www.ensembl.org/id/ENSP00000444998.2" } ] } }, { "isoform_ac": "P09486-1", "url": "", "sequence": { "sequence": "MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI", "length": 303, "header": "sp|P09486-1|SPRC_HUMAN Isoform 1 of SPARC OS=Homo sapiens OX=9606 GN=SPARC PE=1 SV=1 CANONICAL=P09486-1" }, "locus": { "chromosome": "5", "start_pos": 151676188, "end_pos": 151663574, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000231061.9", "url": "https://www.ensembl.org/id/ENST00000231061.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000231061.4", "url": "https://www.ensembl.org/id/ENSP00000231061.4" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "P09486", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "P09486", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G12313PD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14456RI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G20210JR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G25418HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G46902YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47448YK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48584BU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "P09486", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G60177UT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G60923RB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "P09486", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G65092SV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70087PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "P09486@N116", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P09486@N116" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G70375MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72398FA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72735IY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G74430RZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G80223IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "P09486", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G83229XP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G83555HU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "P09486", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "P09486", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G92062TF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G92821TF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "P09486", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G95133RI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G96577RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "706", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/706" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "P09486", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09486#ptm_processing" }, { "id": "9501084", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9501084" }, { "id": "9233787", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9233787" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 39, "start_aa": "Thr", "end_pos": 39, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr39", "evidence": [ { "id": "P09486", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Binding of the G domains of laminin alpha1 and alpha2 chains and perlecan to heparin, sulfatides, alpha-dystroglycan and several extracellular matrix proteins.", "journal": "The EMBO journal", "date": "1999", "authors": "Talts JF, Andac Z, Gohring W, Brancaccio A, Timpl R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "10022829", "url": "https://glygen.org/publication/PubMed/10022829" } ] }, { "title": "Agrin in Alzheimer's disease: altered solubility and abnormal distribution within microvasculature and brain parenchyma.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Donahue JE, Berzin TM, Rafii MS, Glass DJ, Yancopoulos GD, Fallon JR, Stopa EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "10339611", "url": "https://glygen.org/publication/PubMed/10339611" } ] }, { "title": "Agrin binds to beta-amyloid (Abeta), accelerates abeta fibril formation, and is localized to Abeta deposits in Alzheimer's disease brain.", "journal": "Molecular and cellular neurosciences", "date": "2000", "authors": "Cotman SL, Halfter W, Cole GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "10673326", "url": "https://glygen.org/publication/PubMed/10673326" } ] }, { "title": "Mutations in cartilage oligomeric matrix protein causing pseudoachondroplasia and multiple epiphyseal dysplasia affect binding of calcium and collagen I, II, and IX.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Thur J, Rosenberg K, Nitsche DP, Pihlajamaa T, Ala-Kokko L, Heinegard D, Paulsson M, Maurer P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "11084047", "url": "https://glygen.org/publication/PubMed/11084047" } ] }, { "title": "Biglycan and decorin bind close to the n-terminal region of the collagen VI triple helix.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Wiberg C, Hedbom E, Khairullina A, Lamande SR, Oldberg A, Timpl R, Morgelin M, Heinegard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "11259413", "url": "https://glygen.org/publication/PubMed/11259413" } ] }, { "title": "gamma -Secretase cleavage and nuclear localization of ErbB-4 receptor tyrosine kinase.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Ni CY, Murphy MP, Golde TE, Carpenter G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "11679632", "url": "https://glygen.org/publication/PubMed/11679632" } ] }, { "title": "FEEL-1, a novel scavenger receptor with in vitro bacteria-binding and angiogenesis-modulating activities.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Adachi H, Tsujimoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "12077138", "url": "https://glygen.org/publication/PubMed/12077138" } ] }, { "title": "Matrix-matrix interaction of cartilage oligomeric matrix protein and fibronectin.", "journal": "Matrix biology : journal of the International Society for Matrix Biology", "date": "2002", "authors": "Di Cesare PE, Chen FS, Moergelin M, Carlson CS, Leslie MP, Perris R, Fang C", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "12225811", "url": "https://glygen.org/publication/PubMed/12225811" } ] }, { "title": "FEEL-1 and FEEL-2 are endocytic receptors for advanced glycation end products.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Tamura Y, Adachi H, Osuga J, Ohashi K, Yahagi N, Sekiya M, Okazaki H, Tomita S, Iizuka Y, Shimano H, Nagai R, Kimura S, Tsujimoto M, Ishibashi S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "12473645", "url": "https://glygen.org/publication/PubMed/12473645" } ] }, { "title": "Purification and molecular identification of the human hyaluronan receptor for endocytosis.", "journal": "Glycobiology", "date": "2003", "authors": "Zhou B, McGary CT, Weigel JA, Saxena A, Weigel PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "12626425", "url": "https://glygen.org/publication/PubMed/12626425" } ] }, { "title": "WW domain-containing protein YAP associates with ErbB-4 and acts as a co-transcriptional activator for the carboxyl-terminal fragment of ErbB-4 that translocates to the nucleus.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Komuro A, Nagai M, Navin NE, Sudol M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "12807903", "url": "https://glygen.org/publication/PubMed/12807903" } ] }, { "title": "Mapping of binding sites for heparin, plasminogen activator inhibitor-1, and plasminogen to vitronectin's heparin-binding region reveals a novel vitronectin-dependent feedback mechanism for the control of plasmin formation.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Kost C, Stuber W, Ehrlich HJ, Pannekoek H, Preissner KT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "1376317", "url": "https://glygen.org/publication/PubMed/1376317" } ] }, { "title": "Isolation of dense granules from human platelets.", "journal": "Methods in enzymology", "date": "1992", "authors": "Fukami MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "1435334", "url": "https://glygen.org/publication/PubMed/1435334" } ] }, { "title": "Characterization of the proteins released from activated platelets leads to localization of novel platelet proteins in human atherosclerotic lesions.", "journal": "Blood", "date": "2004", "authors": "Coppinger JA, Cagney G, Toomey S, Kislinger T, Belton O, McRedmond JP, Cahill DJ, Emili A, Fitzgerald DJ, Maguire PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "14630798", "url": "https://glygen.org/publication/PubMed/14630798" } ] }, { "title": "Neurite outgrowth by the alternatively spliced region of human tenascin-C is mediated by neuronal alpha7beta1 integrin.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2004", "authors": "Mercado ML, Nur-e-Kamal A, Liu HY, Gross SR, Movahed R, Meiners S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "14715956", "url": "https://glygen.org/publication/PubMed/14715956" } ] }, { "title": "Ligand-regulated association of ErbB-4 to the transcriptional co-activator YAP65 controls transcription at the nuclear level.", "journal": "Experimental cell research", "date": "2004", "authors": "Omerovic J, Puggioni EM, Napoletano S, Visco V, Fraioli R, Frati L, Gulino A, Alimandi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "15023535", "url": "https://glygen.org/publication/PubMed/15023535" } ] }, { "title": "Interactions between the cartilage oligomeric matrix protein and matrilins. Implications for matrix assembly and the pathogenesis of chondrodysplasias.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Mann HH, Ozbek S, Engel J, Paulsson M, Wagener R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "15075323", "url": "https://glygen.org/publication/PubMed/15075323" } ] }, { "title": "Endocytic function, glycosaminoglycan specificity, and antibody sensitivity of the recombinant human 190-kDa hyaluronan receptor for endocytosis (HARE).", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Harris EN, Weigel JA, Weigel PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "15208308", "url": "https://glygen.org/publication/PubMed/15208308" } ] }, { "title": "Structural basis for interactions between tenascins and lectican C-type lectin domains: evidence for a crosslinking role for tenascins.", "journal": "Structure (London, England : 1993)", "date": "2004", "authors": "Lundell A, Olin AI, Morgelin M, al-Karadaghi S, Aspberg A, Logan DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "15296743", "url": "https://glygen.org/publication/PubMed/15296743" } ] }, { "title": "The nucleotide transporter MRP4 (ABCC4) is highly expressed in human platelets and present in dense granules, indicating a role in mediator storage.", "journal": "Blood", "date": "2004", "authors": "Jedlitschky G, Tirschmann K, Lubenow LE, Nieuwenhuis HK, Akkerman JW, Greinacher A, Kroemer HK", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "15297306", "url": "https://glygen.org/publication/PubMed/15297306" } ] }, { "title": "Rapid plasma membrane-endosomal trafficking of the lymph node sinus and high endothelial venule scavenger receptor/homing receptor stabilin-1 (FEEL-1/CLEVER-1).", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Prevo R, Banerji S, Ni J, Jackson DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "15345716", "url": "https://glygen.org/publication/PubMed/15345716" } ] }, { "title": "Stabilin-1 localizes to endosomes and the trans-Golgi network in human macrophages and interacts with GGA adaptors.", "journal": "Journal of leukocyte biology", "date": "2004", "authors": "Kzhyshkowska J, Gratchev A, Martens JH, Pervushina O, Mamidi S, Johansson S, Schledzewski K, Hansen B, He X, Tang J, Nakayama K, Goerdt S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "15345724", "url": "https://glygen.org/publication/PubMed/15345724" } ] }, { "title": "Binding of the proteoglycan decorin to collagen type VI.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Bidanset DJ, Guidry C, Rosenberg LC, Choi HU, Timpl R, Hook M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "1544908", "url": "https://glygen.org/publication/PubMed/1544908" } ] }, { "title": "The ERBB4/HER4 receptor tyrosine kinase regulates gene expression by functioning as a STAT5A nuclear chaperone.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Williams CC, Allison JG, Vidal GA, Burow ME, Beckman BS, Marrero L, Jones FE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "15534001", "url": "https://glygen.org/publication/PubMed/15534001" } ] }, { "title": "Stabilin-1 and stabilin-2 are both directed into the early endocytic pathway in hepatic sinusoidal endothelium via interactions with clathrin/AP-2, independent of ligand binding.", "journal": "Experimental cell research", "date": "2005", "authors": "Hansen B, Longati P, Elvevold K, Nedredal GI, Schledzewski K, Olsen R, Falkowski M, Kzhyshkowska J, Carlsson F, Johansson S, Smedsrod B, Goerdt S, Johansson S, McCourt P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "15572036", "url": "https://glygen.org/publication/PubMed/15572036" } ] }, { "title": "WW domain-containing proteins, WWOX and YAP, compete for interaction with ErbB-4 and modulate its transcriptional function.", "journal": "Cancer research", "date": "2005", "authors": "Aqeilan RI, Donati V, Palamarchuk A, Trapasso F, Kaou M, Pekarsky Y, Sudol M, Croce CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "16061658", "url": "https://glygen.org/publication/PubMed/16061658" } ] }, { "title": "Phosphatidylinositide 3-kinase activity is required for stabilin-1-mediated endosomal transport of acLDL.", "journal": "Immunobiology", "date": "2005", "authors": "Kzhyshkowska J, Gratchev A, Brundiers H, Mamidi S, Krusell L, Goerdt S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "16164023", "url": "https://glygen.org/publication/PubMed/16164023" } ] }, { "title": "Interactions between collagen IX and biglycan measured by atomic force microscopy.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Chen CH, Yeh ML, Geyer M, Wang GJ, Huang MH, Heggeness MH, Hook M, Luo ZP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "16293224", "url": "https://glygen.org/publication/PubMed/16293224" } ] }, { "title": "Involvement of tenascin-C and PG-M/versican in flexor tenosynovial pathology of idiopathic carpal tunnel syndrome.", "journal": "Histology and histopathology", "date": "2006", "authors": "Tsujii M, Hirata H, Yoshida T, Imanaka-Yoshida K, Morita A, Uchida A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "16493581", "url": "https://glygen.org/publication/PubMed/16493581" } ] }, { "title": "Novel function of alternatively activated macrophages: stabilin-1-mediated clearance of SPARC.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2006", "authors": "Kzhyshkowska J, Workman G, Cardo-Vila M, Arap W, Pasqualini R, Gratchev A, Krusell L, Goerdt S, Sage EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "16670288", "url": "https://glygen.org/publication/PubMed/16670288" } ] }, { "title": "Coregulation of estrogen receptor by ERBB4/HER4 establishes a growth-promoting autocrine signal in breast tumor cells.", "journal": "Cancer research", "date": "2006", "authors": "Zhu Y, Sullivan LL, Nair SS, Williams CC, Pandey AK, Marrero L, Vadlamudi RK, Jones FE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "16912174", "url": "https://glygen.org/publication/PubMed/16912174" } ] }, { "title": "Presenilin-dependent ErbB4 nuclear signaling regulates the timing of astrogenesis in the developing brain.", "journal": "Cell", "date": "2006", "authors": "Sardi SP, Murtie J, Koirala S, Patten BA, Corfas G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "17018285", "url": "https://glygen.org/publication/PubMed/17018285" } ] }, { "title": "Expression, processing, and glycosaminoglycan binding activity of the recombinant human 315-kDa hyaluronic acid receptor for endocytosis (HARE).", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Harris EN, Kyosseva SV, Weigel JA, Weigel PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "17145755", "url": "https://glygen.org/publication/PubMed/17145755" } ] }, { "title": "Interaction of cartilage oligomeric matrix protein/thrombospondin 5 with aggrecan.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Chen FH, Herndon ME, Patel N, Hecht JT, Tuan RS, Lawler J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "17588949", "url": "https://glygen.org/publication/PubMed/17588949" } ] }, { "title": "Rapid cell corpse clearance by stabilin-2, a membrane phosphatidylserine receptor.", "journal": "Cell death and differentiation", "date": "2008", "authors": "Park SY, Jung MY, Kim HJ, Lee SJ, Kim SY, Lee BH, Kwon TH, Park RW, Kim IS", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "17962816", "url": "https://glygen.org/publication/PubMed/17962816" } ] }, { "title": "The human hyaluronan receptor for endocytosis (HARE/Stabilin-2) is a systemic clearance receptor for heparin.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Harris EN, Weigel JA, Weigel PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "18434317", "url": "https://glygen.org/publication/PubMed/18434317" } ] }, { "title": "The ligand-binding profile of HARE: hyaluronan and chondroitin sulfates A, C, and D bind to overlapping sites distinct from the sites for heparin, acetylated low-density lipoprotein, dermatan sulfate, and CS-E.", "journal": "Glycobiology", "date": "2008", "authors": "Harris EN, Weigel PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "18499864", "url": "https://glygen.org/publication/PubMed/18499864" } ] }, { "title": "Prolactin and ErbB4/HER4 signaling interact via Janus kinase 2 to induce mammary epithelial cell gene expression differentiation.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2008", "authors": "Muraoka-Cook RS, Sandahl M, Hunter D, Miraglia L, Earp HS 3rd", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "18653779", "url": "https://glygen.org/publication/PubMed/18653779" } ] }, { "title": "The E3 ubiquitin ligase WWP1 selectively targets HER4 and its proteolytically derived signaling isoforms for degradation.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Feng SM, Muraoka-Cook RS, Hunter D, Sandahl MA, Caskey LS, Miyazawa K, Atfi A, Earp HS 3rd", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "19047365", "url": "https://glygen.org/publication/PubMed/19047365" } ] }, { "title": "Rat and human HARE/stabilin-2 are clearance receptors for high- and low-molecular-weight heparins.", "journal": "American journal of physiology. Gastrointestinal and liver physiology", "date": "2009", "authors": "Harris EN, Baggenstoss BA, Weigel PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "19359419", "url": "https://glygen.org/publication/PubMed/19359419" } ] }, { "title": "ErbB4 splice variants Cyt1 and Cyt2 differ by 16 amino acids and exert opposing effects on the mammary epithelium in vivo.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Muraoka-Cook RS, Sandahl MA, Strunk KE, Miraglia LC, Husted C, Hunter DM, Elenius K, Chodosh LA, Earp HS 3rd", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "19596786", "url": "https://glygen.org/publication/PubMed/19596786" } ] }, { "title": "Stabilin-1 mediates phosphatidylserine-dependent clearance of cell corpses in alternatively activated macrophages.", "journal": "Journal of cell science", "date": "2009", "authors": "Park SY, Jung MY, Lee SJ, Kang KB, Gratchev A, Riabov V, Kzhyshkowska J, Kim IS", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "19726632", "url": "https://glygen.org/publication/PubMed/19726632" } ] }, { "title": "Decorin interacts with fibrillar collagen of embryonic and adult human skin.", "journal": "Journal of structural biology", "date": "1991", "authors": "Fleischmajer R, Fisher LW, MacDonald ED, Jacobs L Jr, Perlish JS, Termine JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2059554", "url": "https://glygen.org/publication/PubMed/2059554" } ] }, { "title": "Role of liver sinusoidal endothelial cells and stabilins in elimination of oxidized low-density lipoproteins.", "journal": "American journal of physiology. Gastrointestinal and liver physiology", "date": "2011", "authors": "Li R, Oteiza A, Sorensen KK, McCourt P, Olsen R, Smedsrod B, Svistounov D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "21030611", "url": "https://glygen.org/publication/PubMed/21030611" } ] }, { "title": "Stabilin-1/CLEVER-1, a type 2 macrophage marker, is an adhesion and scavenging molecule on human placental macrophages.", "journal": "European journal of immunology", "date": "2011", "authors": "Palani S, Maksimow M, Miiluniemi M, Auvinen K, Jalkanen S, Salmi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "21480214", "url": "https://glygen.org/publication/PubMed/21480214" } ] }, { "title": "Dentin matrix protein 1 (DMP1) signals via cell surface integrin.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Wu H, Teng PN, Jayaraman T, Onishi S, Li J, Bannon L, Huang H, Close J, Sfeir C", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "21642437", "url": "https://glygen.org/publication/PubMed/21642437" } ] }, { "title": "Collagen I and III and their decorin modified surfaces studied by atomic force microscopy and the elucidation of their affinity toward positive apolipoprotein B-100 residue by quartz crystal microbalance.", "journal": "The Analyst", "date": "2011", "authors": "Witos J, Saint-Guirons J, Meinander K, D'Ulivo L, Riekkola ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "21789315", "url": "https://glygen.org/publication/PubMed/21789315" } ] }, { "title": "Dentin phosphoprotein (DPP) activates integrin-mediated anchorage-dependent signals in undifferentiated mesenchymal cells.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Eapen A, Ramachandran A, George A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "22134916", "url": "https://glygen.org/publication/PubMed/22134916" } ] }, { "title": "Human platelet osteonectin: release, surface expression, and partial characterization.", "journal": "Blood", "date": "1990", "authors": "Kelm R J, Mann K G", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "reference": [ { "type": "PubMed", "id": "2306517", "url": "https://glygen.org/publication/PubMed/2306517" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "Nuclear ErbB4 signaling through H3K9me3 is antagonized by EGFR-activated c-Src.", "journal": "Journal of cell science", "date": "2013", "authors": "Ishibashi K, Fukumoto Y, Hasegawa H, Abe K, Kubota S, Aoyama K, Kubota S, Nakayama Y, Yamaguchi N", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "23230144", "url": "https://glygen.org/publication/PubMed/23230144" } ] }, { "title": "Glycoproteomic analysis of the secretome of human endothelial cells.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M", "evidence": [ { "database": "UniCarbKB", "id": "P09486", "url": "" }, { "database": "GlyConnect", "id": "706", "url": "https://glyconnect.expasy.org/browser/proteins/706" } ], "reference": [ { "type": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "title": "Structure and expression of osteonectin mRNA in human tissue.", "journal": "Connect. Tissue Res.", "date": "1990", "authors": "Young M F, Day A A, Dominquez P, McQuillan C I, Fisher L W, Termine J D", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "reference": [ { "type": "PubMed", "id": "2338025", "url": "https://glygen.org/publication/PubMed/2338025" } ] }, { "title": "High precision platelet releasate definition by quantitative reversed protein profiling--brief report.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2013", "authors": "Wijten P, van Holten T, Woo LL, Bleijerveld OB, Roest M, Heck AJ, Scholten A", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "23640497", "url": "https://glygen.org/publication/PubMed/23640497" } ] }, { "title": "Immunoelectron microscopy of osteonectin and type I collagen in osteoblasts and bone matrix.", "journal": "Calcified tissue international", "date": "1990", "authors": "Romanowski R, Jundt G, Termine JD, von der Mark K, Schulz A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2364322", "url": "https://glygen.org/publication/PubMed/2364322" } ] }, { "title": "A 125/115-kDa cell surface receptor specific for vitronectin interacts with the arginine-glycine-aspartic acid adhesion sequence derived from fibronectin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1985", "authors": "Pytela R, Pierschbacher MD, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2412224", "url": "https://glygen.org/publication/PubMed/2412224" } ] }, { "title": "Landscape of somatic mutations and clonal evolution in mantle cell lymphoma.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Bea S, Valdes-Mas R, Navarro A, Salaverria I, Martin-Garcia D, Jares P, Gine E, Pinyol M, Royo C, Nadeu F, Conde L, Juan M, Clot G, Vizan P, Di Croce L, Puente DA, Lopez-Guerra M, Moros A, Roue G, Aymerich M, Villamor N, Colomo L, Martinez A, Valera A, Martin-Subero JI, Amador V, Hernandez L, Rozman M, Enjuanes A, Forcada P, Muntanola A, Hartmann EM, Calasanz MJ, Rosenwald A, Ott G, Hernandez-Rivas JM, Klapper W, Siebert R, Wiestner A, Wilson WH, Colomer D, Lopez-Guillermo A, Lopez-Otin C, Puente XS, Campo E", "evidence": [ { "database": "dbSNP", "id": "rs201797309", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201797309" } ], "reference": [ { "type": "PubMed", "id": "24145436", "url": "https://glygen.org/publication/PubMed/24145436" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "Platelet membrane glycoprotein IIb/IIIa: member of a family of Arg-Gly-Asp--specific adhesion receptors.", "journal": "Science (New York, N.Y.)", "date": "1986", "authors": "Pytela R, Pierschbacher MD, Ginsberg MH, Plow EF, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2420006", "url": "https://glygen.org/publication/PubMed/2420006" } ] }, { "title": "Molecular origin of the binding of WWOX tumor suppressor to ErbB4 receptor tyrosine kinase.", "journal": "Biochemistry", "date": "2013", "authors": "Schuchardt BJ, Bhat V, Mikles DC, McDonald CB, Sudol M, Farooq A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "24308844", "url": "https://glygen.org/publication/PubMed/24308844" } ] }, { "title": "Interaction of vitronectin with collagen.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Gebb C, Hayman EG, Engvall E, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2430969", "url": "https://glygen.org/publication/PubMed/2430969" } ] }, { "title": "Convergent and divergent cellular responses by ErbB4 isoforms in mammary epithelial cells.", "journal": "Molecular cancer research : MCR", "date": "2014", "authors": "Wali VB, Haskins JW, Gilmore-Hebert M, Platt JT, Liu Z, Stern DF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "24829397", "url": "https://glygen.org/publication/PubMed/24829397" } ] }, { "title": "Recessive osteogenesis imperfecta caused by missense mutations in SPARC.", "journal": "American journal of human genetics", "date": "2015", "authors": "Mendoza-Londono R, Fahiminiya S, Majewski J, Tetreault M, Nadaf J, Kannu P, Sochett E, Howard A, Stimec J, Dupuis L, Roschger P, Klaushofer K, Palomo T, Ouellet J, Al-Jallad H, Mort JS, Moffatt P, Boudko S, Bachinger HP, Rauch F", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "reference": [ { "type": "PubMed", "id": "26027498", "url": "https://glygen.org/publication/PubMed/26027498" } ] }, { "title": "Structure of human osteonectin based upon analysis of cDNA and genomic sequences.", "journal": "Biochemistry", "date": "1989", "authors": "Villarreal X C, Mann K G, Long G L", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "reference": [ { "type": "PubMed", "id": "2790009", "url": "https://glygen.org/publication/PubMed/2790009" } ] }, { "title": "Molecular analysis of the cDNA for human SPARC/osteonectin/BM-40: sequence, expression, and localization of the gene to chromosome 5q31-q33.", "journal": "Genomics", "date": "1988", "authors": "Swaroop A, Hogan B L, Francke U", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "reference": [ { "type": "PubMed", "id": "2838412", "url": "https://glygen.org/publication/PubMed/2838412" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "GlyConnect", "id": "706", "url": "https://glyconnect.expasy.org/browser/proteins/706" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Mapping the O-glycoproteome using site-specific extraction of O-linked glycopeptides (EXoO).", "journal": "Molecular systems biology", "date": "2018", "authors": "Yang W, Ao M, Hu Y, Li QK, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P09486", "url": "" } ], "reference": [ { "type": "PubMed", "id": "30459171", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "title": "Osteonectin/SPARC/BM-40 in human decidua and carcinoma, tissues characterized by de novo formation of basement membrane.", "journal": "Am. J. Pathol.", "date": "1988", "authors": "Wewer UM, Albrechtsen R, Fisher LW, Young MF, Termine JD", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "reference": [ { "type": "PubMed", "id": "3400777", "url": "https://glygen.org/publication/PubMed/3400777" } ] }, { "title": "Cloning and complete amino acid sequences of human and murine basement membrane protein BM-40 (SPARC, osteonectin).", "journal": "FEBS Lett.", "date": "1988", "authors": "Lankat-Buttgereit B, Mann K, Deutzmann R, Timpl R, Krieg T", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "reference": [ { "type": "PubMed", "id": "3410046", "url": "https://glygen.org/publication/PubMed/3410046" } ] }, { "title": "Purification and partial characterization of small proteoglycans I and II, bone sialoproteins I and II, and osteonectin from the mineral compartment of developing human bone.", "journal": "J. Biol. Chem.", "date": "1987", "authors": "Fisher LW, Hawkins GR, Tuross N, Termine JD", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "reference": [ { "type": "PubMed", "id": "3597437", "url": "https://glygen.org/publication/PubMed/3597437" } ] }, { "title": "Novel pathogenic variants in SPARC as cause of osteogenesis imperfecta: Two case reports.", "journal": "European journal of medical genetics", "date": "2023-11", "authors": "Storoni Silvia, Celli Luca, Zhytnik Lidiia, Maasalu Katre, M\u00e4rtson Aare, K\u00f5ks Sulev, Khmyzov Sergey, Pashenko Andrei, Maugeri Alessandra, Zambrano Anna, Celli Mauro, Eekhoff Elisabeth M W, Micha Dimitra", "evidence": [ { "database": "RefSeq", "id": "NP_001296372", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001296372" } ], "reference": [ { "type": "PubMed", "id": "37758164", "url": "https://glygen.org/publication/PubMed/37758164" } ] }, { "title": "Hepatic SPARC Expression Is Associated with Inflammasome Activation during the Progression of Non-Alcoholic Fatty Liver Disease in Both Mice and Morbidly Obese Patients.", "journal": "International journal of molecular sciences", "date": "2023-10-02", "authors": "Onorato Agostina M, Lameroli Mauriz Luc\u00eda, Bayo Juan, Fiore Esteban, Cantero Mar\u00eda Jos\u00e9, Bueloni Barbara, Garc\u00eda Mariana, Lag\u00fces Cecilia, Mart\u00ednez-Duartez Pedro, Menaldi Gabriel, Paleari Nicolas, Atorrasagasti Catalina, Mazzolini Guillermo D", "evidence": [ { "database": "RefSeq", "id": "NP_001296372", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001296372" } ], "reference": [ { "type": "PubMed", "id": "37834291", "url": "https://glygen.org/publication/PubMed/37834291" } ] }, { "title": "Peritumoral SPARC expression induced by exosomes from nasopharyngeal carcinoma infected Epstein-Barr virus: A poor prognostic marker.", "journal": "International journal of cancer", "date": "2024-03-01", "authors": "Dochi Hirotomo, Kondo Satoru, Komura Shigetaka, Moriyama-Kita Makiko, Komori Takeshi, Nanbo Asuka, Sakaguchi Miako, Fukuyo Masaki, Hamabe-Horiike Toshihide, Tanaka Mariko, Mizokami Harue, Kano Makoto, Kitagawa Yuki, Kobayashi Eiji, Hirai Nobuyuki, Ueno Takayoshi, Nakanishi Yosuke, Endo Kazuhira, Sugimoto Hisashi, Hanayama Rikinari, Kaneda Atsushi, Yoshizaki Tomokazu", "evidence": [ { "database": "RefSeq", "id": "NP_001296372", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001296372" } ], "reference": [ { "type": "PubMed", "id": "37907830", "url": "https://glygen.org/publication/PubMed/37907830" } ] }, { "title": "The association of SPARC with hypertension and its function in endothelial-dependent relaxation.", "journal": "Atherosclerosis", "date": "2024-01", "authors": "Li Xinwei, Zhao Wen, Li Xinxin, Chen Xueying, Li Yu, He Jianxun, Qin Yanwen, Li Linghai, Zhang Huina", "evidence": [ { "database": "RefSeq", "id": "NP_001296372", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001296372" } ], "reference": [ { "type": "PubMed", "id": "38048752", "url": "https://glygen.org/publication/PubMed/38048752" } ] }, { "title": "Serum CRP interacts with SPARC and regulate immune response in severe cases of COVID-19 infection.", "journal": "Frontiers in immunology", "date": "2023", "authors": "Liu Chengyang, Zheng Chenyang, Shen Xipeng, Liang Ling, Li Qiuyu", "evidence": [ { "database": "RefSeq", "id": "NP_001296372", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001296372" } ], "reference": [ { "type": "PubMed", "id": "38077346", "url": "https://glygen.org/publication/PubMed/38077346" } ] }, { "title": "Cartilage proteoglycan binding region and link protein. Radioimmunoassays and the detection of masked determinants in aggregates.", "journal": "The Biochemical journal", "date": "1983", "authors": "Ratcliffe A, Hardingham T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "6193777", "url": "https://glygen.org/publication/PubMed/6193777" } ] }, { "title": "Specific inhibition of type I and type II collagen fibrillogenesis by the small proteoglycan of tendon.", "journal": "The Biochemical journal", "date": "1984", "authors": "Vogel KG, Paulsson M, Heinegard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "6439184", "url": "https://glygen.org/publication/PubMed/6439184" } ] }, { "title": "Characterization of the proteins of isolated human platelet alpha-granules. Evidence for a separate alpha-granule-pool of the glycoproteins IIb and IIIa.", "journal": "Biochimica et biophysica acta", "date": "1981", "authors": "Gogstad GO, Hagen I, Korsmo R, Solum NO", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "6457647", "url": "https://glygen.org/publication/PubMed/6457647" } ] }, { "title": "Immunolocalization of SPARC, tenascin, and thrombospondin in pulmonary fibrosis.", "journal": "Am. J. Pathol.", "date": "1995", "authors": "Kuhn C, Mason R J", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "reference": [ { "type": "PubMed", "id": "7495300", "url": "https://glygen.org/publication/PubMed/7495300" } ] }, { "title": "Binding of tenascin-C to soluble fibronectin and matrix fibrils.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Chung CY, Zardi L, Erickson HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7499434", "url": "https://glygen.org/publication/PubMed/7499434" } ] }, { "title": "Tenascin-R (J1 160/180 inhibits fibronectin-mediated cell adhesion--functional relatedness to tenascin-C.", "journal": "Journal of cell science", "date": "1994", "authors": "Pesheva P, Probstmeier R, Skubitz AP, McCarthy JB, Furcht LT, Schachner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7527058", "url": "https://glygen.org/publication/PubMed/7527058" } ] }, { "title": "Alpha v beta 1 is a receptor for vitronectin and fibrinogen, and acts with alpha 5 beta 1 to mediate spreading on fibronectin.", "journal": "Journal of cell science", "date": "1995", "authors": "Marshall JF, Rutherford DC, McCartney AC, Mitjans F, Goodman SL, Hart IR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7542669", "url": "https://glygen.org/publication/PubMed/7542669" } ] }, { "title": "The human integrin alpha 8 beta 1 functions as a receptor for tenascin, fibronectin, and vitronectin.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Schnapp LM, Hatch N, Ramos DM, Klimanskaya IV, Sheppard D, Pytela R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7559467", "url": "https://glygen.org/publication/PubMed/7559467" } ] }, { "title": "The alpha v beta 5 integrin receptor regulates receptor-mediated endocytosis of vitronectin.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Panetti TS, McKeown-Longo PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7685013", "url": "https://glygen.org/publication/PubMed/7685013" } ] }, { "title": "Endothelial cell attachment and spreading on human tenascin is mediated by alpha 2 beta 1 and alpha v beta 3 integrins.", "journal": "Journal of cell science", "date": "1993", "authors": "Sriramarao P, Mendler M, Bourdon MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7693733", "url": "https://glygen.org/publication/PubMed/7693733" } ] }, { "title": "Interaction of biglycan with type I collagen.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Schonherr E, Witsch-Prehm P, Harrach B, Robenek H, Rauterberg J, Kresse H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7852349", "url": "https://glygen.org/publication/PubMed/7852349" } ] }, { "title": "The expression of functional link protein in a baculovirus system: analysis of mutants lacking the A, B and B' domains.", "journal": "The Biochemical journal", "date": "1994", "authors": "Grover J, Roughley PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8002934", "url": "https://glygen.org/publication/PubMed/8002934" } ] }, { "title": "Interaction of heparin cofactor II with biglycan and decorin.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Whinna HC, Choi HU, Rosenberg LC, Church FC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8440685", "url": "https://glygen.org/publication/PubMed/8440685" } ] }, { "title": "Platelet alpha-granules.", "journal": "Blood reviews", "date": "1993", "authors": "Harrison P, Cramer EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "8467233", "url": "https://glygen.org/publication/PubMed/8467233" } ] }, { "title": "Structure of a novel extracellular Ca(2+)-binding module in BM-40.", "journal": "Nat. Struct. Biol.", "date": "1996", "authors": "Hohenester E, Maurer P, Hohenadl C, Timpl R, Jansonius J N, Engel J", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "reference": [ { "type": "PubMed", "id": "8548457", "url": "https://glygen.org/publication/PubMed/8548457" } ] }, { "title": "Differential effects of the integrins alpha9beta1, alphavbeta3, and alphavbeta6 on cell proliferative responses to tenascin. Roles of the beta subunit extracellular and cytoplasmic domains.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Yokosaki Y, Monis H, Chen J, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8798654", "url": "https://glygen.org/publication/PubMed/8798654" } ] }, { "title": "Interaction of cartilage matrix protein with aggrecan. Increased covalent cross-linking with tissue maturation.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Hauser N, Paulsson M, Heinegard D, Morgelin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8943283", "url": "https://glygen.org/publication/PubMed/8943283" } ] }, { "title": "Crystal structure of a pair of follistatin-like and EF-hand calcium-binding domains in BM-40.", "journal": "The EMBO journal", "date": "1997", "authors": "Hohenester E, Maurer P, Timpl R", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486#ptm_processing" }, { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "reference": [ { "type": "PubMed", "id": "9233787", "url": "https://glygen.org/publication/PubMed/9233787" } ] }, { "title": "Localization of a binding site for the proteoglycan decorin on collagen XIV (undulin).", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Ehnis T, Dieterich W, Bauer M, Kresse H, Schuppan D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9252349", "url": "https://glygen.org/publication/PubMed/9252349" } ] }, { "title": "The C-type lectin domains of lecticans, a family of aggregating chondroitin sulfate proteoglycans, bind tenascin-R by protein-protein interactions independent of carbohydrate moiety.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Aspberg A, Miura R, Bourdoulous S, Shimonaka M, Heinegard D, Schachner M, Ruoslahti E, Yamaguchi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9294172", "url": "https://glygen.org/publication/PubMed/9294172" } ] }, { "title": "Mapping of a defined neurocan binding site to distinct domains of tenascin-C.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Rauch U, Clement A, Retzler C, Frohlich L, Fassler R, Gohring W, Faissner A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9341124", "url": "https://glygen.org/publication/PubMed/9341124" } ] }, { "title": "Identification of hyaluronan-binding domains of aggrecan.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Watanabe H, Cheung SC, Itano N, Kimata K, Yamada Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9346959", "url": "https://glygen.org/publication/PubMed/9346959" } ] }, { "title": "BM-40 (osteonectin, SPARC) is expressed both in the epidermal and in the dermal compartment of adult human skin.", "journal": "J. Invest. Dermatol.", "date": "1998", "authors": "Hunzelmann N, Hafner M, Anders S, Krieg T, Nischt R", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "reference": [ { "type": "PubMed", "id": "9457905", "url": "https://glygen.org/publication/PubMed/9457905" } ] }, { "title": "Crystal structure and mapping by site-directed mutagenesis of the collagen-binding epitope of an activated form of BM-40/SPARC/osteonectin.", "journal": "The EMBO journal", "date": "1998", "authors": "Sasaki T, Hohenester E, Gohring W, Timpl R", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486#ptm_processing" }, { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "reference": [ { "type": "PubMed", "id": "9501084", "url": "https://glygen.org/publication/PubMed/9501084" } ] }, { "title": "Cartilage oligomeric matrix protein shows high affinity zinc-dependent interaction with triple helical collagen.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Rosenberg K, Olsson H, Morgelin M, Heinegard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9685393", "url": "https://glygen.org/publication/PubMed/9685393" } ] }, { "title": "Tenascin-C inhibits beta1 integrin-dependent cell adhesion and neurite outgrowth on fibronectin by a disialoganglioside-mediated signaling mechanism.", "journal": "Glycobiology", "date": "1999", "authors": "Probstmeier R, Pesheva P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9949188", "url": "https://glygen.org/publication/PubMed/9949188" } ] } ], "pathway": [ { "id": "hsa:6678", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:6678", "resource": "KEGG Pathway" }, { "id": "R-HSA-114608", "name": "Platelet degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608", "resource": "Reactome", "description": "Platelet degranulation" }, { "id": "R-HSA-1251985", "name": "Nuclear signaling by ERBB4", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985", "resource": "Reactome", "description": "Nuclear signaling by ERBB4" }, { "id": "R-HSA-3000178", "name": "ECM proteoglycans", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178", "resource": "Reactome", "description": "ECM proteoglycans" }, { "id": "R-HSA-3000497", "name": "Scavenging by Class H Receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497", "resource": "Reactome", "description": "Scavenging by Class H Receptors" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A5G2R6P1-1", "protein_name": "SPARC", "gene_name": "SPARC", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MRAWIFFLLCLAGKALAAPQQEALPDETEVVEETVAEVPVGANPVQVEVGEFDDGAEEAEEEVVAENPCQNHHCKHGKVCELDENNSPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDENNNLLTEKQKLRVKKIHENEKRLEGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFQTCDLDNDKYIALDEWAGCFGIKEQDIDKDLVI", "length": 299 }, "evidence": [ { "id": "P09486", "url": "https://omabrowser.org/oma/group/P09486/", "database": "OMA" } ], "common_name": "Pig" }, { "uniprot_canonical_ac": "P07214-1", "protein_name": "SPARC", "gene_name": "Sparc", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRAWIFFLLCLAGRALAAPQQTEVAEEIVEEETVVEETGVPVGANPVQVEMGEFEDGAEETVEEVVADNPCQNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVLVTLYERDEGNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALEEWAGCFGIKEQDINKDLVI", "length": 302 }, "evidence": [ { "id": "45918807", "url": "http://www.informatics.jax.org/homology/45918807", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P16975-1", "protein_name": "SPARC", "gene_name": "Sparc", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MRAWIFFLLCLAGRALAAPQTEAAEEMVAEETVVEETGLPVGANPVQVEMGEFEEGAEETVEEVVAENPCQNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVLVTLYERDEGNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALEEWAGCFGIKEQDINKDLVI", "length": 301 }, "evidence": [ { "id": "45918807", "url": "http://www.informatics.jax.org/homology/45918807", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 13, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "pmid": "" }, { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "pmid": "" }, { "name": "platelet alpha granule lumen", "id": "GO:0031093", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031093", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "pmid": "" }, { "name": "nuclear matrix", "id": "GO:0016363", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016363", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "pmid": "" }, { "name": "basement membrane", "id": "GO:0005604", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005604", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "pmid": "" }, { "name": "endocytic vesicle lumen", "id": "GO:0071682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071682", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "pmid": "" }, { "name": "platelet alpha granule membrane", "id": "GO:0031092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031092", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "pmid": "" }, { "name": "platelet alpha granule", "id": "GO:0031091", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031091", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "pmid": "" }, { "name": "collagen-containing extracellular matrix", "id": "GO:0062023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062023", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "pmid": "" }, { "name": "collagen binding", "id": "GO:0005518", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005518", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "pmid": "" }, { "name": "extracellular matrix binding", "id": "GO:0050840", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050840", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "positive regulation of endothelial cell migration", "id": "GO:0010595", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010595", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "pmid": "" }, { "name": "negative regulation of endothelial cell proliferation", "id": "GO:0001937", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001937", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "pmid": "" }, { "name": "negative regulation of angiogenesis", "id": "GO:0016525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016525", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "pmid": "" }, { "name": "anatomical structure development", "id": "GO:0048856", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048856", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "pmid": "" }, { "name": "regulation of cell morphogenesis", "id": "GO:0022604", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022604", "evidence": [ { "database": "UniProtKB", "id": "P09486", "url": "https://www.uniprot.org/uniprot/P09486" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "SPARC protein N-glycosylated 1 (human)", "definition": "A SPARC protein (human) that has been N-glycosylated at the residue equivalent to Asn-116 of the amino acid sequence represented by UniProtKB:P09486-1, in which the glycan composition is represented by GlyTouCan:G08293MJ. Example: UniProtKB:P09486-1, Asn-116, MOD:00160~GNO:G08293MJ. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000054641", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054641" } ] }, { "name": "SPARC protein N-glycosylated 2 (human)", "definition": "A SPARC protein (human) that has been N-glycosylated at the residue equivalent to Asn-116 of the amino acid sequence represented by UniProtKB:P09486-1, in which the glycan composition is represented by GlyTouCan:G10486CT. Example: UniProtKB:P09486-1, Asn-116, MOD:00160~GNO:G10486CT. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000054642", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054642" } ] }, { "name": "SPARC protein N-glycosylated 3 (human)", "definition": "A SPARC protein (human) that has been N-glycosylated at the residue equivalent to Asn-116 of the amino acid sequence represented by UniProtKB:P09486-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P09486-1, Asn-116, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000054643", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054643" } ] }, { "name": "SPARC protein N-glycosylated 4 (human)", "definition": "A SPARC protein (human) that has been N-glycosylated at the residue equivalent to Asn-116 of the amino acid sequence represented by UniProtKB:P09486-1, in which the glycan composition is represented by GlyTouCan:G60923RB. Example: UniProtKB:P09486-1, Asn-116, MOD:00160~GNO:G60923RB. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000054644", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054644" } ] }, { "name": "SPARC protein N-glycosylated 5 (human)", "definition": "A SPARC protein (human) that has been N-glycosylated at the residue equivalent to Asn-116 of the amino acid sequence represented by UniProtKB:P09486-1, in which the glycan composition is represented by GlyTouCan:G73997SB. Example: UniProtKB:P09486-1, Asn-116, MOD:00160~GNO:G73997SB. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000054645", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054645" } ] }, { "name": "SPARC protein N-glycosylated 6 (human)", "definition": "A SPARC protein (human) that has been N-glycosylated at the residue equivalent to Asn-116 of the amino acid sequence represented by UniProtKB:P09486-1, in which the glycan composition is represented by GlyTouCan:G80920RR. Example: UniProtKB:P09486-1, Asn-116, MOD:00160~GNO:G80920RR. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000054646", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054646" } ] }, { "name": "SPARC protein N-glycosylated 7 (human)", "definition": "A SPARC protein (human) that has been N-glycosylated at the residue equivalent to Asn-116 of the amino acid sequence represented by UniProtKB:P09486-1, in which the glycan composition is represented by GlyTouCan:G83555HU. Example: UniProtKB:P09486-1, Asn-116, MOD:00160~GNO:G83555HU. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000054647", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054647" } ] }, { "name": "SPARC protein N-glycosylated 8 (human)", "definition": "A SPARC protein (human) that has been N-glycosylated at the residue equivalent to Asn-116 of the amino acid sequence represented by UniProtKB:P09486-1, in which the glycan composition is represented by GlyTouCan:G88374WZ. Example: UniProtKB:P09486-1, Asn-116, MOD:00160~GNO:G88374WZ. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000054648", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054648" } ] }, { "name": "SPARC protein N-glycosylated 9 (human)", "definition": "A SPARC protein (human) that has been N-glycosylated at the residue equivalent to Asn-116 of the amino acid sequence represented by UniProtKB:P09486-1, in which the glycan composition is represented by GlyTouCan:G92821TF. Example: UniProtKB:P09486-1, Asn-116, MOD:00160~GNO:G92821TF. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000054649", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054649" } ] }, { "name": "SPARC protein O-glycosylated 1 (human)", "definition": "A SPARC protein (human) that has been O-glycosylated at the residue equivalent to Thr-39 of the amino acid sequence represented by UniProtKB:P09486-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P09486-1, Thr-39, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000054650", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054650" } ] } ], "site_annotation": [ { "start_pos": 116, "end_pos": 118, "annotation": "n_glycosylation_sequon" }, { "start_pos": 88, "end_pos": 90, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 116 ], "o_linked_sites": [ 39 ], "snv_sites": [ 26, 91, 118, 120, 282 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 116, "end_pos": 118 }, { "start_pos": 88, "end_pos": 90 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 47 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 45 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 46 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 45 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 101 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }