{ "uniprot_canonical_ac": "P09429-1", "uniprot_ac": "P09429", "uniprot_id": "HMGB1_HUMAN", "mass": { "chemical_mass": 24894.0, "monoisotopic_mass": 24894.0 }, "refseq": { "ac": "NP_001300821", "name": "high mobility group protein B1 isoform 1", "summary": "This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2015].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300821" }, "gene_names": [ { "name": "HMGB1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P09429", "id": "P09429" }, { "name": "HMG-1; HMG1; HMG3; SBP-1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300821", "id": "NP_001300821" }, { "name": "HMG1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P09429", "id": "P09429" }, { "name": "HMGB1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300821", "id": "NP_001300821" } ], "protein_names": [ { "name": "High mobility group protein B1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P09429" }, { "name": "HMG-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P09429" }, { "name": "High mobility group protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P09429" }, { "name": "Sulfoglucuronyl carbohydrate binding protein; Amphoterin; high-mobility group (nonhistone chromosomal) protein 1; high mobility group protein B1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300821", "id": "NP_001300821" }, { "name": "high mobility group protein B1 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300821", "id": "NP_001300821" } ], "function": [ { "annotation": "(Microbial infection) Associates with the influenza A viral protein NP in the nucleus of infected cells, promoting viral growth and enhancing the activity of the viral polymerase.", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429#function" }, { "database": "PubMed", "id": "22696656", "url": "https://glygen.org/publication/PubMed/22696656" } ] }, { "annotation": "(Microbial infection) Critical for entry of human coronaviruses SARS-CoV and SARS-CoV-2, as well as human coronavirus NL63/HCoV-NL63 (PubMed:33147444). Regulates the expression of the pro-viral genes ACE2 and CTSL through chromatin modulation (PubMed:33147444). Required for SARS-CoV-2 ORF3A-induced reticulophagy which induces endoplasmic reticulum stress and inflammatory responses and facilitates viral infection (PubMed:35239449).", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429#function" }, { "database": "PubMed", "id": "35239449", "url": "https://glygen.org/publication/PubMed/35239449" }, { "database": "PubMed", "id": "33147444", "url": "https://glygen.org/publication/PubMed/33147444" } ] }, { "annotation": "(Microbial infection) Facilitates dengue virus propagation via interaction with the untranslated regions of viral genome. In turn, this interaction with viral RNA may regulate secondary structure of dengue RNA thus facilitating its recognition by the replication complex.", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429#function" }, { "database": "PubMed", "id": "34971702", "url": "https://glygen.org/publication/PubMed/34971702" } ] }, { "annotation": "(Microbial infection) Promotes Epstein-Barr virus (EBV) latent-to-lytic switch by sustaining the expression of the viral transcription factor BZLF1 that acts as a molecular switch to induce the transition from the latent to the lytic or productive phase of the virus cycle. Mechanistically, participates in EBV reactivation through the NLRP3 inflammasome.", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429#function" }, { "database": "PubMed", "id": "34922257", "url": "https://glygen.org/publication/PubMed/34922257" } ] }, { "annotation": "HMGB1 mediates microbiome-immune axis dysregulation underlying reduced neutralization capacity in obesity-related post-acute sequelae of SARS-CoV-2. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001300821", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300821" }, { "database": "PubMed", "id": "38172612", "url": "https://glygen.org/publication/PubMed/38172612" } ] }, { "annotation": "In the cytoplasm proposed to dissociate the BECN1:BCL2 complex via competitive interaction with BECN1 leading to autophagy activation (PubMed:20819940). Involved in oxidative stress-mediated autophagy (PubMed:21395369). Can protect BECN1 and ATG5 from calpain-mediated cleavage and thus proposed to control their proautophagic and proapoptotic functions and to regulate the extent and severity of inflammation-associated cellular injury (By similarity). In myeloid cells has a protective role against endotoxemia and bacterial infection by promoting autophagy (By similarity). Involved in endosomal translocation and activation of TLR9 in response to CpG-DNA in macrophages (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429#function" }, { "database": "PubMed", "id": "20819940", "url": "https://glygen.org/publication/PubMed/20819940" }, { "database": "PubMed", "id": "21395369", "url": "https://glygen.org/publication/PubMed/21395369" }, { "database": "UniProtKB", "id": "P63158", "url": "https://www.uniprot.org/uniprot/P63158#function" } ] }, { "annotation": "In the extracellular compartment (following either active secretion or passive release) involved in regulation of the inflammatory response. Fully reduced HGMB1 (which subsequently gets oxidized after release) in association with CXCL12 mediates the recruitment of inflammatory cells during the initial phase of tissue injury; the CXCL12:HMGB1 complex triggers CXCR4 homodimerization (PubMed:22370717). Induces the migration of monocyte-derived immature dendritic cells and seems to regulate adhesive and migratory functions of neutrophils implicating AGER/RAGE and ITGAM (By similarity). Can bind to various types of DNA and RNA including microbial unmethylated CpG-DNA to enhance the innate immune response to nucleic acids. Proposed to act in promiscuous DNA/RNA sensing which cooperates with subsequent discriminative sensing by specific pattern recognition receptors (By similarity). Promotes extracellular DNA-induced AIM2 inflammasome activation implicating AGER/RAGE (PubMed:24971542). Disulfide HMGB1 binds to transmembrane receptors, such as AGER/RAGE, TLR2, TLR4 and probably TREM1, thus activating their signal transduction pathways. Mediates the release of cytokines/chemokines such as TNF, IL-1, IL-6, IL-8, CCL2, CCL3, CCL4 and CXCL10 (PubMed:12765338, PubMed:18354232, PubMed:19264983, PubMed:20547845, PubMed:24474694). Promotes secretion of interferon-gamma by macrophage-stimulated natural killer (NK) cells in concert with other cytokines like IL-2 or IL-12 (PubMed:15607795). TLR4 is proposed to be the primary receptor promoting macrophage activation and signaling through TLR4 seems to implicate LY96/MD-2 (PubMed:20547845). In bacterial LPS- or LTA-mediated inflammatory responses binds to the endotoxins and transfers them to CD14 for signaling to the respective TLR4:LY96 and TLR2 complexes (PubMed:18354232, PubMed:21660935, PubMed:25660311). Contributes to tumor proliferation by association with ACER/RAGE (By similarity). Can bind to IL1-beta and signals through the IL1R1:IL1RAP receptor complex (PubMed:18250463). Binding to class A CpG activates cytokine production in plasmacytoid dendritic cells implicating TLR9, MYD88 and AGER/RAGE and can activate autoreactive B cells. Via HMGB1-containing chromatin immune complexes may also promote B cell responses to endogenous TLR9 ligands through a B-cell receptor (BCR)-dependent and ACER/RAGE-independent mechanism (By similarity). Inhibits phagocytosis of apoptotic cells by macrophages; the function is dependent on poly-ADP-ribosylation and involves binding to phosphatidylserine on the cell surface of apoptotic cells (By similarity). In adaptive immunity may be involved in enhancing immunity through activation of effector T cells and suppression of regulatory T (TReg) cells (PubMed:15944249, PubMed:22473704). In contrast, without implicating effector or regulatory T-cells, required for tumor infiltration and activation of T-cells expressing the lymphotoxin LTA:LTB heterotrimer thus promoting tumor malignant progression (By similarity). Also reported to limit proliferation of T-cells (By similarity). Released HMGB1:nucleosome complexes formed during apoptosis can signal through TLR2 to induce cytokine production (PubMed:19064698). Involved in induction of immunological tolerance by apoptotic cells; its pro-inflammatory activities when released by apoptotic cells are neutralized by reactive oxygen species (ROS)-dependent oxidation specifically on Cys-106 (PubMed:18631454). During macrophage activation by activated lymphocyte-derived self apoptotic DNA (ALD-DNA) promotes recruitment of ALD-DNA to endosomes (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429#function" }, { "database": "PubMed", "id": "18354232", "url": "https://glygen.org/publication/PubMed/18354232" }, { "database": "PubMed", "id": "25660311", "url": "https://glygen.org/publication/PubMed/25660311" }, { "database": "UniProtKB", "id": "P63158", "url": "https://www.uniprot.org/uniprot/P63158#function" }, { "database": "PubMed", "id": "15944249", "url": "https://glygen.org/publication/PubMed/15944249" }, { "database": "PubMed", "id": "22473704", "url": "https://glygen.org/publication/PubMed/22473704" }, { "database": "UniProtKB", "id": "P63159", "url": "https://www.uniprot.org/uniprot/P63159#function" }, { "database": "UniProtKB", "id": "SIP1E1D7D2D9CDD818B", "url": "https://www.uniprot.org/uniprot/SIP1E1D7D2D9CDD818B#function" }, { "database": "PubMed", "id": "20547845", "url": "https://glygen.org/publication/PubMed/20547845" }, { "database": "PubMed", "id": "18250463", "url": "https://glygen.org/publication/PubMed/18250463" }, { "database": "PubMed", "id": "24971542", "url": "https://glygen.org/publication/PubMed/24971542" }, { "database": "PubMed", "id": "19264983", "url": "https://glygen.org/publication/PubMed/19264983" }, { "database": "PubMed", "id": "18631454", "url": "https://glygen.org/publication/PubMed/18631454" }, { "database": "PubMed", "id": "21660935", "url": "https://glygen.org/publication/PubMed/21660935" }, { "database": "UniProtKB", "id": "P10103", "url": "https://www.uniprot.org/uniprot/P10103#function" }, { "database": "PubMed", "id": "15607795", "url": "https://glygen.org/publication/PubMed/15607795" }, { "database": "PubMed", "id": "19064698", "url": "https://glygen.org/publication/PubMed/19064698" }, { "database": "PubMed", "id": "22370717", "url": "https://glygen.org/publication/PubMed/22370717" }, { "database": "PubMed", "id": "24474694", "url": "https://glygen.org/publication/PubMed/24474694" }, { "database": "PubMed", "id": "12765338", "url": "https://glygen.org/publication/PubMed/12765338" } ] }, { "annotation": "Increased expression of NLRP3 associated with elevated levels of HMGB1 in children with febrile seizures: a case-control study. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001300821", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300821" }, { "database": "PubMed", "id": "38218765", "url": "https://glygen.org/publication/PubMed/38218765" } ] }, { "annotation": "Multifunctional redox sensitive protein with various roles in different cellular compartments. In the nucleus is one of the major chromatin-associated non-histone proteins and acts as a DNA chaperone involved in replication, transcription, chromatin remodeling, V(D)J recombination, DNA repair and genome stability (PubMed:33147444). Proposed to be an universal biosensor for nucleic acids. Promotes host inflammatory response to sterile and infectious signals and is involved in the coordination and integration of innate and adaptive immune responses. In the cytoplasm functions as a sensor and/or chaperone for immunogenic nucleic acids implicating the activation of TLR9-mediated immune responses, and mediates autophagy. Acts as a danger-associated molecular pattern (DAMP) molecule that amplifies immune responses during tissue injury (PubMed:27362237). Released to the extracellular environment can bind DNA, nucleosomes, IL-1 beta, CXCL12, AGER isoform 2/sRAGE, lipopolysaccharide (LPS) and lipoteichoic acid (LTA), and activates cells through engagement of multiple surface receptors (PubMed:34743181). In the extracellular compartment fully reduced HMGB1 (released by necrosis) acts as a chemokine, disulfide HMGB1 (actively secreted) as a cytokine, and sulfonyl HMGB1 (released from apoptotic cells) promotes immunological tolerance (PubMed:23519706, PubMed:23446148, PubMed:23994764, PubMed:25048472). Has proangiogdenic activity (By similarity). May be involved in platelet activation (By similarity). Binds to phosphatidylserine and phosphatidylethanolamide (By similarity). Bound to RAGE mediates signaling for neuronal outgrowth (By similarity). May play a role in accumulation of expanded polyglutamine (polyQ) proteins such as huntingtin (HTT) or TBP (PubMed:23303669, PubMed:25549101).", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429#function" }, { "database": "UniProtKB", "id": "P12682", "url": "https://www.uniprot.org/uniprot/P12682#function" }, { "database": "UniProtKB", "id": "P63158", "url": "https://www.uniprot.org/uniprot/P63158#function" }, { "database": "PubMed", "id": "25549101", "url": "https://glygen.org/publication/PubMed/25549101" }, { "database": "PubMed", "id": "23446148", "url": "https://glygen.org/publication/PubMed/23446148" }, { "database": "UniProtKB", "id": "P63159", "url": "https://www.uniprot.org/uniprot/P63159#function" }, { "database": "PubMed", "id": "23519706", "url": "https://glygen.org/publication/PubMed/23519706" }, { "database": "PubMed", "id": "23303669", "url": "https://glygen.org/publication/PubMed/23303669" }, { "database": "PubMed", "id": "23994764", "url": "https://glygen.org/publication/PubMed/23994764" }, { "database": "PubMed", "id": "27362237", "url": "https://glygen.org/publication/PubMed/27362237" }, { "database": "UniProtKB", "id": "P10103", "url": "https://www.uniprot.org/uniprot/P10103#function" }, { "database": "PubMed", "id": "25048472", "url": "https://glygen.org/publication/PubMed/25048472" }, { "database": "PubMed", "id": "34743181", "url": "https://glygen.org/publication/PubMed/34743181" }, { "database": "PubMed", "id": "33147444", "url": "https://glygen.org/publication/PubMed/33147444" } ] }, { "annotation": "Nuclear functions are attributed to fully reduced HGMB1. Associates with chromatin and binds DNA with a preference to non-canonical DNA structures such as single-stranded DNA, DNA-containing cruciforms or bent structures, supercoiled DNA and ZDNA. Can bent DNA and enhance DNA flexibility by looping thus providing a mechanism to promote activities on various gene promoters by enhancing transcription factor binding and/or bringing distant regulatory sequences into close proximity (PubMed:20123072). May have an enhancing role in nucleotide excision repair (NER) (By similarity). However, effects in NER using in vitro systems have been reported conflictingly (PubMed:19446504, PubMed:19360789). May be involved in mismatch repair (MMR) and base excision repair (BER) pathways (PubMed:15014079, PubMed:16143102, PubMed:17803946). May be involved in double strand break repair such as non-homologous end joining (NHEJ) (By similarity). Involved in V(D)J recombination by acting as a cofactor of the RAG complex: acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS) (By similarity). In vitro can displace histone H1 from highly bent DNA (By similarity). Can restructure the canonical nucleosome leading to relaxation of structural constraints for transcription factor-binding (By similarity). Enhances binding of sterol regulatory element-binding proteins (SREBPs) such as SREBF1 to their cognate DNA sequences and increases their transcriptional activities (By similarity). Facilitates binding of TP53 to DNA (PubMed:23063560). Proposed to be involved in mitochondrial quality control and autophagy in a transcription-dependent fashion implicating HSPB1; however, this function has been questioned (By similarity). Can modulate the activity of the telomerase complex and may be involved in telomere maintenance (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429#function" }, { "database": "PubMed", "id": "19360789", "url": "https://glygen.org/publication/PubMed/19360789" }, { "database": "PubMed", "id": "23063560", "url": "https://glygen.org/publication/PubMed/23063560" }, { "database": "UniProtKB", "id": "P63158", "url": "https://www.uniprot.org/uniprot/P63158#function" }, { "database": "PubMed", "id": "20123072", "url": "https://glygen.org/publication/PubMed/20123072" }, { "database": "UniProtKB", "id": "P63159", "url": "https://www.uniprot.org/uniprot/P63159#function" }, { "database": "PubMed", "id": "17803946", "url": "https://glygen.org/publication/PubMed/17803946" }, { "database": "PubMed", "id": "19446504", "url": "https://glygen.org/publication/PubMed/19446504" }, { "database": "UniProtKB", "id": "P10103", "url": "https://www.uniprot.org/uniprot/P10103#function" }, { "database": "PubMed", "id": "16143102", "url": "https://glygen.org/publication/PubMed/16143102" }, { "database": "PubMed", "id": "15014079", "url": "https://glygen.org/publication/PubMed/15014079" } ] }, { "annotation": "Structural changes in the retina and serum HMGB1 levels are associated with decreased cognitive function in patients with Parkinson's disease.", "evidence": [ { "database": "RefSeq", "id": "NP_001300821", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300821" }, { "database": "PubMed", "id": "38104911", "url": "https://glygen.org/publication/PubMed/38104911" } ] }, { "annotation": "The Role of High Mobility Group Box B-1 in the Prognosis of Colorectal Cancer Based on the Changes in the Intestinal Mucosal Barrier.", "evidence": [ { "database": "RefSeq", "id": "NP_001300821", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300821" }, { "database": "PubMed", "id": "38200714", "url": "https://glygen.org/publication/PubMed/38200714" } ] }, { "annotation": "This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2015].", "evidence": [ { "database": "RefSeq", "id": "NP_001300821", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300821" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs775952971", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775952971" }, { "id": "rs775952971", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775952971" }, { "id": "rs775952971", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775952971" }, { "id": "rs775952971", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775952971" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 100, "end_pos": 100, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->L).", "chr_id": "13", "chr_pos": "30462710", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S100", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P09429", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P09429" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 107, "end_pos": 107, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "C", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->C).", "chr_id": "13", "chr_pos": "30462689", "ref_nt": "G", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "S107", "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1312166825", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1312166825" }, { "id": "rs1312166825", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1312166825#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 137, "end_pos": 137, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NTA->NTT).", "chr_id": "13", "chr_pos": "30462600", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A137", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 106, "end_pos": 106, "sequence_org": "C", "sequence_mut": "S", "comment": "Inhibits oxidation-dependent inactivation of immunostimmulatory activity in apoptotic cells.", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" }, { "database": "PubMed", "id": "18631454", "url": "https://glygen.org/publication/PubMed/18631454" } ] }, { "start_pos": 181, "end_pos": 181, "sequence_org": "S", "sequence_mut": "A", "comment": "Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-39; A-42; A-46 and A-53.", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" }, { "database": "PubMed", "id": "17114460", "url": "https://glygen.org/publication/PubMed/17114460" } ] }, { "start_pos": 181, "end_pos": 181, "sequence_org": "S", "sequence_mut": "E", "comment": "Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-39; E-42; E-46 and E-53.", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" }, { "database": "PubMed", "id": "17114460", "url": "https://glygen.org/publication/PubMed/17114460" } ] }, { "start_pos": 35, "end_pos": 35, "sequence_org": "S", "sequence_mut": "A", "comment": "Greatly reduces phosphorylation, nuclear localization; when associated with A-39; A-42; A-46; A-53 and A-181.", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" }, { "database": "PubMed", "id": "17114460", "url": "https://glygen.org/publication/PubMed/17114460" } ] }, { "start_pos": 35, "end_pos": 35, "sequence_org": "S", "sequence_mut": "E", "comment": "Cytoplasmic localization (phosphorylation mimicking); when associated with E-39; E-42; E-46; E-53 and E-181.", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" }, { "database": "PubMed", "id": "17114460", "url": "https://glygen.org/publication/PubMed/17114460" } ] }, { "start_pos": 39, "end_pos": 39, "sequence_org": "S", "sequence_mut": "A", "comment": "Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-42; A-46; A-53 and A-181.", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" }, { "database": "PubMed", "id": "17114460", "url": "https://glygen.org/publication/PubMed/17114460" } ] }, { "start_pos": 39, "end_pos": 39, "sequence_org": "S", "sequence_mut": "E", "comment": "Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-42; E-46; E-53 and E-181.", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" }, { "database": "PubMed", "id": "17114460", "url": "https://glygen.org/publication/PubMed/17114460" } ] }, { "start_pos": 42, "end_pos": 42, "sequence_org": "S", "sequence_mut": "A", "comment": "Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-39; A-46; A-53 and A-181.", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" }, { "database": "PubMed", "id": "17114460", "url": "https://glygen.org/publication/PubMed/17114460" } ] }, { "start_pos": 42, "end_pos": 42, "sequence_org": "S", "sequence_mut": "E", "comment": "Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-39; E-46; E-53 and E-181.", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" }, { "database": "PubMed", "id": "17114460", "url": "https://glygen.org/publication/PubMed/17114460" } ] }, { "start_pos": 46, "end_pos": 46, "sequence_org": "S", "sequence_mut": "A", "comment": "Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-39; A-42; A-53 and A-181.", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" }, { "database": "PubMed", "id": "17114460", "url": "https://glygen.org/publication/PubMed/17114460" } ] }, { "start_pos": 46, "end_pos": 46, "sequence_org": "S", "sequence_mut": "E", "comment": "Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-39; E-42; E-53 and E-181.", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" }, { "database": "PubMed", "id": "17114460", "url": "https://glygen.org/publication/PubMed/17114460" } ] }, { "start_pos": 53, "end_pos": 53, "sequence_org": "S", "sequence_mut": "A", "comment": "Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-39; A-42; A-46 and A-181.", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" }, { "database": "PubMed", "id": "17114460", "url": "https://glygen.org/publication/PubMed/17114460" } ] }, { "start_pos": 53, "end_pos": 53, "sequence_org": "S", "sequence_mut": "E", "comment": "Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-39; E-42; E-46 and E-181.", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" }, { "database": "PubMed", "id": "17114460", "url": "https://glygen.org/publication/PubMed/17114460" } ] }, { "start_pos": 67, "end_pos": 67, "sequence_org": "D", "sequence_mut": "A", "comment": "Abolishes cleavage by CASP1 and impairs ability to antagonize apoptosis-induced immune tolerance.", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" }, { "database": "PubMed", "id": "24474694", "url": "https://glygen.org/publication/PubMed/24474694" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "98.81", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000189403", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000189403" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "98.98", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000189403", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000189403" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "97.79", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000189403", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000189403" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.35", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000189403", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000189403" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "99.53", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000189403", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000189403" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "99.25", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000189403", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000189403" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "99.38", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000189403", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000189403" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "98.03", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000189403", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000189403" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "99.29", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000189403", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000189403" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "99.37", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000189403", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000189403" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P09429", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09429" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P09429", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09429" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P09429", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09429" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P09429", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09429" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P09429", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09429" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P09429", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09429" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P09429", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09429" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P09429", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09429" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P09429", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09429" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P09429", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09429" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P09429", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09429" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P09429", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09429" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "common_name": "Human" } ], "gene": [ { "name": "HMGB1", "url": "https://www.uniprot.org/uniprot/P09429", "locus": { "chromosome": "13", "start_pos": 30456704, "end_pos": 30617597, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000189403", "url": "https://www.ensembl.org/id/ENSG00000189403" } ] } } ], "crossref": [ { "id": "ENSG00000189403", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000189403", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P09429", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P09429", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd21978", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd21978", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd21979", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd21979", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL2311236", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2311236", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "HMGB1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=HMGB1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "3146", "url": "https://www.ncbi.nlm.nih.gov/gene/3146", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "4983", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4983", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P09429", "url": "https://www.ebi.ac.uk/intact/interactors/id:P09429*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR009071", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009071", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017967", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017967", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036910", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036910", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:3146", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3146", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "163905", "url": "http://www.omim.org/entry/163905", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P09429", "url": "https://www.nextprot.org/entry/NX_P09429", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P09429", "url": "https://oglcnac.org/atlas/detail/P09429", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P09429", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09429", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "PHSANEV", "url": "https://omabrowser.org/oma/group/PHSANEV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1222485at2759", "url": "http://www.orthodb.org/?query=1222485at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR48112", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48112", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR48112:SF12", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48112:SF12", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2LY4", "url": "https://www.rcsb.org/structure/2LY4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2RTU", "url": "https://www.rcsb.org/structure/2RTU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2YRQ", "url": "https://www.rcsb.org/structure/2YRQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6CG0", "url": "https://www.rcsb.org/structure/6CG0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6CIJ", "url": "https://www.rcsb.org/structure/6CIJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6CIK", "url": "https://www.rcsb.org/structure/6CIK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6CIL", "url": "https://www.rcsb.org/structure/6CIL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6CIM", "url": "https://www.rcsb.org/structure/6CIM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6OEM", "url": "https://www.rcsb.org/structure/6OEM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6OEN", "url": "https://www.rcsb.org/structure/6OEN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6OEO", "url": "https://www.rcsb.org/structure/6OEO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00505", "url": "http://pfam.xfam.org/family/PF00505", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF09011", "url": "http://pfam.xfam.org/family/PF09011", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P09429", "url": "https://pharos.nih.gov/targets/P09429", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P09429", "url": "http://purl.obolibrary.org/obo/PR_P09429", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-140342", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140342", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-445989", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5602498", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5602498", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5603041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5603041", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-879415", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879415", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-933542", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933542", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001300821", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300821", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P09429-1", "url": "https://www.uniprot.org/uniprot/P09429-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5T7C4", "url": "https://www.uniprot.org/uniprot/Q5T7C4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5T7C4-1", "url": "https://www.uniprot.org/uniprot/Q5T7C4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE", "length": 215, "header": "sp|P09429-1|HMGB1_HUMAN Isoform 1 of High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3 CANONICAL=P09429-1" }, "isoforms": [ { "isoform_ac": "P09429-1", "url": "", "sequence": { "sequence": "MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE", "length": 215, "header": "sp|P09429-1|HMGB1_HUMAN Isoform 1 of High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3 CANONICAL=P09429-1" }, "locus": { "chromosome": "13", "start_pos": 30463680, "end_pos": 30461360, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000341423.10", "url": "https://www.ensembl.org/id/ENST00000341423.10" }, { "database": "Ensembl Peptide", "id": "ENSP00000345347.5", "url": "https://www.ensembl.org/id/ENSP00000345347.5" } ] } }, { "isoform_ac": "Q5T7C4-1", "url": "", "sequence": { "sequence": "MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKF", "length": 158, "header": "tr|Q5T7C4-1|Q5T7C4_HUMAN Computationally mapped isoform of High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=1 CANONICAL=P09429-1" }, "locus": { "chromosome": "13", "start_pos": 30463680, "end_pos": 30461686, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000326004.4", "url": "https://www.ensembl.org/id/ENST00000326004.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000369904.1", "url": "https://www.ensembl.org/id/ENSP00000369904.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 100, "start_aa": "Ser", "end_pos": 100, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser100", "evidence": [ { "id": "P09429", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09429" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "34546745", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34546745" }, { "id": "P09429", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P09429" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 107, "start_aa": "Ser", "end_pos": 107, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser107", "evidence": [ { "id": "P09429", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09429" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "34546745", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34546745" }, { "id": "P09429", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P09429" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 22, "start_aa": "Thr", "end_pos": 22, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr22", "evidence": [ { "id": "P09429", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09429" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "34546745", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34546745" } ] } ], "phosphorylation": [ { "start_pos": 100, "end_pos": 100, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "iPTMnet", "id": "P09429", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09429" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" } ], "site_lbl": "Ser100" }, { "start_pos": 109, "end_pos": 109, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P09429", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09429" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Tyr109" }, { "start_pos": 121, "end_pos": 121, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P09429", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09429" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser121" }, { "start_pos": 155, "end_pos": 155, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P09429", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09429" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" } ], "site_lbl": "Tyr155" }, { "start_pos": 162, "end_pos": 162, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P09429", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09429" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "20068230", "url": "https://glygen.org/publication/PubMed/20068230" } ], "site_lbl": "Tyr162" }, { "start_pos": 35, "end_pos": 35, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "P09429", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09429" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "phospho.ELM", "id": "P09429", "url": "http://phospho.elm.eu.org/byAccession/P09429.html" } ], "site_lbl": "Ser35" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Activation of the apoptotic endonuclease DFF40 (caspase-activated DNase or nuclease). Oligomerization and direct interaction with histone H1.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Liu X, Zou H, Widlak P, Garrard W, Wang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-140342", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140342" } ], "reference": [ { "type": "PubMed", "id": "10318789", "url": "https://glygen.org/publication/PubMed/10318789" } ] }, { "title": "ECSIT is an evolutionarily conserved intermediate in the Toll/IL-1 signal transduction pathway.", "journal": "Genes & development", "date": "1999", "authors": "Kopp E, Medzhitov R, Carothers J, Xiao C, Douglas I, Janeway CA, Ghosh S", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "10465784", "url": "https://glygen.org/publication/PubMed/10465784" } ] }, { "title": "N(epsilon)-(carboxymethyl)lysine adducts of proteins are ligands for receptor for advanced glycation end products that activate cell signaling pathways and modulate gene expression.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Kislinger T, Fu C, Huber B, Qu W, Taguchi A, Du Yan S, Hofmann M, Yan SF, Pischetsrieder M, Stern D, Schmidt AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-879415", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879415" } ], "reference": [ { "type": "PubMed", "id": "10531386", "url": "https://glygen.org/publication/PubMed/10531386" } ] }, { "title": "Cleavage preferences of the apoptotic endonuclease DFF40 (caspase-activated DNase or nuclease) on naked DNA and chromatin substrates.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Widlak P, Li P, Wang X, Garrard WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-140342", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140342" } ], "reference": [ { "type": "PubMed", "id": "10713148", "url": "https://glygen.org/publication/PubMed/10713148" } ] }, { "title": "Activation of NF-kappa B by the dsRNA-dependent protein kinase, PKR involves the I kappa B kinase complex.", "journal": "Oncogene", "date": "2000", "authors": "Gil J, Alcami J, Esteban M", "evidence": [ { "database": "Reactome", "id": "R-HSA-445989", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989" } ], "reference": [ { "type": "PubMed", "id": "10723127", "url": "https://glygen.org/publication/PubMed/10723127" } ] }, { "title": "Occurrence of amphoterin (HMG1) as an endogenous protein of human platelets that is exported to the cell surface upon platelet activation.", "journal": "Thromb. Haemost.", "date": "2000", "authors": "Rouhiainen A, Imai S, Rauvala H, Parkkinen J", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "11154118", "url": "https://glygen.org/publication/PubMed/11154118" } ] }, { "title": "Fibrinogen stimulates macrophage chemokine secretion through toll-like receptor 4.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001", "authors": "Smiley ST, King JA, Hancock WW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "11509636", "url": "https://glygen.org/publication/PubMed/11509636" } ] }, { "title": "Mal (MyD88-adapter-like) is required for Toll-like receptor-4 signal transduction.", "journal": "Nature", "date": "2001", "authors": "Fitzgerald KA, Palsson-McDermott EM, Bowie AG, Jefferies CA, Mansell AS, Brady G, Brint E, Dunne A, Gray P, Harte MT, McMurray D, Smith DE, Sims JE, Bird TA, O'Neill LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "11544529", "url": "https://glygen.org/publication/PubMed/11544529" } ] }, { "title": "Surfactant protein A inhibits peptidoglycan-induced tumor necrosis factor-alpha secretion in U937 cells and alveolar macrophages by direct interaction with toll-like receptor 2.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Murakami S, Iwaki D, Mitsuzawa H, Sano H, Takahashi H, Voelker DR, Akino T, Kuroki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "11724772", "url": "https://glygen.org/publication/PubMed/11724772" } ] }, { "title": "IRAK-4: a novel member of the IRAK family with the properties of an IRAK-kinase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Li S, Strelow A, Fontana EJ, Wesche H", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "11960013", "url": "https://glygen.org/publication/PubMed/11960013" } ] }, { "title": "Release of chromatin protein HMGB1 by necrotic cells triggers inflammation.", "journal": "Nature", "date": "2002", "authors": "Scaffidi P, Misteli T, Bianchi ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "12110890", "url": "https://glygen.org/publication/PubMed/12110890" } ] }, { "title": "Identification of threonine 66 as a functionally critical residue of the interleukin-1 receptor-associated kinase.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Ross K, Yang L, Dower S, Volpe F, Guesdon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "12138165", "url": "https://glygen.org/publication/PubMed/12138165" } ] }, { "title": "Distinct molecular mechanism for initiating TRAF6 signalling.", "journal": "Nature", "date": "2002", "authors": "Ye H, Arron JR, Lamothe B, Cirilli M, Kobayashi T, Shevde NK, Segal D, Dzivenu OK, Vologodskaia M, Yim M, Du K, Singh S, Pike JW, Darnay BG, Choi Y, Wu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "12140561", "url": "https://glygen.org/publication/PubMed/12140561" } ] }, { "title": "Protective role of phospholipid oxidation products in endotoxin-induced tissue damage.", "journal": "Nature", "date": "2002", "authors": "Bochkov VN, Kadl A, Huber J, Gruber F, Binder BR, Leitinger N", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "12214235", "url": "https://glygen.org/publication/PubMed/12214235" } ] }, { "title": "IKKalpha, IKKbeta, and NEMO/IKKgamma are each required for the NF-kappa B-mediated inflammatory response program.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Li X, Massa PE, Hanidu A, Peet GW, Aro P, Savitt A, Mische S, Li J, Marcu KB", "evidence": [ { "database": "Reactome", "id": "R-HSA-933542", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933542" } ], "reference": [ { "type": "PubMed", "id": "12221085", "url": "https://glygen.org/publication/PubMed/12221085" } ] }, { "title": "The nuclear protein HMGB1 is secreted by monocytes via a non-classical, vesicle-mediated secretory pathway.", "journal": "EMBO Rep.", "date": "2002", "authors": "Gardella Stefania, Andrei Cristina, Ferrera Denise, Lotti Lavinia V, Torrisi Maria R, Bianchi Marco E, Rubartelli Anna", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "12231511", "url": "https://glygen.org/publication/PubMed/12231511" } ] }, { "title": "IRAK-4 as the central TIR signaling mediator in innate immunity.", "journal": "Trends in immunology", "date": "2002", "authors": "Suzuki N, Suzuki S, Yeh WC", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "12297423", "url": "https://glygen.org/publication/PubMed/12297423" } ] }, { "title": "Essential role for TIRAP in activation of the signalling cascade shared by TLR2 and TLR4.", "journal": "Nature", "date": "2002", "authors": "Yamamoto M, Sato S, Hemmi H, Sanjo H, Uematsu S, Kaisho T, Hoshino K, Takeuchi O, Kobayashi M, Fujita T, Takeda K, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "12447441", "url": "https://glygen.org/publication/PubMed/12447441" } ] }, { "title": "The adaptor molecule TIRAP provides signalling specificity for Toll-like receptors.", "journal": "Nature", "date": "2002", "authors": "Horng T, Barton GM, Flavell RA, Medzhitov R", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "12447442", "url": "https://glygen.org/publication/PubMed/12447442" } ] }, { "title": "Solution NMR structure of S100B bound to the high-affinity target peptide TRTK-12.", "journal": "Journal of molecular biology", "date": "2002", "authors": "Inman KG, Yang R, Rustandi RR, Miller KE, Baldisseri DM, Weber DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-879415", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879415" } ], "reference": [ { "type": "PubMed", "id": "12470955", "url": "https://glygen.org/publication/PubMed/12470955" } ] }, { "title": "Pyogenic bacterial infections in humans with IRAK-4 deficiency.", "journal": "Science (New York, N.Y.)", "date": "2003", "authors": "Picard C, Puel A, Bonnet M, Ku CL, Bustamante J, Yang K, Soudais C, Dupuis S, Feinberg J, Fieschi C, Elbim C, Hitchcock R, Lammas D, Davies G, Al-Ghonaium A, Al-Rayes H, Al-Jumaah S, Al-Hajjar S, Al-Mohsen IZ, Frayha HH, Rucker R, Hawn TR, Aderem A, Tufenkeji H, Haraguchi S, Day NK, Good RA, Gougerot-Pocidalo MA, Ozinsky A, Casanova JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5603041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5603041" } ], "reference": [ { "type": "PubMed", "id": "12637671", "url": "https://glygen.org/publication/PubMed/12637671" } ] }, { "title": "Bruton's tyrosine kinase is a Toll/interleukin-1 receptor domain-binding protein that participates in nuclear factor kappaB activation by Toll-like receptor 4.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Jefferies CA, Doyle S, Brunner C, Dunne A, Brint E, Wietek C, Walch E, Wirth T, O'Neill LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "12724322", "url": "https://glygen.org/publication/PubMed/12724322" } ] }, { "title": "Subunit structures and stoichiometries of human DNA fragmentation factor proteins before and after induction of apoptosis.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Widlak P, Lanuszewska J, Cary RB, Garrard WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-140342", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140342" } ], "reference": [ { "type": "PubMed", "id": "12748178", "url": "https://glygen.org/publication/PubMed/12748178" } ] }, { "title": "Structural basis for the proinflammatory cytokine activity of high mobility group box 1.", "journal": "Molecular medicine (Cambridge, Mass.)", "date": "2003", "authors": "Li Jianhua, Kokkola Riikka, Tabibzadeh Siamak, Yang Runkuan, Ochani Mahendar, Qiang Xiaoling, Harris Helena E, Czura Christopher J, Wang Haichao, Ulloa Luis, Wang Hong, Warren H Shaw, Moldawer Lyle L, Fink Mitchell P, Andersson Ulf, Tracey Kevin J, Yang Huan", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "12765338", "url": "https://glygen.org/publication/PubMed/12765338" } ] }, { "title": "Direct binding of Toll-like receptor 2 to zymosan, and zymosan-induced NF-kappa B activation and TNF-alpha secretion are down-regulated by lung collectin surfactant protein A.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2003", "authors": "Sato M, Sano H, Iwaki D, Kudo K, Konishi M, Takahashi H, Takahashi T, Imaizumi H, Asai Y, Kuroki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "12817025", "url": "https://glygen.org/publication/PubMed/12817025" } ] }, { "title": "The receptor for advanced glycation end-products (RAGE) directly binds to ERK by a D-domain-like docking site.", "journal": "FEBS letters", "date": "2003", "authors": "Ishihara K, Tsutsumi K, Kawane S, Nakajima M, Kasaoka T", "evidence": [ { "database": "Reactome", "id": "R-HSA-879415", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879415" } ], "reference": [ { "type": "PubMed", "id": "12935895", "url": "https://glygen.org/publication/PubMed/12935895" } ] }, { "title": "Monocytic cells hyperacetylate chromatin protein HMGB1 to redirect it towards secretion.", "journal": "EMBO J.", "date": "2003", "authors": "Bonaldi T, Talamo F, Scaffidi P, Ferrera D, Porto A, Bachi A, Rubartelli A, Agresti A, Bianchi ME", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "14532127", "url": "https://glygen.org/publication/PubMed/14532127" } ] }, { "title": "Sequential autophosphorylation steps in the interleukin-1 receptor-associated kinase-1 regulate its availability as an adapter in interleukin-1 signaling.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Kollewe C, Mackensen AC, Neumann D, Knop J, Cao P, Li S, Wesche H, Martin MU", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "14625308", "url": "https://glygen.org/publication/PubMed/14625308" } ] }, { "title": "Reversing established sepsis with antagonists of endogenous high-mobility group box 1.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2004", "authors": "Yang Huan, Ochani Mahendar, Li Jianhua, Qiang Xiaoling, Tanovic Mahira, Harris Helena E, Susarla Srinivas M, Ulloa Luis, Wang Hong, DiRaimo Robert, Czura Christopher J, Wang Haichao, Roth Jesse, Warren H Shaw, Fink Mitchell P, Fenton Matthew J, Andersson Ulf, Tracey Kevin J", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "14695889", "url": "https://glygen.org/publication/PubMed/14695889" } ] }, { "title": "Evidence for involvement of HMGB1 protein in human DNA mismatch repair.", "journal": "The Journal of biological chemistry", "date": "2004-05-14", "authors": "Yuan Fenghua, Gu Liya, Guo Shuangli, Wang Chunmei, Li Guo-Min", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "15014079", "url": "https://glygen.org/publication/PubMed/15014079" } ] }, { "title": "The two NF-kappaB activation pathways and their role in innate and adaptive immunity.", "journal": "Trends in immunology", "date": "2004", "authors": "Bonizzi G, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-445989", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989" } ], "reference": [ { "type": "PubMed", "id": "15145317", "url": "https://glygen.org/publication/PubMed/15145317" } ] }, { "title": "Structural mechanism for inactivation and activation of CAD/DFF40 in the apoptotic pathway.", "journal": "Molecular cell", "date": "2004", "authors": "Woo EJ, Kim YG, Kim MS, Han WD, Shin S, Robinson H, Park SY, Oh BH", "evidence": [ { "database": "Reactome", "id": "R-HSA-140342", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140342" } ], "reference": [ { "type": "PubMed", "id": "15149602", "url": "https://glygen.org/publication/PubMed/15149602" } ] }, { "title": "Nuclear translocation of caspase-3 is dependent on its proteolytic activation and recognition of a substrate-like protein(s).", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Kamada S, Kikkawa U, Tsujimoto Y, Hunter T", "evidence": [ { "database": "Reactome", "id": "R-HSA-140342", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140342" } ], "reference": [ { "type": "PubMed", "id": "15569692", "url": "https://glygen.org/publication/PubMed/15569692" } ] }, { "title": "Toll-like receptors in innate immunity.", "journal": "International immunology", "date": "2005", "authors": "Takeda K, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "15585605", "url": "https://glygen.org/publication/PubMed/15585605" } ] }, { "title": "Monocytes promote natural killer cell interferon gamma production in response to the endogenous danger signal HMGB1.", "journal": "Molecular immunology", "date": "2005-02", "authors": "DeMarco Richard A, Fink Mitchell P, Lotze Michael T", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "15607795", "url": "https://glygen.org/publication/PubMed/15607795" } ] }, { "title": "The N-terminal domain of thrombomodulin sequesters high-mobility group-B1 protein, a novel antiinflammatory mechanism.", "journal": "J. Clin. Invest.", "date": "2005", "authors": "Abeyama Kazuhiro, Stern David M, Ito Yuji, Kawahara Ko-ichi, Yoshimoto Yasushi, Tanaka Motoyuki, Uchimura Tomonori, Ida Nobuo, Yamazaki Yoshiaki, Yamada Shingo, Yamamoto Yasuhiko, Yamamoto Hiroshi, Iino Satoshi, Taniguchi Noboru, Maruyama Ikuro", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "15841214", "url": "https://glygen.org/publication/PubMed/15841214" } ] }, { "title": "The histone H1 C-terminal domain binds to the apoptotic nuclease, DNA fragmentation factor (DFF40/CAD) and stimulates DNA cleavage.", "journal": "Biochemistry", "date": "2005", "authors": "Widlak P, Kalinowska M, Parseghian MH, Lu X, Hansen JC, Garrard WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-140342", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140342" } ], "reference": [ { "type": "PubMed", "id": "15910001", "url": "https://glygen.org/publication/PubMed/15910001" } ] }, { "title": "Release of high mobility group box 1 by dendritic cells controls T cell activation via the receptor for advanced glycation end products.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005-06-15", "authors": "Dumitriu Ingrid E, Baruah Paramita, Valentinis Barbara, Voll Reinhard E, Herrmann Martin, Nawroth Peter P, Arnold Bernd, Bianchi Marco E, Manfredi Angelo A, Rovere-Querini Patrizia", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "15944249", "url": "https://glygen.org/publication/PubMed/15944249" } ] }, { "title": "Bruton's Tyrosine Kinase is involved in innate and adaptive immunity.", "journal": "Histology and histopathology", "date": "2005", "authors": "Brunner C, Muller B, Wirth T", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "15944945", "url": "https://glygen.org/publication/PubMed/15944945" } ] }, { "title": "A novel splice variant of interleukin-1 receptor (IL-1R)-associated kinase 1 plays a negative regulatory role in Toll/IL-1R-induced inflammatory signaling.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Rao N, Nguyen S, Ngo K, Fung-Leung WP", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "16024789", "url": "https://glygen.org/publication/PubMed/16024789" } ] }, { "title": "Ubiquitin signalling in the NF-kappaB pathway.", "journal": "Nature cell biology", "date": "2005", "authors": "Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-445989", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989" } ], "reference": [ { "type": "PubMed", "id": "16056267", "url": "https://glygen.org/publication/PubMed/16056267" } ] }, { "title": "Reconstitution of 5'-directed human mismatch repair in a purified system.", "journal": "Cell", "date": "2005", "authors": "Zhang Y, Yuan F, Presnell SR, Tian K, Gao Y, Tomkinson AE, Gu L, Li GM", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "16143102", "url": "https://glygen.org/publication/PubMed/16143102" } ] }, { "title": "Surfactant proteins SP-A and SP-D: structure, function and receptors.", "journal": "Molecular immunology", "date": "2006", "authors": "Kishore U, Greenhough TJ, Waters P, Shrive AK, Ghai R, Kamran MF, Bernal AL, Reid KB, Madan T, Chakraborty T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "16213021", "url": "https://glygen.org/publication/PubMed/16213021" } ] }, { "title": "MyD88 adapter-like (Mal) is phosphorylated by Bruton's tyrosine kinase during TLR2 and TLR4 signal transduction.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Gray P, Dunne A, Brikos C, Jefferies CA, Doyle SL, O'Neill LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "16439361", "url": "https://glygen.org/publication/PubMed/16439361" } ] }, { "title": "Two novel rat liver membrane proteins that bind advanced glycosylation endproducts: relationship to macrophage receptor for glucose-modified proteins.", "journal": "The Journal of experimental medicine", "date": "1991", "authors": "Yang Z, Makita Z, Horii Y, Brunelle S, Cerami A, Sehajpal P, Suthanthiran M, Vlassara H", "evidence": [ { "database": "Reactome", "id": "R-HSA-879415", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879415" } ], "reference": [ { "type": "PubMed", "id": "1651976", "url": "https://glygen.org/publication/PubMed/1651976" } ] }, { "title": "Phosphoinositide-mediated adaptor recruitment controls Toll-like receptor signaling.", "journal": "Cell", "date": "2006", "authors": "Kagan JC, Medzhitov R", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "16751103", "url": "https://glygen.org/publication/PubMed/16751103" } ] }, { "title": "Surfactant protein A directly interacts with TLR4 and MD-2 and regulates inflammatory cellular response. Importance of supratrimeric oligomerization.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Yamada C, Sano H, Shimizu T, Mitsuzawa H, Nishitani C, Himi T, Kuroki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "16754682", "url": "https://glygen.org/publication/PubMed/16754682" } ] }, { "title": "Human pulmonary surfactant protein D binds the extracellular domains of Toll-like receptors 2 and 4 through the carbohydrate recognition domain by a mechanism different from its binding to phosphatidylinositol and lipopolysaccharide.", "journal": "Biochemistry", "date": "2006", "authors": "Ohya M, Nishitani C, Sano H, Yamada C, Mitsuzawa H, Shimizu T, Saito T, Smith K, Crouch E, Kuroki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "16834340", "url": "https://glygen.org/publication/PubMed/16834340" } ] }, { "title": "The extracellular release of HMGB1 during apoptotic cell death.", "journal": "Am. J. Physiol.", "date": "2006", "authors": "Bell CW, Jiang W, Reich CF 3rd, Pisetsky DS", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" }, { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "16855214", "url": "https://glygen.org/publication/PubMed/16855214" } ] }, { "title": "HMGB1 signals through toll-like receptor (TLR) 4 and TLR2.", "journal": "Shock (Augusta, Ga.)", "date": "2006", "authors": "Yu M, Wang H, Ding A, Golenbock DT, Latz E, Czura CJ, Fenton MJ, Tracey KJ, Yang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "16878026", "url": "https://glygen.org/publication/PubMed/16878026" } ] }, { "title": "The potential role of DFNA5, a hearing impairment gene, in p53-mediated cellular response to DNA damage.", "journal": "Journal of human genetics", "date": "2006", "authors": "Masuda Y, Futamura M, Kamino H, Nakamura Y, Kitamura N, Ohnishi S, Miyamoto Y, Ichikawa H, Ohta T, Ohki M, Kiyono T, Egami H, Baba H, Arakawa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "16897187", "url": "https://glygen.org/publication/PubMed/16897187" } ] }, { "title": "Molecular basis for the redox control of nuclear transport of the structural chromatin protein Hmgb1.", "journal": "Experimental cell research", "date": "2006", "authors": "Hoppe G, Talcott KE, Bhattacharya SK, Crabb JW, Sears JE", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "16962095", "url": "https://glygen.org/publication/PubMed/16962095" } ] }, { "title": "Regulation and function of IKK and IKK-related kinases.", "journal": "Science's STKE : signal transduction knowledge environment", "date": "2006", "authors": "Hacker H, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-445989", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989" } ], "reference": [ { "type": "PubMed", "id": "17047224", "url": "https://glygen.org/publication/PubMed/17047224" } ] }, { "title": "Nucleocytoplasmic shuttling of HMGB1 is regulated by phosphorylation that redirects it toward secretion.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2006", "authors": "Youn JH, Shin JS", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "17114460", "url": "https://glygen.org/publication/PubMed/17114460" } ] }, { "title": "Regulation of IRAK-4 kinase activity via autophosphorylation within its activation loop.", "journal": "Biochemical and biophysical research communications", "date": "2007", "authors": "Cheng H, Addona T, Keshishian H, Dahlstrand E, Lu C, Dorsch M, Li Z, Wang A, Ocain TD, Li P, Parsons TF, Jaffee B, Xu Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "17141195", "url": "https://glygen.org/publication/PubMed/17141195" } ] }, { "title": "Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Molina H, Horn DM, Tang N, Mathivanan S, Pandey A", "evidence": [ { "database": "iPTMnet", "id": "P09429", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09429" } ], "reference": [ { "type": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" } ] }, { "title": "Essential role of IRAK-4 protein and its kinase activity in Toll-like receptor-mediated immune responses but not in TCR signaling.", "journal": "The Journal of experimental medicine", "date": "2007", "authors": "Kawagoe T, Sato S, Jung A, Yamamoto M, Matsui K, Kato H, Uematsu S, Takeuchi O, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "17485511", "url": "https://glygen.org/publication/PubMed/17485511" } ] }, { "title": "The genetic variation of the human HMGB1 gene.", "journal": "Tissue Antigens", "date": "2007", "authors": "Kornblit B, Munthe-Fog L, Petersen S L, Madsen H O, Vindel\u00f8v L, Garred P", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "17610420", "url": "https://glygen.org/publication/PubMed/17610420" } ] }, { "title": "A dimer of the Toll-like receptor 4 cytoplasmic domain provides a specific scaffold for the recruitment of signalling adaptor proteins.", "journal": "PloS one", "date": "2007", "authors": "Nunez Miguel R, Wong J, Westoll JF, Brooks HJ, O'Neill LA, Gay NJ, Bryant CE, Monie TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "17726518", "url": "https://glygen.org/publication/PubMed/17726518" } ] }, { "title": "Identification of TRAF6-dependent NEMO polyubiquitination sites through analysis of a new NEMO mutation causing incontinentia pigmenti.", "journal": "Human molecular genetics", "date": "2007", "authors": "Sebban-Benin H, Pescatore A, Fusco F, Pascuale V, Gautheron J, Yamaoka S, Moncla A, Ursini MV, Courtois G", "evidence": [ { "database": "Reactome", "id": "R-HSA-445989", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989" } ], "reference": [ { "type": "PubMed", "id": "17728323", "url": "https://glygen.org/publication/PubMed/17728323" } ] }, { "title": "Mrp8 and Mrp14 are endogenous activators of Toll-like receptor 4, promoting lethal, endotoxin-induced shock.", "journal": "Nature medicine", "date": "2007", "authors": "Vogl T, Tenbrock K, Ludwig S, Leukert N, Ehrhardt C, van Zoelen MA, Nacken W, Foell D, van der Poll T, Sorg C, Roth J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "17767165", "url": "https://glygen.org/publication/PubMed/17767165" } ] }, { "title": "HMGB1 is a cofactor in mammalian base excision repair.", "journal": "Molecular cell", "date": "2007-09-07", "authors": "Prasad Rajendra, Liu Yuan, Deterding Leesa J, Poltoratsky Vladimir P, Kedar Padmini S, Horton Julie K, Kanno Shin-Ichiro, Asagoshi Kenjiro, Hou Esther W, Khodyreva Svetlana N, Lavrik Olga I, Tomer Kenneth B, Yasui Akira, Wilson Samuel H", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "17803946", "url": "https://glygen.org/publication/PubMed/17803946" } ] }, { "title": "IRAK-2 participates in multiple toll-like receptor signaling pathways to NFkappaB via activation of TRAF6 ubiquitination.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Keating SE, Maloney GM, Moran EM, Bowie AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "17878161", "url": "https://glygen.org/publication/PubMed/17878161" } ] }, { "title": "TLR9 activation induces normal neutrophil responses in a child with IRAK-4 deficiency: involvement of the direct PI3K pathway.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Hoarau C, Gerard B, Lescanne E, Henry D, Francois S, Lacapere JJ, El Benna J, Dang PM, Grandchamp B, Lebranchu Y, Gougerot-Pocidalo MA, Elbim C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5603041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5603041" } ], "reference": [ { "type": "PubMed", "id": "17878374", "url": "https://glygen.org/publication/PubMed/17878374" } ] }, { "title": "IRAK1: a critical signaling mediator of innate immunity.", "journal": "Cellular signalling", "date": "2008", "authors": "Gottipati S, Rao NL, Fung-Leung WP", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "17890055", "url": "https://glygen.org/publication/PubMed/17890055" } ] }, { "title": "Selective predisposition to bacterial infections in IRAK-4-deficient children: IRAK-4-dependent TLRs are otherwise redundant in protective immunity.", "journal": "The Journal of experimental medicine", "date": "2007", "authors": "Ku CL, von Bernuth H, Picard C, Zhang SY, Chang HH, Yang K, Chrabieh M, Issekutz AC, Cunningham CK, Gallin J, Holland SM, Roifman C, Ehl S, Smart J, Tang M, Barrat FJ, Levy O, McDonald D, Day-Good NK, Miller R, Takada H, Hara T, Al-Hajjar S, Al-Ghonaium A, Speert D, Sanlaville D, Li X, Geissmann F, Vivier E, Marodi L, Garty BZ, Chapel H, Rodriguez-Gallego C, Bossuyt X, Abel L, Puel A, Casanova JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5603041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5603041" } ], "reference": [ { "type": "PubMed", "id": "17893200", "url": "https://glygen.org/publication/PubMed/17893200" } ] }, { "title": "Sequence elements in both subunits of the DNA fragmentation factor are essential for its nuclear transport.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Neimanis S, Albig W, Doenecke D, Kahle J", "evidence": [ { "database": "Reactome", "id": "R-HSA-140342", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140342" } ], "reference": [ { "type": "PubMed", "id": "17938174", "url": "https://glygen.org/publication/PubMed/17938174" } ] }, { "title": "Tyrosine phosphorylation of MyD88 adapter-like (Mal) is critical for signal transduction and blocked in endotoxin tolerance.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Piao W, Song C, Chen H, Wahl LM, Fitzgerald KA, O'Neill LA, Medvedev AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "18070880", "url": "https://glygen.org/publication/PubMed/18070880" } ] }, { "title": "TRAF6 distinctively mediates MyD88- and IRAK-1-induced activation of NF-kappaB.", "journal": "Journal of leukocyte biology", "date": "2008", "authors": "Muroi M, Tanamoto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "18070982", "url": "https://glygen.org/publication/PubMed/18070982" } ] }, { "title": "Proteomic screen defines the hepatocyte nuclear factor 1alpha-binding partners and identifies HMGB1 as a new cofactor of HNF1alpha.", "journal": "Nucleic Acids Res.", "date": "2008", "authors": "Yu Miao, Wang Jian, Li Wei, Yuan Yan Zhi, Li Chang Yan, Qian Xiao Hong, Xu Wang Xiang, Zhan Yi Qun, Yang Xiao Ming", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "18160415", "url": "https://glygen.org/publication/PubMed/18160415" } ] }, { "title": "High mobility group proteins stimulate DNA cleavage by apoptotic endonuclease DFF40/CAD due to HMG-box interactions with DNA.", "journal": "Acta biochimica Polonica", "date": "2008", "authors": "Kalinowska-Herok M, Widlak P", "evidence": [ { "database": "Reactome", "id": "R-HSA-140342", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140342" } ], "reference": [ { "type": "PubMed", "id": "18239742", "url": "https://glygen.org/publication/PubMed/18239742" } ] }, { "title": "HMGB1 develops enhanced proinflammatory activity by binding to cytokines.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2008-02-15", "authors": "Sha Yonggang, Zmijewski Jaroslaw, Xu Zhiwei, Abraham Edward", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "18250463", "url": "https://glygen.org/publication/PubMed/18250463" } ] }, { "title": "The major apoptotic endonuclease DFF40/CAD is a deoxyribose-specific and double-strand-specific enzyme.", "journal": "Apoptosis : an international journal on programmed cell death", "date": "2008", "authors": "Hanus J, Kalinowska-Herok M, Widlak P", "evidence": [ { "database": "Reactome", "id": "R-HSA-140342", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140342" } ], "reference": [ { "type": "PubMed", "id": "18283539", "url": "https://glygen.org/publication/PubMed/18283539" } ] }, { "title": "High mobility group box 1 protein binding to lipopolysaccharide facilitates transfer of lipopolysaccharide to CD14 and enhances lipopolysaccharide-mediated TNF-alpha production in human monocytes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2008", "authors": "Youn JH, Oh YJ, Kim ES, Choi JE, Shin JS", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" }, { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "18354232", "url": "https://glygen.org/publication/PubMed/18354232" } ] }, { "title": "Sequential control of Toll-like receptor-dependent responses by IRAK1 and IRAK2.", "journal": "Nature immunology", "date": "2008", "authors": "Kawagoe T, Sato S, Matsushita K, Kato H, Matsui K, Kumagai Y, Saitoh T, Kawai T, Takeuchi O, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "18438411", "url": "https://glygen.org/publication/PubMed/18438411" } ] }, { "title": "Structure of a NEMO/IKK-associating domain reveals architecture of the interaction site.", "journal": "Structure (London, England : 1993)", "date": "2008", "authors": "Rushe M, Silvian L, Bixler S, Chen LL, Cheung A, Bowes S, Cuervo H, Berkowitz S, Zheng T, Guckian K, Pellegrini M, Lugovskoy A", "evidence": [ { "database": "Reactome", "id": "R-HSA-445989", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989" } ], "reference": [ { "type": "PubMed", "id": "18462684", "url": "https://glygen.org/publication/PubMed/18462684" } ] }, { "title": "Oxidized phospholipid inhibition of toll-like receptor (TLR) signaling is restricted to TLR2 and TLR4: roles for CD14, LPS-binding protein, and MD2 as targets for specificity of inhibition.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Erridge C, Kennedy S, Spickett CM, Webb DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "18559343", "url": "https://glygen.org/publication/PubMed/18559343" } ] }, { "title": "Induction of immunological tolerance by apoptotic cells requires caspase-dependent oxidation of high-mobility group box-1 protein.", "journal": "Immunity", "date": "2008", "authors": "Kazama H, Ricci JE, Herndon JM, Hoppe G, Green DR, Ferguson TA", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "18631454", "url": "https://glygen.org/publication/PubMed/18631454" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" }, { "database": "iPTMnet", "id": "P09429", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09429" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Pyogenic bacterial infections in humans with MyD88 deficiency.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "von Bernuth H, Picard C, Jin Z, Pankla R, Xiao H, Ku CL, Chrabieh M, Mustapha IB, Ghandil P, Camcioglu Y, Vasconcelos J, Sirvent N, Guedes M, Vitor AB, Herrero-Mata MJ, Arostegui JI, Rodrigo C, Alsina L, Ruiz-Ortiz E, Juan M, Fortuny C, Yague J, Anton J, Pascal M, Chang HH, Janniere L, Rose Y, Garty BZ, Chapel H, Issekutz A, Marodi L, Rodriguez-Gallego C, Banchereau J, Abel L, Li X, Chaussabel D, Puel A, Casanova JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5602498", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5602498" } ], "reference": [ { "type": "PubMed", "id": "18669862", "url": "https://glygen.org/publication/PubMed/18669862" } ] }, { "title": "Phosphorylation of SNAP-23 by IkappaB kinase 2 regulates mast cell degranulation.", "journal": "Cell", "date": "2008", "authors": "Suzuki K, Verma IM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974" } ], "reference": [ { "type": "PubMed", "id": "18692471", "url": "https://glygen.org/publication/PubMed/18692471" } ] }, { "title": "Assembly of oligomeric death domain complexes during Toll receptor signaling.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Moncrieffe MC, Grossmann JG, Gay NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "18829464", "url": "https://glygen.org/publication/PubMed/18829464" } ] }, { "title": "Pulmonary surfactant protein D inhibits lipopolysaccharide (LPS)-induced inflammatory cell responses by altering LPS binding to its receptors.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Yamazoe M, Nishitani C, Takahashi M, Katoh T, Ariki S, Shimizu T, Mitsuzawa H, Sawada K, Voelker DR, Takahashi H, Kuroki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "18990700", "url": "https://glygen.org/publication/PubMed/18990700" } ] }, { "title": "Induction of inflammatory and immune responses by HMGB1-nucleosome complexes: implications for the pathogenesis of SLE.", "journal": "The Journal of experimental medicine", "date": "2008-12-22", "authors": "Urbonaviciute Vilma, F\u00fcrnrohr Barbara G, Meister Silke, Munoz Luis, Heyder Petra, De Marchis Francesco, Bianchi Marco E, Kirschning Carsten, Wagner Hermann, Manfredi Angelo A, Kalden Joachim R, Schett Georg, Rovere-Querini Patrizia, Herrmann Martin, Voll Reinhard E", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "19064698", "url": "https://glygen.org/publication/PubMed/19064698" } ] }, { "title": "Multi-hit inhibition of circulating and cell-associated components of the toll-like receptor 4 pathway by oxidized phospholipids.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2009", "authors": "von Schlieffen E, Oskolkova OV, Schabbauer G, Gruber F, Bluml S, Genest M, Kadl A, Marsik C, Knapp S, Chow J, Leitinger N, Binder BR, Bochkov VN", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "19112167", "url": "https://glygen.org/publication/PubMed/19112167" } ] }, { "title": "MHC molecules and microbial antigen processing in phagosomes.", "journal": "Current opinion in immunology", "date": "2009", "authors": "Ramachandra L, Simmons D, Harding CV", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974" } ], "reference": [ { "type": "PubMed", "id": "19217269", "url": "https://glygen.org/publication/PubMed/19217269" } ] }, { "title": "Interleukin-1 receptor-associated kinase 2 is critical for lipopolysaccharide-mediated post-transcriptional control.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Wan Y, Xiao H, Affolter J, Kim TW, Bulek K, Chaudhuri S, Carlson D, Hamilton T, Mazumder B, Stark GR, Thomas J, Li X", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "19224918", "url": "https://glygen.org/publication/PubMed/19224918" } ] }, { "title": "CD24 and Siglec-10 selectively repress tissue damage-induced immune responses.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Chen GY, Tang J, Zheng P, Liu Y", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "19264983", "url": "https://glygen.org/publication/PubMed/19264983" } ] }, { "title": "HMGB1: the jack-of-all-trades protein is a master DNA repair mechanic.", "journal": "Molecular carcinogenesis", "date": "2009-07", "authors": "Lange Sabine S, Vasquez Karen M", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "19360789", "url": "https://glygen.org/publication/PubMed/19360789" } ] }, { "title": "Human HMGB1 directly facilitates interactions between nucleotide excision repair proteins on triplex-directed psoralen interstrand crosslinks.", "journal": "DNA repair", "date": "2009-07-04", "authors": "Lange Sabine S, Reddy Madhava C, Vasquez Karen M", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "19446504", "url": "https://glygen.org/publication/PubMed/19446504" } ] }, { "title": "Tube Is an IRAK-4 homolog in a Toll pathway adapted for development and immunity.", "journal": "Journal of innate immunity", "date": "2009", "authors": "Towb P, Sun H, Wasserman SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "19498957", "url": "https://glygen.org/publication/PubMed/19498957" } ] }, { "title": "Structural basis for the multiple interactions of the MyD88 TIR domain in TLR4 signaling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Ohnishi H, Tochio H, Kato Z, Orii KE, Li A, Kimura T, Hiroaki H, Kondo N, Shirakawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5602498", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5602498" } ], "reference": [ { "type": "PubMed", "id": "19506249", "url": "https://glygen.org/publication/PubMed/19506249" } ] }, { "title": "A TIR domain variant of MyD88 adapter-like (Mal)/TIRAP results in loss of MyD88 binding and reduced TLR2/TLR4 signaling.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Nagpal K, Plantinga TS, Wong J, Monks BG, Gay NJ, Netea MG, Fitzgerald KA, Golenbock DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "19509286", "url": "https://glygen.org/publication/PubMed/19509286" } ] }, { "title": "An oligomeric signaling platform formed by the Toll-like receptor signal transducers MyD88 and IRAK-4.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Motshwene PG, Moncrieffe MC, Grossmann JG, Kao C, Ayaluru M, Sandercock AM, Robinson CV, Latz E, Gay NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "19592493", "url": "https://glygen.org/publication/PubMed/19592493" } ] }, { "title": "MyD88 adapter-like (Mal)/TIRAP interaction with TRAF6 is critical for TLR2- and TLR4-mediated NF-kappaB proinflammatory responses.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Verstak B, Nagpal K, Bottomley SP, Golenbock DT, Hertzog PJ, Mansell A", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "19592497", "url": "https://glygen.org/publication/PubMed/19592497" } ] }, { "title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "19608861", "url": "https://glygen.org/publication/PubMed/19608861" } ] }, { "title": "NEMO-binding domains of both IKKalpha and IKKbeta regulate IkappaB kinase complex assembly and classical NF-kappaB activation.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Solt LA, Madge LA, May MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-933542", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933542" } ], "reference": [ { "type": "PubMed", "id": "19666475", "url": "https://glygen.org/publication/PubMed/19666475" } ] }, { "title": "Oxidation of the alarmin high-mobility group box 1 protein (HMGB1) during apoptosis.", "journal": "Autoimmunity", "date": "2009", "authors": "Urbonaviciute V, Meister S, Furnrohr BG, Frey B, Guckel E, Schett G, Herrmann M, Voll RE", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "19811284", "url": "https://glygen.org/publication/PubMed/19811284" } ] }, { "title": "Genomic screening for genes upregulated by demethylation revealed novel targets of epigenetic silencing in breast cancer.", "journal": "Breast cancer research and treatment", "date": "2010", "authors": "Fujikane T, Nishikawa N, Toyota M, Suzuki H, Nojima M, Maruyama R, Ashida M, Ohe-Toyota M, Kai M, Nishidate T, Sasaki Y, Ohmura T, Hirata K, Tokino T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "19859801", "url": "https://glygen.org/publication/PubMed/19859801" } ] }, { "title": "CD36 ligands promote sterile inflammation through assembly of a Toll-like receptor 4 and 6 heterodimer.", "journal": "Nature immunology", "date": "2010", "authors": "Stewart CR, Stuart LM, Wilkinson K, van Gils JM, Deng J, Halle A, Rayner KJ, Boyer L, Zhong R, Frazier WA, Lacy-Hulbert A, El Khoury J, Golenbock DT, Moore KJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "20037584", "url": "https://glygen.org/publication/PubMed/20037584" } ] }, { "title": "Exploring the human leukocyte phosphoproteome using a microfluidic reversed-phase-TiO2-reversed-phase high-performance liquid chromatography phosphochip coupled to a quadrupole time-of-flight mass spectrometer.", "journal": "Analytical chemistry", "date": "2010", "authors": "Raijmakers R, Kraiczek K, de Jong AP, Mohammed S, Heck AJ", "evidence": [ { "database": "iPTMnet", "id": "P09429", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09429" } ], "reference": [ { "type": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" } ] }, { "title": "Extensive crosstalk between O-GlcNAcylation and phosphorylation regulates cytokinesis.", "journal": "Science signaling", "date": "2010", "authors": "Wang Z, Udeshi ND, Slawson C, Compton PD, Sakabe K, Cheung WD, Shabanowitz J, Hunt DF, Hart GW", "evidence": [ { "database": "iPTMnet", "id": "P09429", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09429" } ], "reference": [ { "type": "PubMed", "id": "20068230", "url": "https://glygen.org/publication/PubMed/20068230" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" }, { "database": "iPTMnet", "id": "P09429", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09429" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "HMGB proteins: interactions with DNA and chromatin.", "journal": "Biochimica et biophysica acta", "date": "2010", "authors": "Stros Michal", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "20123072", "url": "https://glygen.org/publication/PubMed/20123072" } ] }, { "title": "Glycopeptide-specific monoclonal antibodies suggest new roles for O-GlcNAc.", "journal": "Nature chemical biology", "date": "2010", "authors": "Teo CF, Ingale S, Wolfert MA, Elsayed GA, Not LG, Chatham JC, Wells L, Boons GJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09429", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09429" } ], "reference": [ { "type": "PubMed", "id": "20305658", "url": "https://glygen.org/publication/PubMed/20305658" } ] }, { "title": "The Toll-like receptor 4 ligands Mrp8 and Mrp14 are crucial in the development of autoreactive CD8+ T cells.", "journal": "Nature medicine", "date": "2010", "authors": "Loser K, Vogl T, Voskort M, Lueken A, Kupas V, Nacken W, Klenner L, Kuhn A, Foell D, Sorokin L, Luger TA, Roth J, Beissert S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "20473308", "url": "https://glygen.org/publication/PubMed/20473308" } ] }, { "title": "Helical assembly in the MyD88-IRAK4-IRAK2 complex in TLR/IL-1R signalling.", "journal": "Nature", "date": "2010", "authors": "Lin SC, Lo YC, Wu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "20485341", "url": "https://glygen.org/publication/PubMed/20485341" } ] }, { "title": "A critical cysteine is required for HMGB1 binding to Toll-like receptor 4 and activation of macrophage cytokine release.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Yang H, Hreggvidsdottir HS, Palmblad K, Wang H, Ochani M, Li J, Lu B, Chavan S, Rosas-Ballina M, Al-Abed Y, Akira S, Bierhaus A, Erlandsson-Harris H, Andersson U, Tracey KJ", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "20547845", "url": "https://glygen.org/publication/PubMed/20547845" } ] }, { "title": "Endogenous HMGB1 regulates autophagy.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Tang D, Kang R, Livesey KM, Cheh CW, Farkas A, Loughran P, Hoppe G, Bianchi ME, Tracey KJ, Zeh HJ 3rd, Lotze MT", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "20819940", "url": "https://glygen.org/publication/PubMed/20819940" } ] }, { "title": "Two human MYD88 variants, S34Y and R98C, interfere with MyD88-IRAK4-myddosome assembly.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "George J, Motshwene PG, Wang H, Kubarenko AV, Rautanen A, Mills TC, Hill AV, Gay NJ, Weber AN", "evidence": [ { "database": "Reactome", "id": "R-HSA-5602498", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5602498" } ], "reference": [ { "type": "PubMed", "id": "20966070", "url": "https://glygen.org/publication/PubMed/20966070" } ] }, { "title": "High mobility group box 1 (HMGB1) activates an autophagic response to oxidative stress.", "journal": "Antioxidants & redox signaling", "date": "2011-10-15", "authors": "Tang Daolin, Kang Rui, Livesey Kristen M, Zeh Herbert J, Lotze Michael T", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "21395369", "url": "https://glygen.org/publication/PubMed/21395369" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" }, { "database": "iPTMnet", "id": "P09429", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09429" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "Human interleukin-1 receptor-associated kinase-2 is essential for Toll-like receptor-mediated transcriptional and post-transcriptional regulation of tumor necrosis factor alpha.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Flannery SM, Keating SE, Szymak J, Bowie AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "21606490", "url": "https://glygen.org/publication/PubMed/21606490" } ] }, { "title": "Identification of lipopolysaccharide-binding peptide regions within HMGB1 and their effects on subclinical endotoxemia in a mouse model.", "journal": "European journal of immunology", "date": "2011-09", "authors": "Youn Ju Ho, Kwak Man Sup, Wu Jie, Kim Eun Sook, Ji Yeounjung, Min Hyun Jin, Yoo Ji-Ho, Choi Ji Eun, Cho Hyun-Soo, Shin Jeon-Soo", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "21660935", "url": "https://glygen.org/publication/PubMed/21660935" } ] }, { "title": "High mobility group box protein 1 in complex with lipopolysaccharide or IL-1 promotes an increased inflammatory phenotype in synovial fibroblasts.", "journal": "Arthritis research & therapy", "date": "2011", "authors": "Wahamaa H, Schierbeck H, Hreggvidsdottir HS, Palmblad K, Aveberger AC, Andersson U, Harris HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "21871094", "url": "https://glygen.org/publication/PubMed/21871094" } ] }, { "title": "Sec22b regulates phagosomal maturation and antigen crosspresentation by dendritic cells.", "journal": "Cell", "date": "2011", "authors": "Cebrian I, Visentin G, Blanchard N, Jouve M, Bobard A, Moita C, Enninga J, Moita LF, Amigorena S, Savina A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974" } ], "reference": [ { "type": "PubMed", "id": "22153078", "url": "https://glygen.org/publication/PubMed/22153078" } ] }, { "title": "The extracellular release of DNA and HMGB1 from Jurkat T cells during in vitro necrotic cell death.", "journal": "Innate immunity", "date": "2012", "authors": "Beyer C, Stearns NA, Giessl A, Distler JH, Schett G, Pisetsky DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "22344226", "url": "https://glygen.org/publication/PubMed/22344226" } ] }, { "title": "HMGB1 promotes recruitment of inflammatory cells to damaged tissues by forming a complex with CXCL12 and signaling via CXCR4.", "journal": "The Journal of experimental medicine", "date": "2012-03-12", "authors": "Schiraldi Milena, Raucci Angela, Mu\u00f1oz Laura Mart\u00ednez, Livoti Elsa, Celona Barbara, Venereau Emilie, Apuzzo Tiziana, De Marchis Francesco, Pedotti Mattia, Bachi Angela, Thelen Marcus, Varani Luca, Mellado Mario, Proudfoot Amanda, Bianchi Marco Emilio, Uguccioni Mariagrazia", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "22370717", "url": "https://glygen.org/publication/PubMed/22370717" } ] }, { "title": "Bruton's tyrosine kinase phosphorylates Toll-like receptor 3 to initiate antiviral response.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Lee KG, Xu S, Kang ZH, Huo J, Huang M, Liu D, Takeuchi O, Akira S, Lam KP", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "22454496", "url": "https://glygen.org/publication/PubMed/22454496" } ] }, { "title": "HMGB1 conveys immunosuppressive characteristics on regulatory and conventional T cells.", "journal": "International immunology", "date": "2012-08", "authors": "Wild Clarissa Anni, Bergmann Christoph, Fritz G\u00fcnter, Schuler Patrick, Hoffmann Thomas K, Lotfi Ramin, Westendorf Astrid, Brandau Sven, Lang Stephan", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "22473704", "url": "https://glygen.org/publication/PubMed/22473704" } ] }, { "title": "Pro-inflammatory S100A8 and S100A9 proteins: self-assembly into multifunctional native and amyloid complexes.", "journal": "International journal of molecular sciences", "date": "2012", "authors": "Vogl T, Gharibyan AL, Morozova-Roche LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "22489132", "url": "https://glygen.org/publication/PubMed/22489132" } ] }, { "title": "HMGB1 protein binds to influenza virus nucleoprotein and promotes viral replication.", "journal": "Journal of virology", "date": "2012-09", "authors": "Moisy Doroth\u00e9e, Avilov Sergiy V, Jacob Yves, Laoide Brid M, Ge Xingyi, Baudin Florence, Naffakh Nadia, Jestin Jean-Luc", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "22696656", "url": "https://glygen.org/publication/PubMed/22696656" } ] }, { "title": "Novel role of PKR in inflammasome activation and HMGB1 release.", "journal": "Nature", "date": "2012", "authors": "Lu B, Nakamura T, Inouye K, Li J, Tang Y, Lundback P, Valdes-Ferrer SI, Olofsson PS, Kalb T, Roth J, Zou Y, Erlandsson-Harris H, Yang H, Ting JP, Wang H, Andersson U, Antoine DJ, Chavan SS, Hotamisligil GS, Tracey KJ", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "22801494", "url": "https://glygen.org/publication/PubMed/22801494" } ] }, { "title": "Mutually exclusive redox forms of HMGB1 promote cell recruitment or proinflammatory cytokine release.", "journal": "The Journal of experimental medicine", "date": "2012", "authors": "Venereau E, Casalgrandi M, Schiraldi M, Antoine DJ, Cattaneo A, De Marchis F, Liu J, Antonelli A, Preti A, Raeli L, Shams SS, Yang H, Varani L, Andersson U, Tracey KJ, Bachi A, Uguccioni M, Bianchi ME", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "22869893", "url": "https://glygen.org/publication/PubMed/22869893" } ] }, { "title": "High mobility group box 1 released from necrotic cells enhances regrowth and metastasis of cancer cells that have survived chemotherapy.", "journal": "Eur. J. Cancer", "date": "2013", "authors": "Luo Yi, Chihara Yoshitomo, Fujimoto Kiyohide, Sasahira Tomonori, Kuwada Masaomi, Fujiwara Rina, Fujii Kiyomu, Ohmori Hitoshi, Kuniyasu Hiroki", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "23040637", "url": "https://glygen.org/publication/PubMed/23040637" } ] }, { "title": "HMGB1-facilitated p53 DNA binding occurs via HMG-Box/p53 transactivation domain interaction, regulated by the acidic tail.", "journal": "Structure (London, England : 1993)", "date": "2012-12-05", "authors": "Rowell John P, Simpson Kathryn L, Stott Katherine, Watson Matthew, Thomas Jean O", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "23063560", "url": "https://glygen.org/publication/PubMed/23063560" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" }, { "database": "iPTMnet", "id": "P09429", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09429" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.", "journal": "Journal of proteome research", "date": "2013", "authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09429", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09429" } ], "reference": [ { "type": "PubMed", "id": "23301498", "url": "https://glygen.org/publication/PubMed/23301498" } ] }, { "title": "Chaperone-like activity of high-mobility group box 1 protein and its role in reducing the formation of polyglutamine aggregates.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2013-02-15", "authors": "Min Hyun Jin, Ko Eun Ae, Wu Jie, Kim Eun Sung, Kwon Min Kyung, Kwak Man Sup, Choi Ji Eun, Lee Jong Eun, Shin Jeon-Soo", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "23303669", "url": "https://glygen.org/publication/PubMed/23303669" } ] }, { "title": "The many faces of HMGB1: molecular structure-functional activity in inflammation, apoptosis, and chemotaxis.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Yang H, Antoine DJ, Andersson U, Tracey KJ", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" }, { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "23446148", "url": "https://glygen.org/publication/PubMed/23446148" } ] }, { "title": "HMGB1: The Central Cytokine for All Lymphoid Cells.", "journal": "Frontiers in immunology", "date": "2013", "authors": "Li Guanqiao, Liang Xiaoyan, Lotze Michael T", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "23519706", "url": "https://glygen.org/publication/PubMed/23519706" } ] }, { "title": "IkappaB kinase phosphorylation of SNAP-23 controls platelet secretion.", "journal": "Blood", "date": "2013", "authors": "Karim ZA, Zhang J, Banerjee M, Chicka MC, Al Hawas R, Hamilton TR, Roche PA, Whiteheart SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974" } ], "reference": [ { "type": "PubMed", "id": "23613522", "url": "https://glygen.org/publication/PubMed/23613522" } ] }, { "title": "Proteome profiling of human neutrophil granule subsets, secretory vesicles, and cell membrane: correlation with transcriptome profiling of neutrophil precursors.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Rorvig S, Ostergaard O, Heegaard NH, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "23650620", "url": "https://glygen.org/publication/PubMed/23650620" } ] }, { "title": "M\u00e9nage \u00e0 Trois in stress: DAMPs, redox and autophagy.", "journal": "Seminars in cancer biology", "date": "2013-10", "authors": "Li Guanqiao, Tang Daolin, Lotze Michael T", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "23994764", "url": "https://glygen.org/publication/PubMed/23994764" } ] }, { "title": "An overview on HMGB1 inhibitors as potential therapeutic agents in HMGB1-related pathologies.", "journal": "Pharmacol. Ther.", "date": "2014", "authors": "Musumeci Domenica, Roviello Giovanni N, Montesarchio Daniela", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "24220159", "url": "https://glygen.org/publication/PubMed/24220159" } ] }, { "title": "Functional assessment of the mutational effects of human IRAK4 and MyD88 genes.", "journal": "Molecular immunology", "date": "2014", "authors": "Yamamoto T, Tsutsumi N, Tochio H, Ohnishi H, Kubota K, Kato Z, Shirakawa M, Kondo N", "evidence": [ { "database": "Reactome", "id": "R-HSA-5603041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5603041" } ], "reference": [ { "type": "PubMed", "id": "24316379", "url": "https://glygen.org/publication/PubMed/24316379" } ] }, { "title": "Redox-sensitive structural change in the A-domain of HMGB1 and its implication for the binding to cisplatin modified DNA.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2013", "authors": "Wang Jing, Tochio Naoya, Takeuchi Aya, Uewaki Jun-ichi, Kobayashi Naohiro, Tate Shin-ichi", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "24427810", "url": "https://glygen.org/publication/PubMed/24427810" } ] }, { "title": "An immunogenic peptide in the A-box of HMGB1 protein reverses apoptosis-induced tolerance through RAGE receptor.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "LeBlanc PM, Doggett TA, Choi J, Hancock MA, Durocher Y, Frank F, Nagar B, Ferguson TA, Saleh M", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "24474694", "url": "https://glygen.org/publication/PubMed/24474694" } ] }, { "title": "A systematic nomenclature for the redox states of high mobility group box (HMGB) proteins.", "journal": "Molecular medicine (Cambridge, Mass.)", "date": "2014", "authors": "Antoine DJ, Harris HE, Andersson U, Tracey KJ, Bianchi ME", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "24531895", "url": "https://glygen.org/publication/PubMed/24531895" } ] }, { "title": "S100A1 is released from ischemic cardiomyocytes and signals myocardial damage via Toll-like receptor 4.", "journal": "EMBO molecular medicine", "date": "2014", "authors": "Rohde D, Schon C, Boerries M, Didrihsone I, Ritterhoff J, Kubatzky KF, Volkers M, Herzog N, Mahler M, Tsoporis JN, Parker TG, Linke B, Giannitsis E, Gao E, Peppel K, Katus HA, Most P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "24833748", "url": "https://glygen.org/publication/PubMed/24833748" } ] }, { "title": "HMGB1-DNA complex-induced autophagy limits AIM2 inflammasome activation through RAGE.", "journal": "Biochemical and biophysical research communications", "date": "2014-07-18", "authors": "Liu Liying, Yang Minghua, Kang Rui, Dai Yunpeng, Yu Yan, Gao Fei, Wang Hongmei, Sun Xiaojun, Li Xiuli, Li Jianhua, Wang Haichao, Cao Lizhi, Tang Daolin", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "24971542", "url": "https://glygen.org/publication/PubMed/24971542" } ] }, { "title": "The role of high mobility group box 1 in innate immunity.", "journal": "Yonsei medical journal", "date": "2014-09", "authors": "Lee Shin-Ae, Kwak Man Sup, Kim Sol, Shin Jeon-Soo", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "25048472", "url": "https://glygen.org/publication/PubMed/25048472" } ] }, { "title": "TLR signals induce phagosomal MHC-I delivery from the endosomal recycling compartment to allow cross-presentation.", "journal": "Cell", "date": "2014", "authors": "Nair-Gupta P, Baccarini A, Tung N, Seyffer F, Florey O, Huang Y, Banerjee M, Overholtzer M, Roche PA, Tampe R, Brown BD, Amsen D, Whiteheart SW, Blander JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974" } ], "reference": [ { "type": "PubMed", "id": "25083866", "url": "https://glygen.org/publication/PubMed/25083866" } ] }, { "title": "Role of high mobility group box 1 (HMGB1) in SCA17 pathogenesis.", "journal": "PloS one", "date": "2014", "authors": "Lee Li-Ching, Chen Chiung-Mei, Wang Pin-Rong, Su Ming-Tsan, Lee-Chen Guey-Jen, Chang Chun-Yen", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "25549101", "url": "https://glygen.org/publication/PubMed/25549101" } ] }, { "title": "HMGB1 Binds to Lipoteichoic Acid and Enhances TNF-\u03b1 and IL-6 Production through HMGB1-Mediated Transfer of Lipoteichoic Acid to CD14 and TLR2.", "journal": "Journal of innate immunity", "date": "2015", "authors": "Kwak Man Sup, Lim Mihwa, Lee Yong Joon, Lee Hyun Sook, Kim Young Hun, Youn Ju Ho, Choi Ji Eun, Shin Jeon-Soo", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "25660311", "url": "https://glygen.org/publication/PubMed/25660311" } ] }, { "title": "Role of S100A1 in hypoxia-induced inflammatory response in cardiomyocytes via TLR4/ROS/NF-kappaB pathway.", "journal": "The Journal of pharmacy and pharmacology", "date": "2015", "authors": "Yu J, Lu Y, Li Y, Xiao L, Xing Y, Li Y, Wu L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "25880347", "url": "https://glygen.org/publication/PubMed/25880347" } ] }, { "title": "HMGB1 promotes systemic lupus erythematosus by enhancing macrophage inflammatory response.", "journal": "J. Immunol. Res.", "date": "2015", "authors": "Lu Mudan, Yu Shanshan, Xu Wei, Gao Bo, Xiong Sidong", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "26078984", "url": "https://glygen.org/publication/PubMed/26078984" } ] }, { "title": "Cleavage of GSDMD by inflammatory caspases determines pyroptotic cell death.", "journal": "Nature", "date": "2015", "authors": "Shi J, Zhao Y, Wang K, Shi X, Wang Y, Huang H, Zhuang Y, Cai T, Wang F, Shao F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "26375003", "url": "https://glygen.org/publication/PubMed/26375003" } ] }, { "title": "Human caspase-4 and caspase-5 regulate the one-step non-canonical inflammasome activation in monocytes.", "journal": "Nature communications", "date": "2015", "authors": "Vigano E, Diamond CE, Spreafico R, Balachander A, Sobota RM, Mortellaro A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "26508369", "url": "https://glygen.org/publication/PubMed/26508369" } ] }, { "title": "Pore-forming activity and structural autoinhibition of the gasdermin family.", "journal": "Nature", "date": "2016", "authors": "Ding J, Wang K, Liu W, She Y, Sun Q, Shi J, Sun H, Wang DC, Shao F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "27281216", "url": "https://glygen.org/publication/PubMed/27281216" } ] }, { "title": "A core viral protein binds host nucleosomes to sequester immune danger signals.", "journal": "Nature", "date": "2016-07-07", "authors": "Avgousti Daphne C, Herrmann Christin, Kulej Katarzyna, Pancholi Neha J, Sekulic Nikolina, Petrescu Joana, Molden Rosalynn C, Blumenthal Daniel, Paris Andrew J, Reyes Emigdio D, Ostapchuk Philomena, Hearing Patrick, Seeholzer Steven H, Worthen G Scott, Black Ben E, Garcia Benjamin A, Weitzman Matthew D", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "27362237", "url": "https://glygen.org/publication/PubMed/27362237" } ] }, { "title": "Inflammasome-activated gasdermin D causes pyroptosis by forming membrane pores.", "journal": "Nature", "date": "2016", "authors": "Liu X, Zhang Z, Ruan J, Pan Y, Magupalli VG, Wu H, Lieberman J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "27383986", "url": "https://glygen.org/publication/PubMed/27383986" } ] }, { "title": "GSDMD membrane pore formation constitutes the mechanism of pyroptotic cell death.", "journal": "The EMBO journal", "date": "2016", "authors": "Sborgi L, Ruhl S, Mulvihill E, Pipercevic J, Heilig R, Stahlberg H, Farady CJ, Muller DJ, Broz P, Hiller S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "27418190", "url": "https://glygen.org/publication/PubMed/27418190" } ] }, { "title": "Double phosphorylation-induced structural changes in the signal-receiving domain of IkappaBalpha in complex with NF-kappaB.", "journal": "Proteins", "date": "2017", "authors": "Yazdi S, Naumann M, Stein M", "evidence": [ { "database": "Reactome", "id": "R-HSA-445989", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989" } ], "reference": [ { "type": "PubMed", "id": "27701768", "url": "https://glygen.org/publication/PubMed/27701768" } ] }, { "title": "Cleavage of DFNA5 by caspase-3 during apoptosis mediates progression to secondary necrotic/pyroptotic cell death.", "journal": "Nature communications", "date": "2017", "authors": "Rogers C, Fernandes-Alnemri T, Mayes L, Alnemri D, Cingolani G, Alnemri ES", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "28045099", "url": "https://glygen.org/publication/PubMed/28045099" } ] }, { "title": "Serine ADP-Ribosylation Depends on HPF1.", "journal": "Molecular cell", "date": "2017", "authors": "Bonfiglio JJ, Fontana P, Zhang Q, Colby T, Gibbs-Seymour I, Atanassov I, Bartlett E, Zaja R, Ahel I, Matic I", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "28190768", "url": "https://glygen.org/publication/PubMed/28190768" } ] }, { "title": "Pyroptosis and Apoptosis Pathways Engage in Bidirectional Crosstalk in Monocytes and Macrophages.", "journal": "Cell chemical biology", "date": "2017", "authors": "Taabazuing CY, Okondo MC, Bachovchin DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "28392147", "url": "https://glygen.org/publication/PubMed/28392147" } ] }, { "title": "Chemotherapy drugs induce pyroptosis through caspase-3 cleavage of a gasdermin.", "journal": "Nature", "date": "2017", "authors": "Wang Y, Gao W, Shi X, Ding J, Liu W, He H, Wang K, Shao F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "28459430", "url": "https://glygen.org/publication/PubMed/28459430" } ] }, { "title": "Inflammatory Caspases: Activation and Cleavage of Gasdermin-D In Vitro and During Pyroptosis.", "journal": "Methods in molecular biology (Clifton, N.J.)", "date": "2018", "authors": "Zhao Y, Shi J, Shao F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "29177860", "url": "https://glygen.org/publication/PubMed/29177860" } ] }, { "title": "A human placental cDNA clone that encodes nonhistone chromosomal protein HMG-1.", "journal": "Nucleic Acids Res.", "date": "1989", "authors": "Wen L, Huang J K, Johnson B H, Reeck G R", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "2922262", "url": "https://glygen.org/publication/PubMed/2922262" } ] }, { "title": "Mapping and Quantification of Over 2000 O-linked Glycopeptides in Activated Human T Cells with Isotope-Targeted Glycoproteomics (Isotag).", "journal": "Molecular & cellular proteomics : MCP", "date": "2018", "authors": "Woo CM, Lund PJ, Huang AC, Davis MM, Bertozzi CR, Pitteri SJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09429", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09429" }, { "database": "O-GlcNAc Atlas", "id": "P09429", "url": "https://oglcnac.org/atlas/detail/P09429" } ], "reference": [ { "type": "PubMed", "id": "29351928", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "title": "Gasdermin D Exerts Anti-inflammatory Effects by Promoting Neutrophil Death.", "journal": "Cell reports", "date": "2018", "authors": "Kambara H, Liu F, Zhang X, Liu P, Bajrami B, Teng Y, Zhao L, Zhou S, Yu H, Zhou W, Silberstein LE, Cheng T, Han M, Xu Y, Luo HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "29539421", "url": "https://glygen.org/publication/PubMed/29539421" } ] }, { "title": "The proinflammatory protein HMGB1 is a substrate of transglutaminase-2 and forms high-molecular weight complexes with autoantigens.", "journal": "The Journal of biological chemistry", "date": "2018", "authors": "Willis WL, Wang L, Wada TT, Gardner M, Abdouni O, Hampton J, Valiente G, Young N, Ardoin S, Agarwal S, Freitas MA, Wu LC, Jarjour WN", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "29618516", "url": "https://glygen.org/publication/PubMed/29618516" } ] }, { "title": "Mechanism of gasdermin D recognition by inflammatory caspases and their inhibition by a gasdermin D-derived peptide inhibitor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2018", "authors": "Yang J, Liu Z, Wang C, Yang R, Rathkey JK, Pinkard OW, Shi W, Chen Y, Dubyak GR, Abbott DW, Xiao TS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "29891674", "url": "https://glygen.org/publication/PubMed/29891674" } ] }, { "title": "Mechanism of membrane pore formation by human gasdermin-D.", "journal": "The EMBO journal", "date": "2018", "authors": "Mulvihill E, Sborgi L, Mari SA, Pfreundschuh M, Hiller S, Muller DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "29898893", "url": "https://glygen.org/publication/PubMed/29898893" } ] }, { "title": "Mechanisms of Gasdermin Family Members in Inflammasome Signaling and Cell Death.", "journal": "Journal of molecular biology", "date": "2018", "authors": "Feng S, Fox D, Man SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "29990470", "url": "https://glygen.org/publication/PubMed/29990470" } ] }, { "title": "Gasdermin D plays a vital role in the generation of neutrophil extracellular traps.", "journal": "Science immunology", "date": "2018", "authors": "Sollberger G, Choidas A, Burn GL, Habenberger P, Di Lucrezia R, Kordes S, Menninger S, Eickhoff J, Nussbaumer P, Klebl B, Kruger R, Herzig A, Zychlinsky A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "30143555", "url": "https://glygen.org/publication/PubMed/30143555" } ] }, { "title": "Gasdermin pores permeabilize mitochondria to augment caspase-3 activation during apoptosis and inflammasome activation.", "journal": "Nature communications", "date": "2019", "authors": "Rogers C, Erkes DA, Nardone A, Aplin AE, Fernandes-Alnemri T, Alnemri ES", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "30976076", "url": "https://glygen.org/publication/PubMed/30976076" } ] }, { "title": "IRF2 transcriptionally induces GSDMD expression for pyroptosis.", "journal": "Science signaling", "date": "2019", "authors": "Kayagaki N, Lee BL, Stowe IB, Kornfeld OS, O'Rourke K, Mirrashidi KM, Haley B, Watanabe C, Roose-Girma M, Modrusan Z, Kummerfeld S, Reja R, Zhang Y, Cho V, Andrews TD, Morris LX, Goodnow CC, Bertram EM, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "31113851", "url": "https://glygen.org/publication/PubMed/31113851" } ] }, { "title": "Structural Mechanism for GSDMD Targeting by Autoprocessed Caspases in Pyroptosis.", "journal": "Cell", "date": "2020", "authors": "Wang K, Sun Q, Zhong X, Zeng M, Zeng H, Shi X, Li Z, Wang Y, Zhao Q, Shao F, Ding J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "32109412", "url": "https://glygen.org/publication/PubMed/32109412" } ] }, { "title": "Engineering a Proximity-Directed O-GlcNAc Transferase for Selective Protein O-GlcNAcylation in Cells.", "journal": "ACS chemical biology", "date": "2020", "authors": "Ramirez DH, Aonbangkhen C, Wu HY, Naftaly JA, Tang S, O'Meara TR, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09429", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09429" } ], "reference": [ { "type": "PubMed", "id": "32119511", "url": "https://glygen.org/publication/PubMed/32119511" } ] }, { "title": "Gasdermin E suppresses tumour growth by activating anti-tumour immunity.", "journal": "Nature", "date": "2020", "authors": "Zhang Z, Zhang Y, Xia S, Kong Q, Li S, Liu X, Junqueira C, Meza-Sosa KF, Mok TMY, Ansara J, Sengupta S, Yao Y, Wu H, Lieberman J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "32188940", "url": "https://glygen.org/publication/PubMed/32188940" } ] }, { "title": "FDA-approved disulfiram inhibits pyroptosis by blocking gasdermin D pore formation.", "journal": "Nature immunology", "date": "2020", "authors": "Hu JJ, Liu X, Xia S, Zhang Z, Zhang Y, Zhao J, Ruan J, Luo X, Lou X, Bai Y, Wang J, Hollingsworth LR, Magupalli VG, Zhao L, Luo HR, Kim J, Lieberman J, Wu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "32367036", "url": "https://glygen.org/publication/PubMed/32367036" } ] }, { "title": "Succination inactivates gasdermin D and blocks pyroptosis.", "journal": "Science (New York, N.Y.)", "date": "2020", "authors": "Humphries F, Shmuel-Galia L, Ketelut-Carneiro N, Li S, Wang B, Nemmara VV, Wilson R, Jiang Z, Khalighinejad F, Muneeruddin K, Shaffer SA, Dutta R, Ionete C, Pesiridis S, Yang S, Thompson PR, Fitzgerald KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "32820063", "url": "https://glygen.org/publication/PubMed/32820063" } ] }, { "title": "Genome-wide CRISPR Screens Reveal Host Factors Critical for SARS-CoV-2 Infection.", "journal": "Cell", "date": "2021", "authors": "Wei J, Alfajaro MM, DeWeirdt PC, Hanna RE, Lu-Culligan WJ, Cai WL, Strine MS, Zhang SM, Graziano VR, Schmitz CO, Chen JS, Mankowski MC, Filler RB, Ravindra NG, Gasque V, de Miguel FJ, Patil A, Chen H, Oguntuyo KY, Abriola L, Surovtseva YV, Orchard RC, Lee B, Lindenbach BD, Politi K, van Dijk D, Kadoch C, Simon MD, Yan Q, Doench JG, Wilen CB", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "33147444", "url": "https://glygen.org/publication/PubMed/33147444" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09429", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09429" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09429", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09429" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "O-GlcNAcylation of High Mobility Group Box 1 (HMGB1) Alters Its DNA Binding and DNA Damage Processing Activities.", "journal": "Journal of the American Chemical Society", "date": "2021", "authors": "Balana AT, Mukherjee A, Nagpal H, Moon SP, Fierz B, Vasquez KM, Pratt MR", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09429", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09429" }, { "database": "O-GlcNAc Atlas", "id": "P09429", "url": "https://oglcnac.org/atlas/detail/P09429" } ], "reference": [ { "type": "PubMed", "id": "34546745", "url": "https://glygen.org/publication/PubMed/34546745" } ] }, { "title": "LPS-induced macrophage HMGB1-loaded extracellular vesicles trigger hepatocyte pyroptosis by activating the NLRP3 inflammasome.", "journal": "Cell death discovery", "date": "2021-11-06", "authors": "Wang Guozhen, Jin Siyi, Huang Weichang, Li Yang, Wang Jun, Ling Xuguang, Huang Yun, Hu Ye, Li Congcong, Meng Ying, Li Xu", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "34743181", "url": "https://glygen.org/publication/PubMed/34743181" } ] }, { "title": "The danger molecule HMGB1 cooperates with the NLRP3 inflammasome to sustain expression of the EBV lytic switch protein in Burkitt lymphoma cells.", "journal": "Virology", "date": "2022", "authors": "Reinhart NM, Akinyemi IA, Frey TR, Xu H, Agudelo C, Brathwaite J, Burton EM, Burgula S, McIntosh MT, Bhaduri-McIntosh S", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "34922257", "url": "https://glygen.org/publication/PubMed/34922257" } ] }, { "title": "High-mobility group box 1 protein promotes dengue virus replication by interacting with untranslated regions of viral genome.", "journal": "Virus research", "date": "2022-02", "authors": "Chaudhary Nidhi, Srivastava Shikha, Dave Upma, Ojha Amrita, Guchhait Prasenjit, Chandele Anmol, Patel Ashok Kumar", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "34971702", "url": "https://glygen.org/publication/PubMed/34971702" } ] }, { "title": "Simultaneously Identifying and Distinguishing Glycoproteins with O-GlcNAc and O-GalNAc (the Tn Antigen) in Human Cancer Cells.", "journal": "Analytical chemistry", "date": "2022", "authors": "Xu S, Zheng J, Xiao H, Wu R", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09429", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09429" } ], "reference": [ { "type": "PubMed", "id": "35132862", "url": "https://glygen.org/publication/PubMed/35132862" } ] }, { "title": "Spatiotemporal Activation of Protein O-GlcNAcylation in Living Cells.", "journal": "Journal of the American Chemical Society", "date": "2022", "authors": "He J, Fan Z, Tian Y, Yang W, Zhou Y, Zhu Q, Zhang W, Qin W, Yi W", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09429", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09429" } ], "reference": [ { "type": "PubMed", "id": "35138101", "url": "https://glygen.org/publication/PubMed/35138101" } ] }, { "title": "SARS-CoV-2 ORF3a induces RETREG1/FAM134B-dependent reticulophagy and triggers sequential ER stress and inflammatory responses during SARS-CoV-2 infection.", "journal": "Autophagy", "date": "2022-11", "authors": "Zhang Xiaolin, Yang Ziwei, Pan Ting, Long Xubing, Sun Qinqin, Wang Pei-Hui, Li Xiaojuan, Kuang Ersheng", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "35239449", "url": "https://glygen.org/publication/PubMed/35239449" } ] }, { "title": "USP13 regulates HMGB1 stability and secretion through its deubiquitinase activity.", "journal": "Mol. Med.", "date": "2022", "authors": "Shin Jaemin, Kim Young Hun, Lee Bin, Chang Jae Ho, Choi Hee Youn, Lee Hoojung, Song Ki Chan, Kwak Man Sup, Choi Ji Eun, Shin Jeon-Soo", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "36585612", "url": "https://glygen.org/publication/PubMed/36585612" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09429", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09429" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "Structural changes in the retina and serum HMGB1 levels are associated with decreased cognitive function in patients with Parkinson's disease.", "journal": "Neurobiology of disease", "date": "2024-01", "authors": "Liang Keke, Li Xiaohuan, Guo Qingge, Ma Jianjun, Yang Hongqi, Fan Yongyan, Yang Dawei, Shi Xiaoxue, She Zonghan, Qi Xuelin, Gu Qi, Chen Siyuan, Zheng Jinhua, Li Dongsheng", "evidence": [ { "database": "RefSeq", "id": "NP_001300821", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300821" } ], "reference": [ { "type": "PubMed", "id": "38104911", "url": "https://glygen.org/publication/PubMed/38104911" } ] }, { "title": "HMGB1 mediates microbiome-immune axis dysregulation underlying reduced neutralization capacity in obesity-related post-acute sequelae of SARS-CoV-2.", "journal": "Scientific reports", "date": "2024-01-03", "authors": "Rubas Noelle C, Peres Rafael, Kunihiro Braden P, Allan Nina P, Phankitnirundorn Krit, Wells Riley K, McCraken Trevor A, Lee Rosa H, Umeda Lesley, Conching Andie, Juarez Ruben, Maunakea Alika K", "evidence": [ { "database": "RefSeq", "id": "NP_001300821", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300821" } ], "reference": [ { "type": "PubMed", "id": "38172612", "url": "https://glygen.org/publication/PubMed/38172612" } ] }, { "title": "The Role of High Mobility Group Box B-1 in the Prognosis of Colorectal Cancer Based on the Changes in the Intestinal Mucosal Barrier.", "journal": "Technology in cancer research & treatment", "date": "2024", "authors": "Zhao Weiwei, Chen Anqi, Yuan Na, Hao Xiaohui, Wang Cong, Lu Xiurong, Song Xiao, Zhang Zhilin", "evidence": [ { "database": "RefSeq", "id": "NP_001300821", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300821" } ], "reference": [ { "type": "PubMed", "id": "38200714", "url": "https://glygen.org/publication/PubMed/38200714" } ] }, { "title": "Increased expression of NLRP3 associated with elevated levels of HMGB1 in children with febrile seizures: a case-control study.", "journal": "BMC pediatrics", "date": "2024-01-13", "authors": "Ye Xing-Guang, She Feng-Zhi, Yu Dong-Ni, Wu Li-Qian, Tang Yan, Wu Ben-Ze, Dong Shi-Wei, Dai Jie-Min, Zhou Xing, Liu Zhi-Gang", "evidence": [ { "database": "RefSeq", "id": "NP_001300821", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001300821" } ], "reference": [ { "type": "PubMed", "id": "38218765", "url": "https://glygen.org/publication/PubMed/38218765" } ] }, { "title": "CD36 is a receptor for oxidized low density lipoprotein.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Endemann G, Stanton LW, Madden KS, Bryant CM, White RT, Protter AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "7685021", "url": "https://glygen.org/publication/PubMed/7685021" } ] }, { "title": "Identification of galectin-3 as a high-affinity binding protein for advanced glycation end products (AGE): a new member of the AGE-receptor complex.", "journal": "Molecular medicine (Cambridge, Mass.)", "date": "1995", "authors": "Vlassara H, Li YM, Imani F, Wojciechowicz D, Yang Z, Liu FT, Cerami A", "evidence": [ { "database": "Reactome", "id": "R-HSA-879415", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879415" } ], "reference": [ { "type": "PubMed", "id": "8529130", "url": "https://glygen.org/publication/PubMed/8529130" } ] }, { "title": "The active gene that encodes human high mobility group 1 protein (HMG1) contains introns and maps to chromosome 13.", "journal": "Genomics", "date": "1996", "authors": "Ferrari S, Finelli P, Rocchi M, Bianchi M E", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "8661151", "url": "https://glygen.org/publication/PubMed/8661151" } ] }, { "title": "Targeting of proteins to granule subsets is determined by timing and not by sorting: The specific granule protein NGAL is localized to azurophil granules when expressed in HL-60 cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Le Cabec V, Cowland JB, Calafat J, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "8692836", "url": "https://glygen.org/publication/PubMed/8692836" } ] }, { "title": "TRAF6 is a signal transducer for interleukin-1.", "journal": "Nature", "date": "1996", "authors": "Cao Z, Xiong J, Takeuchi M, Kurama T, Goeddel DV", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "8837778", "url": "https://glygen.org/publication/PubMed/8837778" } ] }, { "title": "Activation of the IkappaB alpha kinase complex by MEKK1, a kinase of the JNK pathway.", "journal": "Cell", "date": "1997", "authors": "Lee FS, Hagler J, Chen ZJ, Maniatis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "9008162", "url": "https://glygen.org/publication/PubMed/9008162" } ] }, { "title": "Expression of high-mobility group-1 mRNA in human gastrointestinal adenocarcinoma and corresponding non-cancerous mucosa.", "journal": "International journal of cancer", "date": "1997", "authors": "Xiang YY, Wang DY, Tanaka M, Suzuki M, Kiyokawa E, Igarashi H, Naito Y, Shen Q, Sugimura H", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "9036861", "url": "https://glygen.org/publication/PubMed/9036861" } ] }, { "title": "DFF, a heterodimeric protein that functions downstream of caspase-3 to trigger DNA fragmentation during apoptosis.", "journal": "Cell", "date": "1997", "authors": "Liu X, Zou H, Slaughter C, Wang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-140342", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140342" } ], "reference": [ { "type": "PubMed", "id": "9108473", "url": "https://glygen.org/publication/PubMed/9108473" } ] }, { "title": "Two-dimensional electrophoretic analysis of human breast carcinoma proteins: mapping of proteins that bind to the SH3 domain of mixed lineage kinase MLK2.", "journal": "Electrophoresis", "date": "1997", "authors": "Rasmussen R K, Ji H, Eddes J S, Moritz R L, Reid G E, Simpson R J, Dorow D S", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "reference": [ { "type": "PubMed", "id": "9150946", "url": "https://glygen.org/publication/PubMed/9150946" } ] }, { "title": "MyD88: an adapter that recruits IRAK to the IL-1 receptor complex.", "journal": "Immunity", "date": "1997", "authors": "Wesche H, Henzel WJ, Shillinglaw W, Li S, Cao Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "9430229", "url": "https://glygen.org/publication/PubMed/9430229" } ] }, { "title": "MEKK1 activates both IkappaB kinase alpha and IkappaB kinase beta.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Lee FS, Peters RT, Dang LC, Maniatis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-933542", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933542" } ], "reference": [ { "type": "PubMed", "id": "9689078", "url": "https://glygen.org/publication/PubMed/9689078" } ] }, { "title": "Structure of an IkappaBalpha/NF-kappaB complex.", "journal": "Cell", "date": "1998", "authors": "Jacobs MD, Harrison SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-445989", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989" } ], "reference": [ { "type": "PubMed", "id": "9865693", "url": "https://glygen.org/publication/PubMed/9865693" } ] } ], "pathway": [ { "id": "hsa:3146", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3146", "resource": "KEGG Pathway" }, { "id": "R-HSA-1236974", "name": "ER-Phagosome pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974", "resource": "Reactome", "description": "ER-Phagosome pathway" }, { "id": "R-HSA-140342", "name": "Apoptosis induced DNA fragmentation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140342", "resource": "Reactome", "description": "Apoptosis induced DNA fragmentation" }, { "id": "R-HSA-166058", "name": "MyD88:MAL(TIRAP) cascade initiated on plasma membrane", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058", "resource": "Reactome", "description": "MyD88:MAL(TIRAP) cascade initiated on plasma membrane" }, { "id": "R-HSA-445989", "name": "TAK1-dependent IKK and NF-kappa-B activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989", "resource": "Reactome", "description": "TAK1-dependent IKK and NF-kappa-B activation" }, { "id": "R-HSA-5602498", "name": "MyD88 deficiency (TLR2/4)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5602498", "resource": "Reactome", "description": "MyD88 deficiency (TLR2/4)" }, { "id": "R-HSA-5603041", "name": "IRAK4 deficiency (TLR2/4)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5603041", "resource": "Reactome", "description": "IRAK4 deficiency (TLR2/4)" }, { "id": "R-HSA-5620971", "name": "Pyroptosis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971", "resource": "Reactome", "description": "Pyroptosis" }, { "id": "R-HSA-5686938", "name": "Regulation of TLR by endogenous ligand", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938", "resource": "Reactome", "description": "Regulation of TLR by endogenous ligand" }, { "id": "R-HSA-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-HSA-879415", "name": "Advanced glycosylation endproduct receptor signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879415", "resource": "Reactome", "description": "Advanced glycosylation endproduct receptor signaling" }, { "id": "R-HSA-933542", "name": "TRAF6 mediated NF-kB activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933542", "resource": "Reactome", "description": "TRAF6 mediated NF-kB activation" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A8W4FKZ0-1", "protein_name": "High mobility group protein B1", "gene_name": "HMGB1", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVIKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEEEEEDDDDE", "length": 215 }, "evidence": [ { "id": "P09429", "url": "https://omabrowser.org/oma/group/P09429/", "database": "OMA" } ], "common_name": "Pig" }, { "uniprot_canonical_ac": "P63158-1", "protein_name": "High mobility group protein B1", "gene_name": "Hmgb1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE", "length": 215 }, "evidence": [ { "id": "45919099", "url": "http://www.informatics.jax.org/homology/45919099", "database": "MGI" }, { "id": "P09429", "url": "https://omabrowser.org/oma/group/P09429/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P63159-1", "protein_name": "High mobility group protein B1", "gene_name": "Hmgb1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE", "length": 215 }, "evidence": [ { "id": "45919099", "url": "http://www.informatics.jax.org/homology/45919099", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 24, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "DNA binding, bending", "id": "GO:0008301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008301", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "RAGE receptor binding", "id": "GO:0050786", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050786", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "transcription coactivator activity", "id": "GO:0003713", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003713", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "integrin binding", "id": "GO:0005178", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005178", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "C-X-C chemokine binding", "id": "GO:0019958", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019958", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "chemoattractant activity", "id": "GO:0042056", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042056", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "damaged DNA binding", "id": "GO:0003684", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003684", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "transcription corepressor activity", "id": "GO:0003714", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003714", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "DNA polymerase binding", "id": "GO:0070182", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070182", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "double-stranded DNA binding", "id": "GO:0003690", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003690", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "cytokine activity", "id": "GO:0005125", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005125", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "transcription cis-regulatory region binding", "id": "GO:0000976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000976", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "lipopolysaccharide binding", "id": "GO:0001530", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001530", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "phosphatidylserine binding", "id": "GO:0001786", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001786", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "single-stranded DNA binding", "id": "GO:0003697", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003697", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "receptor ligand activity", "id": "GO:0048018", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048018", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "RNA polymerase II-specific DNA-binding transcription factor binding", "id": "GO:0061629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061629", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "lyase activity", "id": "GO:0016829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016829", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "four-way junction DNA binding", "id": "GO:0000400", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000400", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "bubble DNA binding", "id": "GO:0000405", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000405", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "supercoiled DNA binding", "id": "GO:0097100", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097100", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "DNA-binding transcription factor binding", "id": "GO:0140297", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140297", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 14, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "chromosome", "id": "GO:0005694", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005694", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "endosome", "id": "GO:0005768", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005768", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "secretory granule lumen", "id": "GO:0034774", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034774", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "ficolin-1-rich granule lumen", "id": "GO:1904813", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904813", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "transcription repressor complex", "id": "GO:0017053", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017053", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "condensed chromosome", "id": "GO:0000793", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000793", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "endoplasmic reticulum-Golgi intermediate compartment", "id": "GO:0005793", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005793", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "alphav-beta3 integrin-HMGB1 complex", "id": "GO:0035868", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035868", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 54, "go_terms": [ { "name": "innate immune response", "id": "GO:0045087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "regulation of tolerance induction", "id": "GO:0002643", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002643", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "regulation of T cell mediated immune response to tumor cell", "id": "GO:0002840", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002840", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "negative regulation of RNA polymerase II transcription preinitiation complex assembly", "id": "GO:0017055", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017055", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "regulation of restriction endodeoxyribonuclease activity", "id": "GO:0032072", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032072", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "positive regulation of mismatch repair", "id": "GO:0032425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032425", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "negative regulation of CD4-positive, alpha-beta T cell differentiation", "id": "GO:0043371", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043371", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "T-helper 1 cell differentiation", "id": "GO:0045063", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045063", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "positive regulation of dendritic cell differentiation", "id": "GO:2001200", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001200", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "T-helper 1 cell activation", "id": "GO:0035711", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035711", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "positive regulation of vascular endothelial cell proliferation", "id": "GO:1905564", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905564", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "DNA recombination", "id": "GO:0006310", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006310", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "inflammatory response", "id": "GO:0006954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "positive regulation of cytosolic calcium ion concentration", "id": "GO:0007204", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007204", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "neuron projection development", "id": "GO:0031175", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031175", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "positive regulation of apoptotic process", "id": "GO:0043065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043065", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "positive regulation of cysteine-type endopeptidase activity involved in apoptotic process", "id": "GO:0043280", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043280", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "positive regulation of MAPK cascade", "id": "GO:0043410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043410", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "positive regulation of JNK cascade", "id": "GO:0046330", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046330", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "positive regulation of ERK1 and ERK2 cascade", "id": "GO:0070374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070374", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "positive regulation of monocyte chemotaxis", "id": "GO:0090026", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090026", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "inflammatory response to antigenic stimulus", "id": "GO:0002437", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002437", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "negative regulation of type II interferon production", "id": "GO:0032689", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032689", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "positive regulation of interleukin-6 production", "id": "GO:0032755", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032755", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "cellular response to lipopolysaccharide", "id": "GO:0071222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071222", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "positive regulation of viral entry into host cell", "id": "GO:0046598", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046598", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "double-strand break repair via nonhomologous end joining", "id": "GO:0006303", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006303", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "autophagy", "id": "GO:0006914", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006914", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "negative regulation of blood vessel endothelial cell migration", "id": "GO:0043537", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043537", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "positive regulation of autophagy", "id": "GO:0010508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010508", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "positive regulation of tumor necrosis factor production", "id": "GO:0032760", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032760", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "positive regulation of blood vessel endothelial cell migration", "id": "GO:0043536", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043536", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "positive regulation of DNA ligation", "id": "GO:0051106", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051106", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "positive regulation of interleukin-8 production", "id": "GO:0032757", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032757", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "dendritic cell chemotaxis", "id": "GO:0002407", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002407", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "apoptotic cell clearance", "id": "GO:0043277", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043277", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "activation of innate immune response", "id": "GO:0002218", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002218", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "neutrophil clearance", "id": "GO:0097350", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097350", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "myeloid dendritic cell activation", "id": "GO:0001773", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001773", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "positive regulation of activated T cell proliferation", "id": "GO:0042104", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042104", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "positive regulation of DNA binding", "id": "GO:0043388", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043388", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "positive regulation of interleukin-10 production", "id": "GO:0032733", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032733", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "DNA topological change", "id": "GO:0006265", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006265", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "positive regulation of toll-like receptor 9 signaling pathway", "id": "GO:0034165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034165", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "negative regulation of apoptotic cell clearance", "id": "GO:2000426", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000426", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "positive regulation of interleukin-1 production", "id": "GO:0032732", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032732", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "V(D)J recombination", "id": "GO:0033151", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033151", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "heterochromatin formation", "id": "GO:0031507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031507", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "positive regulation of interleukin-12 production", "id": "GO:0032735", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032735", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "positive regulation of chemokine (C-X-C motif) ligand 2 production", "id": "GO:2000343", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000343", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" }, { "name": "DNA geometric change", "id": "GO:0032392", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032392", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 134, "end_pos": 136, "annotation": "n_glycosylation_sequon" }, { "start_pos": 37, "end_pos": 39, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Acetylated on multiple sites upon stimulation with LPS (PubMed:22801494). Acetylation on lysine residues in the nuclear localization signals (NLS 1 and NLS 2) leads to cytoplasmic localization and subsequent secretion (By similarity). Acetylation on Lys-3 results in preferential binding to DNA ends and impairs DNA bending activity (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" }, { "database": "PubMed", "id": "22801494", "url": "https://glygen.org/publication/PubMed/22801494" } ] }, { "annotation": "Forms covalent cross-links mediated by transglutaminase TGM2, between a glutamine and the epsilon-amino group of a lysine residue, forming homopolymers and heteropolymers.", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" }, { "database": "PubMed", "id": "29618516", "url": "https://glygen.org/publication/PubMed/29618516" } ] }, { "annotation": "In vitro cleavage by CASP1 is liberating a HMG box 1-containing peptide which may mediate immunogenic activity; the peptide antagonizes apoptosis-induced immune tolerance (PubMed:24474694). Can be proteolytically cleaved by a thrombin:thrombomodulin complex; reduces binding to heparin and pro-inflammatory activities (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" }, { "database": "PubMed", "id": "24474694", "url": "https://glygen.org/publication/PubMed/24474694" } ] }, { "annotation": "Phosphorylated at serine residues. Phosphorylation in both NLS regions is required for cytoplasmic translocation followed by secretion (PubMed:17114460).", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" }, { "database": "PubMed", "id": "17114460", "url": "https://glygen.org/publication/PubMed/17114460" } ] }, { "annotation": "Reduction/oxidation of cysteine residues Cys-23, Cys-45 and Cys-106 and a possible intramolecular disulfide bond involving Cys-23 and Cys-45 give rise to different redox forms with specific functional activities in various cellular compartments: 1- fully reduced HMGB1 (HMGB1C23hC45hC106h), 2- disulfide HMGB1 (HMGB1C23-C45C106h) and 3- sulfonyl HMGB1 (HMGB1C23soC45soC106so).", "evidence": [ { "database": "UniProtKB", "id": "P09429", "url": "https://www.uniprot.org/uniprot/P09429" }, { "database": "PubMed", "id": "22869893", "url": "https://glygen.org/publication/PubMed/22869893" }, { "database": "PubMed", "id": "24531895", "url": "https://glygen.org/publication/PubMed/24531895" }, { "database": "PubMed", "id": "19811284", "url": "https://glygen.org/publication/PubMed/19811284" }, { "database": "PubMed", "id": "16962095", "url": "https://glygen.org/publication/PubMed/16962095" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 22, 100, 107 ], "snv_sites": [ 100, 107, 137 ], "glycation_sites": [], "phosphorylation_sites": [ 35, 100, 109, 121, 155, 162 ], "sequon_annotation_sites": [ { "start_pos": 134, "end_pos": 136 }, { "start_pos": 37, "end_pos": 39 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 3 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 3 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 202 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }