{
    "uniprot_canonical_ac": "P09238-1",
    "uniprot_ac": "P09238",
    "uniprot_id": "MMP10_HUMAN",
    "mass": {
        "chemical_mass": 54151.0,
        "monoisotopic_mass": 54151.0
    },
    "refseq": {
        "ac": "NP_002416",
        "name": "stromelysin-2 preproprotein",
        "summary": "This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This secreted protease breaks down fibronectin, laminin, elastin, proteoglycan core protein, gelatins, and several types of collagen. The gene is part of a cluster of MMP genes on chromosome 11. [provided by RefSeq, Jan 2016].",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002416"
    },
    "gene_names": [
        {
            "name": "MMP10",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/P09238",
            "id": "P09238"
        },
        {
            "name": "MMP10",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002416",
            "id": "NP_002416"
        },
        {
            "name": "SL-2; STMY2",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002416",
            "id": "NP_002416"
        },
        {
            "name": "STMY2",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/P09238",
            "id": "P09238"
        }
    ],
    "protein_names": [
        {
            "name": "Stromelysin-2",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "P09238"
        },
        {
            "name": "3.4.24.22",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P09238"
        },
        {
            "name": "MMP-10",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P09238"
        },
        {
            "name": "Matrix metalloproteinase-10",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P09238"
        },
        {
            "name": "SL-2",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P09238"
        },
        {
            "name": "Transin-2",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P09238"
        },
        {
            "name": "stromelysin-2 preproprotein",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002416",
            "id": "NP_002416"
        },
        {
            "name": "transin 2; matrix metalloproteinase 10 (stromelysin 2); matrix metalloprotease 10; stromelysin-2; MMP-10; matrix metalloproteinase-10",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002416",
            "id": "NP_002416"
        }
    ],
    "function": [
        {
            "annotation": "Asymptomatic SARS-CoV-2 Infection Is Associated With Higher Levels of Serum IL-17C, Matrix Metalloproteinase 10 and Fibroblast Growth Factors Than Mild Symptomatic COVID-19. Publication Status: Online-Only",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_002416",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002416"
                },
                {
                    "database": "PubMed",
                    "id": "35479098",
                    "url": "https://glygen.org/publication/PubMed/35479098"
                }
            ]
        },
        {
            "annotation": "Can degrade fibronectin, gelatins of type I, III, IV, and V; weakly collagens III, IV, and V. Activates procollagenase.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P09238",
                    "url": "https://www.uniprot.org/uniprot/P09238#function"
                }
            ]
        },
        {
            "annotation": "Higher Content but Not Activity of Stromelysin-2 (MMP-10) in Comparison to Stromelysin-1 (MMP-3) in Human Renal Carcinoma. Publication Status: Online-Only",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_002416",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002416"
                },
                {
                    "database": "PubMed",
                    "id": "36231910",
                    "url": "https://glygen.org/publication/PubMed/36231910"
                }
            ]
        },
        {
            "annotation": "Matrix metalloproteinase-10 deficiency has protective effects against peritoneal inflammation and fibrosis via transcription factor NFkappaBeta pathway inhibition.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_002416",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002416"
                },
                {
                    "database": "PubMed",
                    "id": "37652204",
                    "url": "https://glygen.org/publication/PubMed/37652204"
                }
            ]
        },
        {
            "annotation": "Study on the Mechanism of circRNA-0024103 Reducing Endothelial Cell Injury by Regulating miR-363/MMP-10. Publication Status: Online-Only",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_002416",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002416"
                },
                {
                    "database": "PubMed",
                    "id": "35992547",
                    "url": "https://glygen.org/publication/PubMed/35992547"
                }
            ]
        },
        {
            "annotation": "The roles of MMP8/MMP10 polymorphisms in ischemic stroke susceptibility.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_002416",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002416"
                },
                {
                    "database": "PubMed",
                    "id": "36282475",
                    "url": "https://glygen.org/publication/PubMed/36282475"
                }
            ]
        },
        {
            "annotation": "This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This secreted protease breaks down fibronectin, laminin, elastin, proteoglycan core protein, gelatins, and several types of collagen. The gene is part of a cluster of MMP genes on chromosome 11. [provided by RefSeq, Jan 2016].",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_002416",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002416"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [
        {
            "evidence": [
                {
                    "id": "P09238",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P09238"
                }
            ],
            "glycoeffect": [],
            "start_pos": 192,
            "end_pos": 192,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "G",
            "sequence_mut": "R",
            "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).",
            "chr_id": "11",
            "chr_pos": "102778672",
            "ref_nt": "C",
            "alt_nt": "T",
            "minor_allelic_frequency": "",
            "site_lbl": "G192",
            "disease": [
                {
                    "disease_id": "DOID:1612",
                    "recommended_name": {
                        "id": "DOID:1612",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:1612",
                        "name": "breast cancer",
                        "description": "A thoracic cancer that originates in the mammary gland."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "breast tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "malignant neoplasm of breast",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "malignant tumor of the breast",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "mammary cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "mammary tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "primary breast cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "hereditary breast carcinoma",
                            "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, lobular, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, protection against, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "familial breast cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "familial breast carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "familial cancer of breast",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "familial cancer of the breast",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "hereditary breast cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "hereditary breast carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, familial",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, familial Male",
                            "description": ""
                        },
                        {
                            "id": "MIM:114480",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/114480",
                            "name": "Breast cancer",
                            "description": "Breast cancer"
                        }
                    ]
                },
                {
                    "disease_id": "DOID:1324",
                    "recommended_name": {
                        "id": "DOID:1324",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:1324",
                        "name": "lung cancer",
                        "description": "A respiratory system cancer that is located_in the lung."
                    },
                    "synonyms": [
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "LNCR1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "lung cancer susceptibility 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "LNCR3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "lung cancer susceptibility 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "adenocarcinoma of lung, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "lung cancer susceptibility 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "LNCR4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "lung cancer susceptibility 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "lung cancer susceptibility 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "LNCR5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "lung cancer susceptibility 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer",
                            "description": "A malignant neoplasm involving the lung."
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "adenocarcinoma of lung, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "cancer of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, protection against, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant neoplasm of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant neoplasm of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumor of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumor of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumour of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumour of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "Nonsmall cell lung cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "alveolar cell carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, protection against",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MIM:211980",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/211980",
                            "name": "Lung cancer",
                            "description": "Lung cancer"
                        }
                    ]
                },
                {
                    "disease_id": "DOID:4159",
                    "recommended_name": {
                        "id": "DOID:4159",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:4159",
                        "name": "skin cancer",
                        "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:4159",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:4159",
                            "name": "CA - skin cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:4159",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:4159",
                            "name": "malignant neoplasm of skin",
                            "description": ""
                        },
                        {
                            "id": "DOID:4159",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:4159",
                            "name": "melanoma and Non-melanoma skin cancer",
                            "description": ""
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        }
    ],
    "mutagenesis": [],
    "expression_tissue": [
        {
            "tissue": {
                "name": "Adult mammalian kidney",
                "namespace": "UBERON",
                "id": "0000082",
                "url": "http://purl.obolibrary.org/obo/UBERON_0000082"
            },
            "score": "50.94",
            "present": "MEDIUM",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000166670",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000166670"
                }
            ]
        },
        {
            "tissue": {
                "name": "Oral cavity",
                "namespace": "UBERON",
                "id": "0000167",
                "url": "http://purl.obolibrary.org/obo/UBERON_0000167"
            },
            "score": "43.3",
            "present": "MEDIUM",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000166670",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000166670"
                }
            ]
        },
        {
            "tissue": {
                "name": "Stomach",
                "namespace": "UBERON",
                "id": "0000945",
                "url": "http://purl.obolibrary.org/obo/UBERON_0000945"
            },
            "score": "53.26",
            "present": "MEDIUM",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000166670",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000166670"
                }
            ]
        },
        {
            "tissue": {
                "name": "Uterus",
                "namespace": "UBERON",
                "id": "0000995",
                "url": "http://purl.obolibrary.org/obo/UBERON_0000995"
            },
            "score": "49.96",
            "present": "MEDIUM",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000166670",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000166670"
                }
            ]
        },
        {
            "tissue": {
                "name": "Esophagus",
                "namespace": "UBERON",
                "id": "0001043",
                "url": "http://purl.obolibrary.org/obo/UBERON_0001043"
            },
            "score": "17.43",
            "present": "LOW",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000166670",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000166670"
                }
            ]
        },
        {
            "tissue": {
                "name": "Rectum",
                "namespace": "UBERON",
                "id": "0001052",
                "url": "http://purl.obolibrary.org/obo/UBERON_0001052"
            },
            "score": "56.65",
            "present": "MEDIUM",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000166670",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000166670"
                }
            ]
        },
        {
            "tissue": {
                "name": "Colon",
                "namespace": "UBERON",
                "id": "0001155",
                "url": "http://purl.obolibrary.org/obo/UBERON_0001155"
            },
            "score": "47.76",
            "present": "MEDIUM",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000166670",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000166670"
                }
            ]
        },
        {
            "tissue": {
                "name": "Urinary bladder",
                "namespace": "UBERON",
                "id": "0001255",
                "url": "http://purl.obolibrary.org/obo/UBERON_0001255"
            },
            "score": "40.5",
            "present": "LOW",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000166670",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000166670"
                }
            ]
        },
        {
            "tissue": {
                "name": "Thyroid gland",
                "namespace": "UBERON",
                "id": "0002046",
                "url": "http://purl.obolibrary.org/obo/UBERON_0002046"
            },
            "score": "29",
            "present": "LOW",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000166670",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000166670"
                }
            ]
        },
        {
            "tissue": {
                "name": "Lung",
                "namespace": "UBERON",
                "id": "0002048",
                "url": "http://purl.obolibrary.org/obo/UBERON_0002048"
            },
            "score": "47.6",
            "present": "MEDIUM",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000166670",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000166670"
                }
            ]
        },
        {
            "tissue": {
                "name": "Liver",
                "namespace": "UBERON",
                "id": "0002107",
                "url": "http://purl.obolibrary.org/obo/UBERON_0002107"
            },
            "score": "42.11",
            "present": "MEDIUM",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000166670",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000166670"
                }
            ]
        },
        {
            "tissue": {
                "name": "Prostate gland",
                "namespace": "UBERON",
                "id": "0002367",
                "url": "http://purl.obolibrary.org/obo/UBERON_0002367"
            },
            "score": "37.32",
            "present": "LOW",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000166670",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000166670"
                }
            ]
        },
        {
            "tissue": {
                "name": "Thoracic mammary gland",
                "namespace": "UBERON",
                "id": "0005200",
                "url": "http://purl.obolibrary.org/obo/UBERON_0005200"
            },
            "score": "42.43",
            "present": "MEDIUM",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000166670",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000166670"
                }
            ]
        }
    ],
    "expression_disease": [
        {
            "significant": "Yes",
            "trend": "up",
            "name": "Prostate cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:10283",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P09238",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09238"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:10283",
                    "recommended_name": {
                        "id": "DOID:10283",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:10283",
                        "name": "prostate cancer",
                        "description": "A male reproductive organ cancer that is located_in the prostate."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "NGP - new growth of prostate",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "hereditary prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "malignant tumor of the prostate",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "prostate cancer, familial",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "prostate neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "prostatic cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "prostatic neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "tumor of the prostate",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012597",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012597",
                            "name": "prostate cancer, hereditary, 9",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012597",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012597",
                            "name": "prostate cancer, hereditary, 9",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012597",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012597",
                            "name": "prostate cancer, hereditary, type 9",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012597",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012597",
                            "name": "HPC9",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "prostate cancer, hereditary, 12",
                            "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "EHBP1 familial prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "familial prostate cancer caused by mutation in EHBP1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "prostate cancer, hereditary, 12",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "prostate cancer, hereditary, type 12",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "HPC12",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012244",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012244",
                            "name": "prostate cancer, hereditary, 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012244",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012244",
                            "name": "prostate cancer, hereditary, 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012244",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012244",
                            "name": "prostate cancer, hereditary, type 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012244",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012244",
                            "name": "HPC5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012093",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012093",
                            "name": "prostate cancer, hereditary, 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012093",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012093",
                            "name": "prostate cancer, hereditary, 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012093",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012093",
                            "name": "prostate cancer, hereditary, type 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012093",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012093",
                            "name": "prostate cancer, susceptibility to, 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012093",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012093",
                            "name": "HPC3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "prostate cancer, hereditary, 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "prostate cancer, hereditary, 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "prostate cancer, hereditary, type 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "prostate cancer, susceptibility to, 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "HPC4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "prostate cancer, hereditary, on chromosome 7",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "prostate cancer, hereditary, 13",
                            "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "MSMB familial prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "familial prostate cancer caused by mutation in MSMB",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "prostate cancer, hereditary, 13",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "prostate cancer, hereditary, type 13",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "HPC13",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "prostate cancer, hereditary, 8",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "prostate cancer, hereditary, 8",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "prostate cancer, hereditary, type 8",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "HPC8",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "predisposing for prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "prostate cancer, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012300",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012300",
                            "name": "prostate cancer, hereditary, 6",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012300",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012300",
                            "name": "prostate cancer, hereditary, 6",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012300",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012300",
                            "name": "prostate cancer, hereditary, type 6",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012300",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012300",
                            "name": "HPC6",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012300",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012300",
                            "name": "prostate cancer, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012620",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012620",
                            "name": "prostate cancer, hereditary, 10",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012620",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012620",
                            "name": "HPC10",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012620",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012620",
                            "name": "prostate cancer, hereditary, 10",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "familial prostate carcinoma",
                            "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "familial prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "hereditary prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "hereditary prostate carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, familial",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, hereditary",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012470",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012470",
                            "name": "prostate cancer, hereditary, 7",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012470",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012470",
                            "name": "HPC7",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012470",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012470",
                            "name": "prostate cancer, hereditary, 7",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012470",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012470",
                            "name": "prostate cancer aggressiveness",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "prostate cancer, hereditary, 1",
                            "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "RNASEL familial prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "familial prostate cancer caused by mutation in RNASEL",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "prostate cancer 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "prostate cancer, hereditary, 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "prostate cancer, hereditary, type 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "HPC1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "Prca1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012768",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012768",
                            "name": "prostate cancer, hereditary, 11",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012768",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012768",
                            "name": "HPC11",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012768",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012768",
                            "name": "prostate cancer, hereditary, 11",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012769",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012769",
                            "name": "prostate cancer, hereditary, 14",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012769",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012769",
                            "name": "HPC14",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012769",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012769",
                            "name": "prostate cancer, hereditary, 14",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012770",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012770",
                            "name": "prostate cancer, hereditary, 15",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012770",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012770",
                            "name": "HPC15",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012770",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012770",
                            "name": "prostate cancer, hereditary, 15",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010257",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010257",
                            "name": "prostate cancer, hereditary, X-linked 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010257",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010257",
                            "name": "HPCX1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010257",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010257",
                            "name": "prostate cancer, hereditary, X-linked 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010257",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010257",
                            "name": "prostate cancer susceptibility, X-linked",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010405",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010405",
                            "name": "prostate cancer, hereditary, X-linked 2",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010405",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010405",
                            "name": "HPCX2",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010405",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010405",
                            "name": "prostate cancer, hereditary, X-linked 2",
                            "description": ""
                        },
                        {
                            "id": "MIM:611868",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/611868",
                            "name": "Prostate cancer, hereditary, 12",
                            "description": "Prostate cancer, hereditary, 12"
                        },
                        {
                            "id": "MIM:611928",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/611928",
                            "name": "Prostate cancer, hereditary, 13",
                            "description": "Prostate cancer, hereditary, 13"
                        },
                        {
                            "id": "MIM:176807",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/176807",
                            "name": "Prostate cancer",
                            "description": "Prostate cancer"
                        },
                        {
                            "id": "MIM:601518",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/601518",
                            "name": "Prostate cancer, hereditary, 1",
                            "description": "Prostate cancer, hereditary, 1"
                        },
                        {
                            "id": "MIM:611955",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/611955",
                            "name": "Prostate cancer, hereditary, 11",
                            "description": "Prostate cancer, hereditary, 11"
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "up",
            "name": "Stomach cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:10534",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P09238",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09238"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:10534",
                    "recommended_name": {
                        "id": "DOID:10534",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:10534",
                        "name": "stomach cancer",
                        "description": "A gastrointestinal system cancer that is located_in the stomach."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:10534",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10534",
                            "name": "gastric cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:10534",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10534",
                            "name": "gastric neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer",
                            "description": "A primary or metastatic malignant neoplasm involving the stomach."
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "Ca lesser curvature - stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "cancer of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer risk after h. pylori infection",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant gastric neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant gastric tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant gastric tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant neoplasm of lesser curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant neoplasm of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant neoplasm of the stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant stomach neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of body of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of greater curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of lesser curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of the stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of body of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of greater curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of lesser curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of the stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "stomach cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "Ca body - stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "ca greater curvature of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant neoplasm of body of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer, intestinal",
                            "description": ""
                        },
                        {
                            "id": "MIM:613659",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/613659",
                            "name": "Gastric cancer",
                            "description": "Gastric cancer"
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "up",
            "name": "Urinary bladder cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:11054",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P09238",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09238"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:11054",
                    "recommended_name": {
                        "id": "DOID:11054",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:11054",
                        "name": "urinary bladder cancer",
                        "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:11054",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11054",
                            "name": "bladder cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:11054",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11054",
                            "name": "tumor of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder cancer",
                            "description": "A primary or metastatic malignant neoplasm involving the bladder."
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "tumor of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "tumour of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "bladder cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "cancer of urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant bladder neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant bladder tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant bladder tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm of bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm of the urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm of urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm, bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm, urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor of bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor of the urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor of urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor, urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumour of bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumour of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumour of the urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumour of urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant urinary bladder neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant urinary bladder tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant urinary bladder tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder malignant neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder malignant tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder malignant tumour",
                            "description": ""
                        },
                        {
                            "id": "MIM:109800",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/109800",
                            "name": "Bladder cancer",
                            "description": "Bladder cancer"
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "up",
            "name": "Head and neck cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:11934",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P09238",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09238"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:11934",
                    "recommended_name": {
                        "id": "DOID:11934",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:11934",
                        "name": "head and neck cancer",
                        "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:11934",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11934",
                            "name": "head and neck neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:11934",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11934",
                            "name": "head and neck tumours",
                            "description": ""
                        },
                        {
                            "id": "DOID:11934",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11934",
                            "name": "head/neck neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:11934",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11934",
                            "name": "tumor of head and neck",
                            "description": ""
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "up",
            "name": "Lung cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:1324",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P09238",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09238"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:1324",
                    "recommended_name": {
                        "id": "DOID:1324",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:1324",
                        "name": "lung cancer",
                        "description": "A respiratory system cancer that is located_in the lung."
                    },
                    "synonyms": [
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "LNCR1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "lung cancer susceptibility 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "LNCR3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "lung cancer susceptibility 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "adenocarcinoma of lung, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "lung cancer susceptibility 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "LNCR4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "lung cancer susceptibility 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "lung cancer susceptibility 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "LNCR5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "lung cancer susceptibility 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer",
                            "description": "A malignant neoplasm involving the lung."
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "adenocarcinoma of lung, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "cancer of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, protection against, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant neoplasm of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant neoplasm of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumor of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumor of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumour of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumour of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "Nonsmall cell lung cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "alveolar cell carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, protection against",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MIM:211980",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/211980",
                            "name": "Lung cancer",
                            "description": "Lung cancer"
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "up",
            "name": "Breast cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:1612",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P09238",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09238"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:1612",
                    "recommended_name": {
                        "id": "DOID:1612",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:1612",
                        "name": "breast cancer",
                        "description": "A thoracic cancer that originates in the mammary gland."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "breast tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "malignant neoplasm of breast",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "malignant tumor of the breast",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "mammary cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "mammary tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "primary breast cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "hereditary breast carcinoma",
                            "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, lobular, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, protection against, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "familial breast cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "familial breast carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "familial cancer of breast",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "familial cancer of the breast",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "hereditary breast cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "hereditary breast carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, familial",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, familial Male",
                            "description": ""
                        },
                        {
                            "id": "MIM:114480",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/114480",
                            "name": "Breast cancer",
                            "description": "Breast cancer"
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "up",
            "name": "Thyroid cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:1781",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P09238",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09238"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:1781",
                    "recommended_name": {
                        "id": "DOID:1781",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:1781",
                        "name": "thyroid cancer",
                        "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:1781",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1781",
                            "name": "thyroid gland cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:1781",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1781",
                            "name": "Thyroid gland neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:1781",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1781",
                            "name": "malignant neoplasm of thyroid gland",
                            "description": ""
                        },
                        {
                            "id": "DOID:1781",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1781",
                            "name": "malignant tumour of thyroid gland",
                            "description": ""
                        },
                        {
                            "id": "DOID:1781",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1781",
                            "name": "neoplasm of thyroid gland",
                            "description": ""
                        },
                        {
                            "id": "DOID:1781",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1781",
                            "name": "thyroid neoplasm",
                            "description": ""
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "up",
            "name": "Kidney cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:263",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P09238",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09238"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:263",
                    "recommended_name": {
                        "id": "DOID:263",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:263",
                        "name": "kidney cancer",
                        "description": "A urinary system cancer that is located_in the kidney."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:263",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:263",
                            "name": "malignant neoplasm of kidney except pelvis",
                            "description": ""
                        },
                        {
                            "id": "DOID:263",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:263",
                            "name": "malignant tumour of kidney",
                            "description": ""
                        },
                        {
                            "id": "DOID:263",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:263",
                            "name": "renal cancer",
                            "description": ""
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "up",
            "name": "Liver cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:3571",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P09238",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09238"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:3571",
                    "recommended_name": {
                        "id": "DOID:3571",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:3571",
                        "name": "liver cancer",
                        "description": "A hepatobiliary system cancer that is located_in the liver."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "Ca liver - primary",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "Resectable malignant neoplasm of Liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "hepatic cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "hepatic neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "malignant hepato-biliary neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "malignant neoplasm of liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "malignant neoplasm of liver, primary",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "malignant tumor of liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "neoplasm of liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "non-resectable primary hepatic malignant neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "primary liver cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "primary malignant neoplasm of liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "resectable malignant neoplasm of the liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "malignant neoplasm of liver, not specified as primary or secondary",
                            "description": ""
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "up",
            "name": "Uterine cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:363",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P09238",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09238"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:363",
                    "recommended_name": {
                        "id": "DOID:363",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:363",
                        "name": "uterine cancer",
                        "description": "A female reproductive organ cancer that is located_in the uterus."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "CA - cancer of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "Tumour of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "malignant neoplasm of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "malignant uterine tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "neoplasm of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "uterine tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "uterus neoplasm",
                            "description": ""
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "up",
            "name": "Esophageal cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:5041",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P09238",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09238"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:5041",
                    "recommended_name": {
                        "id": "DOID:5041",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:5041",
                        "name": "esophageal cancer",
                        "description": "A gastrointestinal system cancer that is located_in the esophagus."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "Ca lower third oesophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "Ca middle third oesophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "esophagus cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant neoplasm of distal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant neoplasm of lower third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant neoplasm of middle third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant neoplasm of proximal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant neoplasm of upper third esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant tumor of Distal Third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant tumor of Proximal Third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant tumor of abdominal esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant tumor of the middle Third of the esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal cancer",
                            "description": "A primary or metastatic malignant neoplasm involving the esophagus."
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "cancer of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "cancer of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal carcinoma, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal squamous cell carcinoma, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophagus cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant esophageal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant esophageal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant esophageal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant esophagus neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant esophagus tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of the esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of the oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant oesophagus neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant oesophagus tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of the esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of the oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "oesophagus cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Ca lower third esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Ca lower third oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Ca middle third esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Ca middle third oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of distal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of distal third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of lower third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of lower third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of middle third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of middle third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of proximal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of proximal third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of upper third esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of upper third oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of abdominal esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of distal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of proximal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of the middle third of the esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of abdominal oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of distal third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of proximal third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of the middle third of the oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Aerodigestive tract cancer, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Escc, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal squamous cell carcinoma, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "gastric cardia adenocarcinoma, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MIM:133239",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/133239",
                            "name": "Esophageal cancer",
                            "description": "Esophageal cancer"
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "up",
            "name": "Colorectal cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:9256",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P09238",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09238"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:9256",
                    "recommended_name": {
                        "id": "DOID:9256",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9256",
                        "name": "colorectal cancer",
                        "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
                    },
                    "synonyms": [
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer",
                            "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of colorectum",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, advanced, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer with chromosomal instability, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectum cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectum neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of colorectum",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "CRC",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "large intestine cancer",
                            "description": ""
                        },
                        {
                            "id": "MIM:114500",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/114500",
                            "name": "Colorectal cancer",
                            "description": "Colorectal cancer"
                        }
                    ]
                }
            ]
        }
    ],
    "species": [
        {
            "name": "Homo sapiens",
            "taxid": 9606,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P09238",
                    "url": "https://www.uniprot.org/uniprot/P09238"
                }
            ],
            "common_name": "Human"
        }
    ],
    "gene": [
        {
            "name": "MMP10",
            "url": "https://www.uniprot.org/uniprot/P09238",
            "locus": {
                "chromosome": "11",
                "start_pos": 102770502,
                "end_pos": 102780628,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSG00000166670",
                        "url": "https://www.ensembl.org/id/ENSG00000166670"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSG00000166670",
            "url": "https://bgee.org/?page=gene&gene_id=ENSG00000166670",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "P09238",
            "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P09238",
            "database": "BioMuta",
            "categories": [
                "Variation"
            ]
        },
        {
            "id": "3.4.24.22",
            "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.4.24.22&UniProtAcc=P09238",
            "database": "BRENDA",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "cd00094",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00094",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "cd04278",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd04278",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "CHEMBL4270",
            "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4270",
            "database": "ChEMBL",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "MMP10",
            "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=MMP10",
            "database": "GeneCards",
            "categories": [
                "Gene Annotation",
                "Organism-specific"
            ]
        },
        {
            "id": "4319",
            "url": "https://www.ncbi.nlm.nih.gov/gene/4319",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "7156",
            "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=7156",
            "database": "HGNC",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "P09238",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:P09238*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR000585",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000585",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR001818",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001818",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR002477",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR002477",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR006026",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR006026",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR018486",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR018486",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR018487",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR018487",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR021158",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR021158",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR021190",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR021190",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR024079",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR024079",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR033739",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR033739",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR036365",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR036365",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR036375",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR036375",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "hsa:4319",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4319",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "185260",
            "url": "http://www.omim.org/entry/185260",
            "database": "MIM",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "NX_P09238",
            "url": "https://www.nextprot.org/entry/NX_P09238",
            "database": "neXtProt",
            "categories": [
                "Protein",
                "Organism-specific"
            ]
        },
        {
            "id": "NLEPEFH",
            "url": "https://omabrowser.org/oma/group/NLEPEFH/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "391167at2759",
            "url": "http://www.orthodb.org/?query=391167at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR10201",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10201",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR10201:SF270",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10201:SF270",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "1Q3A",
            "url": "https://www.rcsb.org/structure/1Q3A",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "3V96",
            "url": "https://www.rcsb.org/structure/3V96",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4ILW",
            "url": "https://www.rcsb.org/structure/4ILW",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "PF00045",
            "url": "http://pfam.xfam.org/family/PF00045",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF00413",
            "url": "http://pfam.xfam.org/family/PF00413",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF01471",
            "url": "http://pfam.xfam.org/family/PF01471",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "P09238",
            "url": "https://pharos.nih.gov/targets/P09238",
            "database": "PHAROS",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "PR_P09238",
            "url": "http://purl.obolibrary.org/obo/PR_P09238",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "R-HSA-1442490",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-1474228",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-1592389",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_002416",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002416",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "F5GYX7",
            "url": "https://www.uniprot.org/uniprot/F5GYX7",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "F5GYX7-1",
            "url": "https://www.uniprot.org/uniprot/F5GYX7-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P09238",
            "url": "https://www.uniprot.org/uniprot/P09238",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P09238-1",
            "url": "https://www.uniprot.org/uniprot/P09238-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MMHLAFLVLLCLPVCSAYPLSGAAKEEDSNKDLAQQYLEKYYNLEKDVKQFRRKDSNLIVKKIQGMQKFLGLEVTGKLDTDTLEVMRKPRCGVPDVGHFSSFPGMPKWRKTHLTYRIVNYTPDLPRDAVDSAIEKALKVWEEVTPLTFSRLYEGEADIMISFAVKEHGDFYSFDGPGHSLAHAYPPGPGLYGDIHFDDDEKWTEDASGTNLFLVAAHELGHSLGLFHSANTEALMYPLYNSFTELAQFRLSQDDVNGIQSLYGPPPASTEEPLVPTKSVPSGSEMPAKCDPALSFDAISTLRGEYLFFKDRYFWRRSHWNPEPEFHLISAFWPSLPSYLDAAYEVNSRDTVFIFKGNEFWAIRGNEVQAGYPRGIHTLGFPPTIRKIDAAVSDKEKKKTYFFAADKYWRFDENSQSMEQGFPRLIADDFPGVEPKVDAVLQAFGFFYFFSGSSQFEFDPNARMVTHILKSNSWLHC",
        "length": 476,
        "header": "sp|P09238-1|MMP10_HUMAN Isoform 1 of Stromelysin-2  OS=Homo sapiens OX=9606 GN=MMP10 PE=1 SV=1 CANONICAL=P09238-1"
    },
    "isoforms": [
        {
            "isoform_ac": "F5GYX7-1",
            "url": "",
            "sequence": {
                "sequence": "MMHLAFLVLLCLPVCSAYPLSGAAKEEDSNKDLAQQYLEKYYNLEKDVKQFRRKDSNLIVKKIQGMQKFLGLEVTGKLDTDTLEVMRKPRCGVPDVGHFSSFPGMPKWRKTHLTYRIVNYTPDLPRDAVDSAIEKALKVWEEVTPLTFSRLYEGEADIMISFAVKGHSLAHAYPPGPGLYG",
                "length": 181,
                "header": "tr|F5GYX7-1|MMP10_HUMAN Computationally mapped isoform of Stromelysin-2  OS=Homo sapiens OX=9606 GN=MMP10 PE=1 SV=1 CANONICAL=P09238-1"
            },
            "locus": {
                "chromosome": "11",
                "start_pos": 102780591,
                "end_pos": 102778670,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000539681.1",
                        "url": "https://www.ensembl.org/id/ENST00000539681.1"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000441485.1",
                        "url": "https://www.ensembl.org/id/ENSP00000441485.1"
                    }
                ]
            }
        },
        {
            "isoform_ac": "P09238-1",
            "url": "",
            "sequence": {
                "sequence": "MMHLAFLVLLCLPVCSAYPLSGAAKEEDSNKDLAQQYLEKYYNLEKDVKQFRRKDSNLIVKKIQGMQKFLGLEVTGKLDTDTLEVMRKPRCGVPDVGHFSSFPGMPKWRKTHLTYRIVNYTPDLPRDAVDSAIEKALKVWEEVTPLTFSRLYEGEADIMISFAVKEHGDFYSFDGPGHSLAHAYPPGPGLYGDIHFDDDEKWTEDASGTNLFLVAAHELGHSLGLFHSANTEALMYPLYNSFTELAQFRLSQDDVNGIQSLYGPPPASTEEPLVPTKSVPSGSEMPAKCDPALSFDAISTLRGEYLFFKDRYFWRRSHWNPEPEFHLISAFWPSLPSYLDAAYEVNSRDTVFIFKGNEFWAIRGNEVQAGYPRGIHTLGFPPTIRKIDAAVSDKEKKKTYFFAADKYWRFDENSQSMEQGFPRLIADDFPGVEPKVDAVLQAFGFFYFFSGSSQFEFDPNARMVTHILKSNSWLHC",
                "length": 476,
                "header": "sp|P09238-1|MMP10_HUMAN Isoform 1 of Stromelysin-2  OS=Homo sapiens OX=9606 GN=MMP10 PE=1 SV=1 CANONICAL=P09238-1"
            },
            "locus": {
                "chromosome": "11",
                "start_pos": 102780591,
                "end_pos": 102770796,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000279441.9",
                        "url": "https://www.ensembl.org/id/ENST00000279441.9"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000279441.4",
                        "url": "https://www.ensembl.org/id/ENSP00000279441.4"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [
        "enzyme"
    ],
    "publication": [
        {
            "title": "Antiangiogenic activity of restin, NC10 domain of human collagen XV: comparison to endostatin.",
            "journal": "Biochemical and biophysical research communications",
            "date": "1999",
            "authors": "Ramchandran R, Dhanabal M, Volk R, Waterman MJ, Segal M, Lu H, Knebelmann B, Sukhatme VP",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10049780",
                    "url": "https://glygen.org/publication/PubMed/10049780"
                }
            ]
        },
        {
            "title": "Fibrillin degradation by matrix metalloproteinases: implications for connective tissue remodelling.",
            "journal": "The Biochemical journal",
            "date": "1999",
            "authors": "Ashworth JL, Murphy G, Rock MJ, Sherratt MJ, Shapiro SD, Shuttleworth CA, Kielty CM",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10229672",
                    "url": "https://glygen.org/publication/PubMed/10229672"
                }
            ]
        },
        {
            "title": "Fibrillin degradation by matrix metalloproteinases: identification of amino- and carboxy-terminal cleavage sites.",
            "journal": "FEBS letters",
            "date": "1999",
            "authors": "Hindson VJ, Ashworth JL, Rock MJ, Cunliffe S, Shuttleworth CA, Kielty CM",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10386589",
                    "url": "https://glygen.org/publication/PubMed/10386589"
                }
            ]
        },
        {
            "title": "Catalytic activities and substrate specificity of the human membrane type 4 matrix metalloproteinase catalytic domain.",
            "journal": "The Journal of biological chemistry",
            "date": "1999",
            "authors": "Wang Y, Johnson AR, Ye QZ, Dyer RD",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10551873",
                    "url": "https://glygen.org/publication/PubMed/10551873"
                }
            ]
        },
        {
            "title": "EMMPRIN (CD147), an inducer of matrix metalloproteinase synthesis, also binds interstitial collagenase to the tumor cell surface.",
            "journal": "Cancer research",
            "date": "2000",
            "authors": "Guo H, Li R, Zucker S, Toole BP",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10706100",
                    "url": "https://glygen.org/publication/PubMed/10706100"
                }
            ]
        },
        {
            "title": "Biochemical characterization of the catalytic domain of human matrix metalloproteinase 19. Evidence for a role as a potent basement membrane degrading enzyme.",
            "journal": "The Journal of biological chemistry",
            "date": "2000",
            "authors": "Stracke JO, Hutton M, Stewart M, Pendas AM, Smith B, Lopez-Otin C, Murphy G, Knauper V",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10809722",
                    "url": "https://glygen.org/publication/PubMed/10809722"
                }
            ]
        },
        {
            "title": "Brevican is degraded by matrix metalloproteinases and aggrecanase-1 (ADAMTS4) at different sites.",
            "journal": "The Journal of biological chemistry",
            "date": "2000",
            "authors": "Nakamura H, Fujii Y, Inoki I, Sugimoto K, Tanzawa K, Matsuki H, Miura R, Yamaguchi Y, Okada Y",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10986281",
                    "url": "https://glygen.org/publication/PubMed/10986281"
                }
            ]
        },
        {
            "title": "A short sequence in the N-terminal region is required for the trimerization of type XIII collagen and is conserved in other collagenous transmembrane proteins.",
            "journal": "The EMBO journal",
            "date": "2000",
            "authors": "Snellman A, Tu H, Vaisanen T, Kvist AP, Huhtala P, Pihlajaniemi T",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11013208",
                    "url": "https://glygen.org/publication/PubMed/11013208"
                }
            ]
        },
        {
            "title": "Generation and degradation of human endostatin proteins by various proteinases.",
            "journal": "FEBS letters",
            "date": "2000",
            "authors": "Ferreras M, Felbor U, Lenhard T, Olsen BR, Delaisse J",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11119712",
                    "url": "https://glygen.org/publication/PubMed/11119712"
                }
            ]
        },
        {
            "title": "Osteopontin, a novel substrate for matrix metalloproteinase-3 (stromelysin-1) and matrix metalloproteinase-7 (matrilysin).",
            "journal": "The Journal of biological chemistry",
            "date": "2001",
            "authors": "Agnihotri R, Crawford HC, Haro H, Matrisian LM, Havrda MC, Liaw L",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11375993",
                    "url": "https://glygen.org/publication/PubMed/11375993"
                }
            ]
        },
        {
            "title": "Calprotectin inhibits matrix metalloproteinases by sequestration of zinc.",
            "journal": "Molecular pathology : MP",
            "date": "2001",
            "authors": "Isaksen B, Fagerhol MK",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11577169",
                    "url": "https://glygen.org/publication/PubMed/11577169"
                }
            ]
        },
        {
            "title": "Activation of membrane-type matrix metalloproteinase 3 zymogen by the proprotein convertase furin in the trans-Golgi network.",
            "journal": "Cancer research",
            "date": "2002",
            "authors": "Kang T, Nagase H, Pei D",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11830519",
                    "url": "https://glygen.org/publication/PubMed/11830519"
                }
            ]
        },
        {
            "title": "Overexpression of alpha(v)beta6 integrin in serous epithelial ovarian cancer regulates extracellular matrix degradation via the plasminogen activation cascade.",
            "journal": "Carcinogenesis",
            "date": "2002",
            "authors": "Ahmed N, Pansino F, Clyde R, Murthi P, Quinn MA, Rice GE, Agrez MV, Mok S, Baker MS",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11872628",
                    "url": "https://glygen.org/publication/PubMed/11872628"
                }
            ]
        },
        {
            "title": "CLAC: a novel Alzheimer amyloid plaque component derived from a transmembrane precursor, CLAC-P/collagen type XXV.",
            "journal": "The EMBO journal",
            "date": "2002",
            "authors": "Hashimoto T, Wakabayashi T, Watanabe A, Kowa H, Hosoda R, Nakamura A, Kanazawa I, Arai T, Takio K, Mann DM, Iwatsubo T",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11927537",
                    "url": "https://glygen.org/publication/PubMed/11927537"
                }
            ]
        },
        {
            "title": "Matriptase-2, a membrane-bound mosaic serine proteinase predominantly expressed in human liver and showing degrading activity against extracellular matrix proteins.",
            "journal": "The Journal of biological chemistry",
            "date": "2002",
            "authors": "Velasco G, Cal S, Quesada V, Sanchez LM, Lopez-Otin C",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12149247",
                    "url": "https://glygen.org/publication/PubMed/12149247"
                }
            ]
        },
        {
            "title": "Loss of types XV and XIX collagen precedes basement membrane invasion in ductal carcinoma of the female breast.",
            "journal": "The Journal of pathology",
            "date": "2003",
            "authors": "Amenta PS, Hadad S, Lee MT, Barnard N, Li D, Myers JC",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12579531",
                    "url": "https://glygen.org/publication/PubMed/12579531"
                }
            ]
        },
        {
            "title": "Membrane type-1-matrix metalloproteinase expressed by prostate carcinoma cells cleaves human laminin-5 beta3 chain and induces cell migration.",
            "journal": "Cancer research",
            "date": "2003",
            "authors": "Udayakumar TS, Chen ML, Bair EL, Von Bredow DC, Cress AE, Nagle RB, Bowden GT",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12727852",
                    "url": "https://glygen.org/publication/PubMed/12727852"
                }
            ]
        },
        {
            "title": "The calpain system.",
            "journal": "Physiological reviews",
            "date": "2003",
            "authors": "Goll DE, Thompson VF, Li H, Wei W, Cong J",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12843408",
                    "url": "https://glygen.org/publication/PubMed/12843408"
                }
            ]
        },
        {
            "title": "Interaction of 92-kDa type IV collagenase with the tissue inhibitor of metalloproteinases prevents dimerization, complex formation with interstitial collagenase, and activation of the proenzyme with stromelysin.",
            "journal": "The Journal of biological chemistry",
            "date": "1992",
            "authors": "Goldberg GI, Strongin A, Collier IE, Genrich LT, Marmer BL",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "1311314",
                    "url": "https://glygen.org/publication/PubMed/1311314"
                }
            ]
        },
        {
            "title": "Matrix metalloproteinase 3 (stromelysin) activates the precursor for the human matrix metalloproteinase 9.",
            "journal": "The Journal of biological chemistry",
            "date": "1992",
            "authors": "Ogata Y, Enghild JJ, Nagase H",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "1371271",
                    "url": "https://glygen.org/publication/PubMed/1371271"
                }
            ]
        },
        {
            "title": "Biochemical characterization of matrilysin. Activation conforms to the stepwise mechanisms proposed for other matrix metalloproteinases.",
            "journal": "Biochemistry",
            "date": "1992",
            "authors": "Crabbe T, Willenbrock F, Eaton D, Hynds P, Carne AF, Murphy G, Docherty AJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "1390635",
                    "url": "https://glygen.org/publication/PubMed/1390635"
                }
            ]
        },
        {
            "title": "Activation mechanisms of the precursors of matrix metalloproteinases 1, 2 and 3.",
            "journal": "Matrix (Stuttgart, Germany). Supplement",
            "date": "1992",
            "authors": "Nagase H, Suzuki K, Morodomi T, Enghild JJ, Salvesen G",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "1480033",
                    "url": "https://glygen.org/publication/PubMed/1480033"
                }
            ]
        },
        {
            "title": "HtrA1 serine protease inhibits signaling mediated by Tgfbeta family proteins.",
            "journal": "Development (Cambridge, England)",
            "date": "2004",
            "authors": "Oka C, Tsujimoto R, Kajikawa M, Koshiba-Takeuchi K, Ina J, Yano M, Tsuchiya A, Ueta Y, Soma A, Kanda H, Matsumoto M, Kawaichi M",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14973287",
                    "url": "https://glygen.org/publication/PubMed/14973287"
                }
            ]
        },
        {
            "title": "The shed ectodomain of type XIII collagen affects cell behaviour in a matrix-dependent manner.",
            "journal": "The Biochemical journal",
            "date": "2004",
            "authors": "Vaisanen MR, Vaisanen T, Pihlajaniemi T",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15005656",
                    "url": "https://glygen.org/publication/PubMed/15005656"
                }
            ]
        },
        {
            "title": "Crystal structure of the catalytic domain of human matrix metalloproteinase 10.",
            "journal": "J. Mol. Biol.",
            "date": "2004",
            "authors": "Bertini I, Calderone V, Fragai M, Luchinat C, Mangani S, Terni B",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P09238",
                    "url": "https://www.uniprot.org/uniprot/P09238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15095982",
                    "url": "https://glygen.org/publication/PubMed/15095982"
                }
            ]
        },
        {
            "title": "A novel secreted, cell-surface glycoprotein containing multiple epidermal growth factor-like repeats and one CUB domain is highly expressed in primary osteoblasts and bones.",
            "journal": "The Journal of biological chemistry",
            "date": "2004",
            "authors": "Wu BT, Su YH, Tsai MT, Wasserman SM, Topper JN, Yang RB",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15234972",
                    "url": "https://glygen.org/publication/PubMed/15234972"
                }
            ]
        },
        {
            "title": "Collagenase unwinds triple-helical collagen prior to peptide bond hydrolysis.",
            "journal": "The EMBO journal",
            "date": "2004",
            "authors": "Chung L, Dinakarpandian D, Yoshida N, Lauer-Fields JL, Fields GB, Visse R, Nagase H",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15257288",
                    "url": "https://glygen.org/publication/PubMed/15257288"
                }
            ]
        },
        {
            "title": "BMP-1/Tolloid-like metalloproteases process endorepellin, the angiostatic C-terminal fragment of perlecan.",
            "journal": "The Journal of biological chemistry",
            "date": "2005",
            "authors": "Gonzalez EM, Reed CC, Bix G, Fu J, Zhang Y, Gopalakrishnan B, Greenspan DS, Iozzo RV",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15591058",
                    "url": "https://glygen.org/publication/PubMed/15591058"
                }
            ]
        },
        {
            "title": "Generation of biologically active endostatin fragments from human collagen XVIII by distinct matrix metalloproteases.",
            "journal": "Experimental cell research",
            "date": "2005",
            "authors": "Heljasvaara R, Nyberg P, Luostarinen J, Parikka M, Heikkila P, Rehn M, Sorsa T, Salo T, Pihlajaniemi T",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15950618",
                    "url": "https://glygen.org/publication/PubMed/15950618"
                }
            ]
        },
        {
            "title": "ADAM10 mediates E-cadherin shedding and regulates epithelial cell-cell adhesion, migration, and beta-catenin translocation.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "2005",
            "authors": "Maretzky T, Reiss K, Ludwig A, Buchholz J, Scholz F, Proksch E, de Strooper B, Hartmann D, Saftig P",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15958533",
                    "url": "https://glygen.org/publication/PubMed/15958533"
                }
            ]
        },
        {
            "title": "Human glioblastomas overexpress ADAMTS-5 that degrades brevican.",
            "journal": "Acta neuropathologica",
            "date": "2005",
            "authors": "Nakada M, Miyamori H, Kita D, Takahashi T, Yamashita J, Sato H, Miura R, Yamaguchi Y, Okada Y",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16133547",
                    "url": "https://glygen.org/publication/PubMed/16133547"
                }
            ]
        },
        {
            "title": "Matrix metalloproteinase degradation of elastin, type IV collagen and proteoglycan. A quantitative comparison of the activities of 95 kDa and 72 kDa gelatinases, stromelysins-1 and -2 and punctuated metalloproteinase (PUMP).",
            "journal": "The Biochemical journal",
            "date": "1991",
            "authors": "Murphy G, Cockett MI, Ward RV, Docherty AJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "1649600",
                    "url": "https://glygen.org/publication/PubMed/1649600"
                }
            ]
        },
        {
            "title": "Alpha-V-dependent outside-in signaling is required for the regulation of CD44 surface expression, MMP-2 secretion, and cell migration by osteopontin in human melanoma cells.",
            "journal": "Experimental cell research",
            "date": "2006",
            "authors": "Samanna V, Wei H, Ego-Osuala D, Chellaiah MA",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16631740",
                    "url": "https://glygen.org/publication/PubMed/16631740"
                }
            ]
        },
        {
            "title": "TIMP independence of matrix metalloproteinase (MMP)-2 activation by membrane type 2 (MT2)-MMP is determined by contributions of both the MT2-MMP catalytic and hemopexin C domains.",
            "journal": "The Journal of biological chemistry",
            "date": "2006",
            "authors": "Morrison CJ, Overall CM",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16825197",
                    "url": "https://glygen.org/publication/PubMed/16825197"
                }
            ]
        },
        {
            "title": "Cathepsin s promotes human preadipocyte differentiation: possible involvement of fibronectin degradation.",
            "journal": "Endocrinology",
            "date": "2006",
            "authors": "Taleb S, Cancello R, Clement K, Lacasa D",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16825321",
                    "url": "https://glygen.org/publication/PubMed/16825321"
                }
            ]
        },
        {
            "title": "The consensus coding sequences of human breast and colorectal cancers.",
            "journal": "Science (New York, N.Y.)",
            "date": "2006",
            "authors": "Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P09238",
                    "url": "https://www.uniprot.org/uniprot/P09238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16959974",
                    "url": "https://glygen.org/publication/PubMed/16959974"
                }
            ]
        },
        {
            "title": "Sequence identity between the alpha 2-macroglobulin receptor and low density lipoprotein receptor-related protein suggests that this molecule is a multifunctional receptor.",
            "journal": "The Journal of biological chemistry",
            "date": "1990",
            "authors": "Strickland DK, Ashcom JD, Williams S, Burgess WH, Migliorini M, Argraves WS",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "1698775",
                    "url": "https://glygen.org/publication/PubMed/1698775"
                }
            ]
        },
        {
            "title": "Increased gene expression of matrix metalloproteinase-3 (stromelysin) in skin fibroblasts from patients with severe recessive dystrophic epidermolysis bullosa.",
            "journal": "Biochemical and biophysical research communications",
            "date": "1991",
            "authors": "Sawamura D, Sugawara T, Hashimoto I, Bruckner-Tuderman L, Fujimoto D, Okada Y, Utsumi N, Shikata H",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "1704217",
                    "url": "https://glygen.org/publication/PubMed/1704217"
                }
            ]
        },
        {
            "title": "Hyaluronan and its binding proteins, the hyaladherins.",
            "journal": "Current opinion in cell biology",
            "date": "1990",
            "authors": "Toole BP",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "1707285",
                    "url": "https://glygen.org/publication/PubMed/1707285"
                }
            ]
        },
        {
            "title": "Enzymatic processing of collagen IV by MMP-2 (gelatinase A) affects neutrophil migration and it is modulated by extracatalytic domains.",
            "journal": "Protein science : a publication of the Protein Society",
            "date": "2006",
            "authors": "Monaco S, Sparano V, Gioia M, Sbardella D, Di Pierro D, Marini S, Coletta M",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17088321",
                    "url": "https://glygen.org/publication/PubMed/17088321"
                }
            ]
        },
        {
            "title": "Engagement of collagen-binding integrins promotes matrix metalloproteinase-9-dependent E-cadherin ectodomain shedding in ovarian carcinoma cells.",
            "journal": "Cancer research",
            "date": "2007",
            "authors": "Symowicz J, Adley BP, Gleason KJ, Johnson JJ, Ghosh S, Fishman DA, Hudson LG, Stack MS",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17332331",
                    "url": "https://glygen.org/publication/PubMed/17332331"
                }
            ]
        },
        {
            "title": "Kallikrein 7 enhances pancreatic cancer cell invasion by shedding E-cadherin.",
            "journal": "Cancer",
            "date": "2007",
            "authors": "Johnson SK, Ramani VC, Hennings L, Haun RS",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17354228",
                    "url": "https://glygen.org/publication/PubMed/17354228"
                }
            ]
        },
        {
            "title": "The calpains: modular designs and functional diversity.",
            "journal": "Genome biology",
            "date": "2007",
            "authors": "Croall DE, Ersfeld K",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17608959",
                    "url": "https://glygen.org/publication/PubMed/17608959"
                }
            ]
        },
        {
            "title": "Substrate specificities and activation mechanisms of matrix metalloproteinases.",
            "journal": "Biochemical Society transactions",
            "date": "1991",
            "authors": "Nagase H, Ogata Y, Suzuki K, Enghild JJ, Salvesen G",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "1783204",
                    "url": "https://glygen.org/publication/PubMed/1783204"
                }
            ]
        },
        {
            "title": "The ectodomain shedding of E-cadherin by ADAM15 supports ErbB receptor activation.",
            "journal": "The Journal of biological chemistry",
            "date": "2008",
            "authors": "Najy AJ, Day KC, Day ML",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18434311",
                    "url": "https://glygen.org/publication/PubMed/18434311"
                }
            ]
        },
        {
            "title": "Matrix metalloproteinase-11/stromelysin-3 exhibits collagenolytic function against collagen VI under normal and malignant conditions.",
            "journal": "Oncogene",
            "date": "2008",
            "authors": "Motrescu ER, Blaise S, Etique N, Messaddeq N, Chenard MP, Stoll I, Tomasetto C, Rio MC",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18622425",
                    "url": "https://glygen.org/publication/PubMed/18622425"
                }
            ]
        },
        {
            "title": "Caspase-3 activation triggers extracellular cathepsin L release and endorepellin proteolysis.",
            "journal": "The Journal of biological chemistry",
            "date": "2008",
            "authors": "Cailhier JF, Sirois I, Laplante P, Lepage S, Raymond MA, Brassard N, Prat A, Iozzo RV, Pshezhetsky AV, Hebert MJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18658137",
                    "url": "https://glygen.org/publication/PubMed/18658137"
                }
            ]
        },
        {
            "title": "Membrane-type 1 matrix metalloproteinase regulates macrophage-dependent elastolytic activity and aneurysm formation in vivo.",
            "journal": "The Journal of biological chemistry",
            "date": "2009",
            "authors": "Xiong W, Knispel R, MacTaggart J, Greiner TC, Weiss SJ, Baxter BT",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19010778",
                    "url": "https://glygen.org/publication/PubMed/19010778"
                }
            ]
        },
        {
            "title": "MT1-MMP-mediated cleavage of decorin in corneal angiogenesis.",
            "journal": "Journal of vascular research",
            "date": "2009",
            "authors": "Mimura T, Han KY, Onguchi T, Chang JH, Kim TI, Kojima T, Zhou Z, Azar DT",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19571574",
                    "url": "https://glygen.org/publication/PubMed/19571574"
                }
            ]
        },
        {
            "title": "Identification of a novel HtrA1-susceptible cleavage site in human aggrecan: evidence for the involvement of HtrA1 in aggrecan proteolysis in vivo.",
            "journal": "The Journal of biological chemistry",
            "date": "2009",
            "authors": "Chamberland A, Wang E, Jones AR, Collins-Racie LA, LaVallie ER, Huang Y, Liu L, Morris EA, Flannery CR, Yang Z",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19657146",
                    "url": "https://glygen.org/publication/PubMed/19657146"
                }
            ]
        },
        {
            "title": "ADAM-8 isolated from human osteoarthritic chondrocytes cleaves fibronectin at Ala(271).",
            "journal": "Arthritis and rheumatism",
            "date": "2009",
            "authors": "Zack MD, Malfait AM, Skepner AP, Yates MP, Griggs DW, Hall T, Hills RL, Alston JT, Nemirovskiy OV, Radabaugh MR, Leone JW, Arner EC, Tortorella MD",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19714641",
                    "url": "https://glygen.org/publication/PubMed/19714641"
                }
            ]
        },
        {
            "title": "Sites of stromelysin cleavage in collagen types II, IX, X, and XI of cartilage.",
            "journal": "The Journal of biological chemistry",
            "date": "1991",
            "authors": "Wu JJ, Lark MW, Chun LE, Eyre DR",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "2005102",
                    "url": "https://glygen.org/publication/PubMed/2005102"
                }
            ]
        },
        {
            "title": "Matrix metalloproteinase-19 is highly expressed in astroglial tumors and promotes invasion of glioma cells.",
            "journal": "Journal of neuropathology and experimental neurology",
            "date": "2010",
            "authors": "Lettau I, Hattermann K, Held-Feindt J, Brauer R, Sedlacek R, Mentlein R",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20142769",
                    "url": "https://glygen.org/publication/PubMed/20142769"
                }
            ]
        },
        {
            "title": "Expanding members and roles of the calpain superfamily and their genetically modified animals.",
            "journal": "Experimental animals",
            "date": "2010",
            "authors": "Sorimachi H, Hata S, Ono Y",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21030783",
                    "url": "https://glygen.org/publication/PubMed/21030783"
                }
            ]
        },
        {
            "title": "Substrate-induced remodeling of the active site regulates human HTRA1 activity.",
            "journal": "Nature structural & molecular biology",
            "date": "2011",
            "authors": "Truebestein L, Tennstaedt A, Monig T, Krojer T, Canellas F, Kaiser M, Clausen T, Ehrmann M",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21297635",
                    "url": "https://glygen.org/publication/PubMed/21297635"
                }
            ]
        },
        {
            "title": "SCUBE3 is an endogenous TGF-beta receptor ligand and regulates the epithelial-mesenchymal transition in lung cancer.",
            "journal": "Oncogene",
            "date": "2011",
            "authors": "Wu YY, Peck K, Chang YL, Pan SH, Cheng YF, Lin JC, Yang RB, Hong TM, Yang PC",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21441952",
                    "url": "https://glygen.org/publication/PubMed/21441952"
                }
            ]
        },
        {
            "title": "Extracellular matrix composition and remodeling in human abdominal aortic aneurysms: a proteomics approach.",
            "journal": "Molecular & cellular proteomics : MCP",
            "date": "2011",
            "authors": "Didangelos A, Yin X, Mandal K, Saje A, Smith A, Xu Q, Jahangiri M, Mayr M",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21593211",
                    "url": "https://glygen.org/publication/PubMed/21593211"
                }
            ]
        },
        {
            "title": "Characterization and activation of procollagenase from human polymorphonuclear leucocytes. N-terminal sequence determination of the proenzyme and various proteolytically activated forms.",
            "journal": "European journal of biochemistry",
            "date": "1990",
            "authors": "Knauper V, Kramer S, Reinke H, Tschesche H",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "2159879",
                    "url": "https://glygen.org/publication/PubMed/2159879"
                }
            ]
        },
        {
            "title": "Calpain chronicle--an enzyme family under multidisciplinary characterization.",
            "journal": "Proceedings of the Japan Academy. Series B, Physical and biological sciences",
            "date": "2011",
            "authors": "Sorimachi H, Hata S, Ono Y",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21670566",
                    "url": "https://glygen.org/publication/PubMed/21670566"
                }
            ]
        },
        {
            "title": "The role of matrix metalloproteinase 3 in the stepwise activation of human rheumatoid synovial procollagenase.",
            "journal": "Biological chemistry Hoppe-Seyler",
            "date": "1990",
            "authors": "Suzuki K, Nagase H, Ito A, Enghild JJ, Salvesen G",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "2169257",
                    "url": "https://glygen.org/publication/PubMed/2169257"
                }
            ]
        },
        {
            "title": "Tumor promoter-stimulated Mr 92,000 gelatinase secreted by normal and malignant human cells: isolation and characterization of the enzyme from HT1080 tumor cells.",
            "journal": "Cancer research",
            "date": "1990",
            "authors": "Moll UM, Youngleib GL, Rosinski KB, Quigley JP",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "2169335",
                    "url": "https://glygen.org/publication/PubMed/2169335"
                }
            ]
        },
        {
            "title": "Mechanisms of activation of tissue procollagenase by matrix metalloproteinase 3 (stromelysin).",
            "journal": "Biochemistry",
            "date": "1990",
            "authors": "Suzuki K, Enghild JJ, Morodomi T, Salvesen G, Nagase H",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "2176865",
                    "url": "https://glygen.org/publication/PubMed/2176865"
                }
            ]
        },
        {
            "title": "Classical and neonatal Marfan syndrome mutations in fibrillin-1 cause differential protease susceptibilities and protein function.",
            "journal": "The Journal of biological chemistry",
            "date": "2011",
            "authors": "Kirschner R, Hubmacher D, Iyengar G, Kaur J, Fagotto-Kaufmann C, Bromme D, Bartels R, Reinhardt DP",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21784848",
                    "url": "https://glygen.org/publication/PubMed/21784848"
                }
            ]
        },
        {
            "title": "Calpains: an elaborate proteolytic system.",
            "journal": "Biochimica et biophysica acta",
            "date": "2012",
            "authors": "Ono Y, Sorimachi H",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21864727",
                    "url": "https://glygen.org/publication/PubMed/21864727"
                }
            ]
        },
        {
            "title": "MMP mediated degradation of type VI collagen is highly associated with liver fibrosis--identification and validation of a novel biochemical marker assay.",
            "journal": "PloS one",
            "date": "2011",
            "authors": "Veidal SS, Karsdal MA, Vassiliadis E, Nawrocki A, Larsen MR, Nguyen QH, Hagglund P, Luo Y, Zheng Q, Vainer B, Leeming DJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21935455",
                    "url": "https://glygen.org/publication/PubMed/21935455"
                }
            ]
        },
        {
            "title": "MT1-MMP regulates the turnover and endocytosis of extracellular matrix fibronectin.",
            "journal": "Journal of cell science",
            "date": "2011",
            "authors": "Shi F, Sottile J",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22159414",
                    "url": "https://glygen.org/publication/PubMed/22159414"
                }
            ]
        },
        {
            "title": "Molecular identification of hydroxylysine kinase and of ammoniophospholyases acting on 5-phosphohydroxy-L-lysine and phosphoethanolamine.",
            "journal": "The Journal of biological chemistry",
            "date": "2012",
            "authors": "Veiga-da-Cunha M, Hadi F, Balligand T, Stroobant V, Van Schaftingen E",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22241472",
                    "url": "https://glygen.org/publication/PubMed/22241472"
                }
            ]
        },
        {
            "title": "MMP mediated type V collagen degradation (C5M) is elevated in ankylosing spondylitis.",
            "journal": "Clinical biochemistry",
            "date": "2012",
            "authors": "Veidal SS, Larsen DV, Chen X, Sun S, Zheng Q, Bay-Jensen AC, Leeming DJ, Nawrocki A, Larsen MR, Schett G, Karsdal MA",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22382088",
                    "url": "https://glygen.org/publication/PubMed/22382088"
                }
            ]
        },
        {
            "title": "Purification and characterization of extracellular matrix-degrading metalloproteinase, matrin (pump-1), secreted from human rectal carcinoma cell line.",
            "journal": "Cancer research",
            "date": "1990",
            "authors": "Miyazaki K, Hattori Y, Umenishi F, Yasumitsu H, Umeda M",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "2253219",
                    "url": "https://glygen.org/publication/PubMed/2253219"
                }
            ]
        },
        {
            "title": "Matrix metalloproteinase 2 from human rheumatoid synovial fibroblasts. Purification and activation of the precursor and enzymic properties.",
            "journal": "European journal of biochemistry",
            "date": "1990",
            "authors": "Okada Y, Morodomi T, Enghild JJ, Suzuki K, Yasui A, Nakanishi I, Salvesen G, Nagase H",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "2269296",
                    "url": "https://glygen.org/publication/PubMed/2269296"
                }
            ]
        },
        {
            "title": "Structure-function relationships in calpains.",
            "journal": "The Biochemical journal",
            "date": "2012",
            "authors": "Campbell RL, Davies PL",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23035980",
                    "url": "https://glygen.org/publication/PubMed/23035980"
                }
            ]
        },
        {
            "title": "Stepwise activation mechanisms of the precursor of matrix metalloproteinase 3 (stromelysin) by proteinases and (4-aminophenyl)mercuric acetate.",
            "journal": "Biochemistry",
            "date": "1990",
            "authors": "Nagase H, Enghild JJ, Suzuki K, Salvesen G",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "2383557",
                    "url": "https://glygen.org/publication/PubMed/2383557"
                }
            ]
        },
        {
            "title": "Characterization of opticin digestion by proteases involved in osteoarthritis development.",
            "journal": "Joint, bone, spine : revue du rhumatisme",
            "date": "2014",
            "authors": "Tio L, Martel-Pelletier J, Pelletier JP, Bishop PN, Roughley P, Farran A, Benito P, Monfort J",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23845380",
                    "url": "https://glygen.org/publication/PubMed/23845380"
                }
            ]
        },
        {
            "title": "Cleavage of type VII collagen by interstitial collagenase and type IV collagenase (gelatinase) derived from human skin.",
            "journal": "The Journal of biological chemistry",
            "date": "1989",
            "authors": "Seltzer JL, Eisen AZ, Bauer EA, Morris NP, Glanville RW, Burgeson RE",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "2537292",
                    "url": "https://glygen.org/publication/PubMed/2537292"
                }
            ]
        },
        {
            "title": "Activation of neutrophil collagenase by cathepsin G.",
            "journal": "Inflammation",
            "date": "1989",
            "authors": "Capodici C, Muthukumaran G, Amoruso MA, Berg RA",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "2546891",
                    "url": "https://glygen.org/publication/PubMed/2546891"
                }
            ]
        },
        {
            "title": "Human and rat malignant-tumor-associated mRNAs encode stromelysin-like metalloproteinases.",
            "journal": "Biochemistry",
            "date": "1989",
            "authors": "Nicholson R, Murphy G, Breathnach R",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "2548603",
                    "url": "https://glygen.org/publication/PubMed/2548603"
                }
            ]
        },
        {
            "title": "SV40-transformed human lung fibroblasts secrete a 92-kDa type IV collagenase which is identical to that secreted by normal human macrophages.",
            "journal": "The Journal of biological chemistry",
            "date": "1989",
            "authors": "Wilhelm SM, Collier IE, Marmer BL, Eisen AZ, Grant GA, Goldberg GI",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "2551898",
                    "url": "https://glygen.org/publication/PubMed/2551898"
                }
            ]
        },
        {
            "title": "Tissue kallikrein effectively activates latent matrix degrading metalloenzymes.",
            "journal": "Advances in experimental medicine and biology",
            "date": "1989",
            "authors": "Tschesche H, Michaelis J, Kohnert U, Fedrowitz J, Oberhoff R",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "2557753",
                    "url": "https://glygen.org/publication/PubMed/2557753"
                }
            ]
        },
        {
            "title": "H-ras oncogene-transformed human bronchial epithelial cells (TBE-1) secrete a single metalloprotease capable of degrading basement membrane collagen.",
            "journal": "The Journal of biological chemistry",
            "date": "1988",
            "authors": "Collier IE, Wilhelm SM, Eisen AZ, Marmer BL, Grant GA, Seltzer JL, Kronberger A, He CS, Bauer EA, Goldberg GI",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "2834383",
                    "url": "https://glygen.org/publication/PubMed/2834383"
                }
            ]
        },
        {
            "title": "The collagenase gene family in humans consists of at least four members.",
            "journal": "Biochem. J.",
            "date": "1988",
            "authors": "Muller D, Quantin B, Gesnel MC, Millon-Collard R, Abecassis J, Breathnach R",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P09238",
                    "url": "https://www.uniprot.org/uniprot/P09238"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "2844164",
                    "url": "https://glygen.org/publication/PubMed/2844164"
                }
            ]
        },
        {
            "title": "Purification of a gelatin-degrading type IV collagenase secreted by ras oncogene-transformed fibroblasts.",
            "journal": "Journal of the National Cancer Institute",
            "date": "1988",
            "authors": "Spinucci C, Zucker S, Wieman JM, Lysik RM, Imhof B, Ramamurthy N, Liotta LA, Nagase H",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "2845110",
                    "url": "https://glygen.org/publication/PubMed/2845110"
                }
            ]
        },
        {
            "title": "The collagen substrate specificity of human neutrophil collagenase.",
            "journal": "The Journal of biological chemistry",
            "date": "1987",
            "authors": "Hasty KA, Jeffrey JJ, Hibbs MS, Welgus HG",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "3038863",
                    "url": "https://glygen.org/publication/PubMed/3038863"
                }
            ]
        },
        {
            "title": "The precursor of a metalloendopeptidase from human rheumatoid synovial fibroblasts. Purification and mechanisms of activation by endopeptidases and 4-aminophenylmercuric acetate.",
            "journal": "The Biochemical journal",
            "date": "1988",
            "authors": "Okada Y, Harris ED Jr, Nagase H",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "3058116",
                    "url": "https://glygen.org/publication/PubMed/3058116"
                }
            ]
        },
        {
            "title": "Degradation of basement membranes by human matrix metalloproteinase 3 (stromelysin).",
            "journal": "The Biochemical journal",
            "date": "1988",
            "authors": "Bejarano PA, Noelken ME, Suzuki K, Hudson BG, Nagase H",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "3223920",
                    "url": "https://glygen.org/publication/PubMed/3223920"
                }
            ]
        },
        {
            "title": "Asymptomatic SARS-CoV-2 Infection Is Associated With Higher Levels of Serum IL-17C, Matrix Metalloproteinase 10 and Fibroblast Growth Factors Than Mild Symptomatic COVID-19.",
            "journal": "Frontiers in immunology",
            "date": "2022",
            "authors": "Soares-Schanoski A, Sauerwald N, Goforth CW, Periasamy S, Weir DL, Lizewski S, Lizewski R, Ge Y, Kuzmina NA, Nair VD, Vangeti S, Marjanovic N, Cappuccio A, Cheng WS, Mofsowitz S, Miller CM, Yu XB, George MC, Zaslavsky E, Bukreyev A, Troyanskaya OG, Sealfon SC, Letizia AG, Ramos I",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_002416",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002416"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "35479098",
                    "url": "https://glygen.org/publication/PubMed/35479098"
                }
            ]
        },
        {
            "title": "Study on the Mechanism of circRNA-0024103 Reducing Endothelial Cell Injury by Regulating miR-363/MMP-10.",
            "journal": "Contrast media & molecular imaging",
            "date": "2022",
            "authors": "Tian Y, Zheng G, Xie H, Guo Y, Zeng H, Fu Y, Liu X",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_002416",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002416"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "35992547",
                    "url": "https://glygen.org/publication/PubMed/35992547"
                }
            ]
        },
        {
            "title": "Higher Content but Not Activity of Stromelysin-2 (MMP-10) in Comparison to Stromelysin-1 (MMP-3) in Human Renal Carcinoma.",
            "journal": "International journal of environmental research and public health",
            "date": "2022-10-02",
            "authors": "Kudelski Jacek, M\u0142ynarczyk Grzegorz, Gudowska-Sawczuk Monika, Mroczko Barbara, Darewicz Barbara, Bruczko-Goralewska Marta, Romanowicz Lech",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_002416",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002416"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "36231910",
                    "url": "https://glygen.org/publication/PubMed/36231910"
                }
            ]
        },
        {
            "title": "The roles of MMP8/MMP10 polymorphisms in ischemic stroke susceptibility.",
            "journal": "Brain and behavior",
            "date": "2022-12",
            "authors": "Zhao Yong, Zhang Qi, Zhang Xiaobo, Zhang Yu, Lu Ying, Ma Xiaojuan, Li Weiping, Niu Xiaochen, Zhang Gejuan, Chang Mingze, Shi Wenzhen, Tian Ye",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_002416",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002416"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "36282475",
                    "url": "https://glygen.org/publication/PubMed/36282475"
                }
            ]
        },
        {
            "title": "Matrix metalloproteinase-10 deficiency has protective effects against peritoneal inflammation and fibrosis via transcription factor NF\u03ba\u0392 pathway inhibition.",
            "journal": "Kidney international",
            "date": "2023-08-29",
            "authors": "Ishimura Takuya, Ishii Akira, Yamada Hiroyuki, Osaki Keisuke, Toda Naohiro, Mori Keita P, Ohno Shoko, Kato Yukiko, Handa Takaya, Sugioka Sayaka, Ikushima Akie, Nishio Haruomi, Yanagita Motoko, Yokoi Hideki",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_002416",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002416"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "37652204",
                    "url": "https://glygen.org/publication/PubMed/37652204"
                }
            ]
        },
        {
            "title": "Presence of a gelatin-specific proteinase and its latent form in human leucocytes.",
            "journal": "Biochimica et biophysica acta",
            "date": "1974",
            "authors": "Sopata I, Dancewicz AM",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "4216367",
                    "url": "https://glygen.org/publication/PubMed/4216367"
                }
            ]
        },
        {
            "title": "Partial purification and characterization of a neutral protease which cleaves type IV collagen.",
            "journal": "Biochemistry",
            "date": "1981",
            "authors": "Liotta LA, Tryggvason K, Garbisa S, Robey PG, Abe S",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "6258630",
                    "url": "https://glygen.org/publication/PubMed/6258630"
                }
            ]
        },
        {
            "title": "The latent collagenase and gelatinase of human polymorphonuclear neutrophil leucocytes.",
            "journal": "The Biochemical journal",
            "date": "1980",
            "authors": "Murphy G, Bretz U, Baggiolini M, Reynolds JJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "6263256",
                    "url": "https://glygen.org/publication/PubMed/6263256"
                }
            ]
        },
        {
            "title": "The collagen substrate specificity of human skin fibroblast collagenase.",
            "journal": "The Journal of biological chemistry",
            "date": "1981",
            "authors": "Welgus HG, Jeffrey JJ, Eisen AZ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "6270089",
                    "url": "https://glygen.org/publication/PubMed/6270089"
                }
            ]
        },
        {
            "title": "Type VIII collagen. Synthesis by normal and malignant cells in culture.",
            "journal": "Laboratory investigation; a journal of technical methods and pathology",
            "date": "1984",
            "authors": "Sage H, Balian G, Vogel AM, Bornstein P",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "6694361",
                    "url": "https://glygen.org/publication/PubMed/6694361"
                }
            ]
        },
        {
            "title": "Characterization of the binding domains in the fragments cleaved by cathepsin G from human plasma fibronectin.",
            "journal": "European journal of biochemistry",
            "date": "1982",
            "authors": "Vartio T",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7075587",
                    "url": "https://glygen.org/publication/PubMed/7075587"
                }
            ]
        },
        {
            "title": "Release of biological activities from quiescent fibronectin by a conformational change and limited proteolysis by matrix metalloproteinases.",
            "journal": "Biochemistry",
            "date": "1995",
            "authors": "Fukai F, Ohtaki M, Fujii N, Yajima H, Ishii T, Nishizawa Y, Miyazaki K, Katayama T",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7547873",
                    "url": "https://glygen.org/publication/PubMed/7547873"
                }
            ]
        },
        {
            "title": "Proteolytic and non-proteolytic activation of human neutrophil progelatinase B.",
            "journal": "Biochimica et biophysica acta",
            "date": "1995",
            "authors": "Sang QX, Birkedal-Hansen H, Van Wart HE",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7669817",
                    "url": "https://glygen.org/publication/PubMed/7669817"
                }
            ]
        },
        {
            "title": "Furin-dependent intracellular activation of the human stromelysin-3 zymogen.",
            "journal": "Nature",
            "date": "1995",
            "authors": "Pei D, Weiss SJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7746327",
                    "url": "https://glygen.org/publication/PubMed/7746327"
                }
            ]
        },
        {
            "title": "Activation of progelatinase B (MMP-9) by gelatinase A (MMP-2).",
            "journal": "Cancer research",
            "date": "1995",
            "authors": "Fridman R, Toth M, Pena D, Mobashery S",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7780967",
                    "url": "https://glygen.org/publication/PubMed/7780967"
                }
            ]
        },
        {
            "title": "Activation of precursors for matrix metalloproteinases 1 (interstitial collagenase) and 3 (stromelysin) by rat mast-cell proteinases I and II.",
            "journal": "The Biochemical journal",
            "date": "1995",
            "authors": "Suzuki K, Lees M, Newlands GF, Nagase H, Woolley DE",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7826345",
                    "url": "https://glygen.org/publication/PubMed/7826345"
                }
            ]
        },
        {
            "title": "Mechanism of cell surface activation of 72-kDa type IV collagenase. Isolation of the activated form of the membrane metalloprotease.",
            "journal": "The Journal of biological chemistry",
            "date": "1995",
            "authors": "Strongin AY, Collier I, Bannikov G, Marmer BL, Grant GA, Goldberg GI",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7890645",
                    "url": "https://glygen.org/publication/PubMed/7890645"
                }
            ]
        },
        {
            "title": "Matrix metalloproteinase-2 is an interstitial collagenase. Inhibitor-free enzyme catalyzes the cleavage of collagen fibrils and soluble native type I collagen generating the specific 3/4- and 1/4-length fragments.",
            "journal": "The Journal of biological chemistry",
            "date": "1995",
            "authors": "Aimes RT, Quigley JP",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7890717",
                    "url": "https://glygen.org/publication/PubMed/7890717"
                }
            ]
        },
        {
            "title": "Matrix metalloproteinase 7 (matrilysin) from human rectal carcinoma cells. Activation of the precursor, interaction with other matrix metalloproteinases and enzymic properties.",
            "journal": "The Journal of biological chemistry",
            "date": "1995",
            "authors": "Imai K, Yokohama Y, Nakanishi I, Ohuchi E, Fujii Y, Nakai N, Okada Y",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7896811",
                    "url": "https://glygen.org/publication/PubMed/7896811"
                }
            ]
        },
        {
            "title": "Reciprocated matrix metalloproteinase activation: a process performed by interstitial collagenase and progelatinase A.",
            "journal": "Biochemistry",
            "date": "1994",
            "authors": "Crabbe T, O'Connell JP, Smith BJ, Docherty AJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7981201",
                    "url": "https://glygen.org/publication/PubMed/7981201"
                }
            ]
        },
        {
            "title": "A matrix metalloproteinase expressed on the surface of invasive tumour cells.",
            "journal": "Nature",
            "date": "1994",
            "authors": "Sato H, Takino T, Okada Y, Cao J, Shinagawa A, Yamamoto E, Seiki M",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8015608",
                    "url": "https://glygen.org/publication/PubMed/8015608"
                }
            ]
        },
        {
            "title": "Human progelatinase A can be activated by matrilysin.",
            "journal": "FEBS letters",
            "date": "1994",
            "authors": "Crabbe T, Smith B, O'Connell J, Docherty A",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8194591",
                    "url": "https://glygen.org/publication/PubMed/8194591"
                }
            ]
        },
        {
            "title": "Cloning and characterization of a unique elastolytic metalloproteinase produced by human alveolar macrophages.",
            "journal": "The Journal of biological chemistry",
            "date": "1993",
            "authors": "Shapiro SD, Kobayashi DK, Ley TJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8226919",
                    "url": "https://glygen.org/publication/PubMed/8226919"
                }
            ]
        },
        {
            "title": "Plasma membrane-dependent activation of the 72-kDa type IV collagenase is prevented by complex formation with TIMP-2.",
            "journal": "The Journal of biological chemistry",
            "date": "1993",
            "authors": "Strongin AY, Marmer BL, Grant GA, Goldberg GI",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8314771",
                    "url": "https://glygen.org/publication/PubMed/8314771"
                }
            ]
        },
        {
            "title": "Role of zinc-binding- and hemopexin domain-encoded sequences in the substrate specificity of collagenase and stromelysin-2 as revealed by chimeric proteins.",
            "journal": "The Journal of biological chemistry",
            "date": "1993",
            "authors": "Sanchez-Lopez R, Alexander CM, Behrendtsen O, Breathnach R, Werb Z",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8463259",
                    "url": "https://glygen.org/publication/PubMed/8463259"
                }
            ]
        },
        {
            "title": "Intermolecular autolytic cleavage can contribute to the activation of progelatinase A by cell membranes.",
            "journal": "The Journal of biological chemistry",
            "date": "1995",
            "authors": "Atkinson SJ, Crabbe T, Cowell S, Ward RV, Butler MJ, Sato H, Seiki M, Reynolds JJ, Murphy G",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8530478",
                    "url": "https://glygen.org/publication/PubMed/8530478"
                }
            ]
        },
        {
            "title": "Biochemical characterization of human collagenase-3.",
            "journal": "The Journal of biological chemistry",
            "date": "1996",
            "authors": "Knauper V, Lopez-Otin C, Smith B, Knight G, Murphy G",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8576151",
                    "url": "https://glygen.org/publication/PubMed/8576151"
                }
            ]
        },
        {
            "title": "Transmembrane-deletion mutants of the membrane-type matrix metalloproteinase-1 process progelatinase A and express intrinsic matrix-degrading activity.",
            "journal": "The Journal of biological chemistry",
            "date": "1996",
            "authors": "Pei D, Weiss SJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8621565",
                    "url": "https://glygen.org/publication/PubMed/8621565"
                }
            ]
        },
        {
            "title": "The degradation of human endothelial cell-derived perlecan and release of bound basic fibroblast growth factor by stromelysin, collagenase, plasmin, and heparanases.",
            "journal": "The Journal of biological chemistry",
            "date": "1996",
            "authors": "Whitelock JM, Murdoch AD, Iozzo RV, Underwood PA",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8626565",
                    "url": "https://glygen.org/publication/PubMed/8626565"
                }
            ]
        },
        {
            "title": "Characterization of structural determinants and molecular mechanisms involved in pro-stromelysin-3 activation by 4-aminophenylmercuric acetate and furin-type convertases.",
            "journal": "The Biochemical journal",
            "date": "1996",
            "authors": "Santavicca M, Noel A, Angliker H, Stoll I, Segain JP, Anglard P, Chretien M, Seidah N, Basset P",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8645182",
                    "url": "https://glygen.org/publication/PubMed/8645182"
                }
            ]
        },
        {
            "title": "Cellular mechanisms for human procollagenase-3 (MMP-13) activation. Evidence that MT1-MMP (MMP-14) and gelatinase a (MMP-2) are able to generate active enzyme.",
            "journal": "The Journal of biological chemistry",
            "date": "1996",
            "authors": "Knauper V, Will H, Lopez-Otin C, Smith B, Atkinson SJ, Stanton H, Hembry RM, Murphy G",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8663255",
                    "url": "https://glygen.org/publication/PubMed/8663255"
                }
            ]
        },
        {
            "title": "Activation of a recombinant membrane type 1-matrix metalloproteinase (MT1-MMP) by furin and its interaction with tissue inhibitor of metalloproteinases (TIMP)-2.",
            "journal": "FEBS letters",
            "date": "1996",
            "authors": "Sato H, Kinoshita T, Takino T, Nakayama K, Seiki M",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8804434",
                    "url": "https://glygen.org/publication/PubMed/8804434"
                }
            ]
        },
        {
            "title": "Macrophage metalloelastase degrades matrix and myelin proteins and processes a tumour necrosis factor-alpha fusion protein.",
            "journal": "Biochemical and biophysical research communications",
            "date": "1996",
            "authors": "Chandler S, Cossins J, Lury J, Wells G",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8920930",
                    "url": "https://glygen.org/publication/PubMed/8920930"
                }
            ]
        },
        {
            "title": "Membrane type 1 matrix metalloproteinase digests interstitial collagens and other extracellular matrix macromolecules.",
            "journal": "The Journal of biological chemistry",
            "date": "1997",
            "authors": "Ohuchi E, Imai K, Fujii Y, Sato H, Seiki M, Okada Y",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8999957",
                    "url": "https://glygen.org/publication/PubMed/8999957"
                }
            ]
        },
        {
            "title": "The role of the C-terminal domain of human collagenase-3 (MMP-13) in the activation of procollagenase-3, substrate specificity, and tissue inhibitor of metalloproteinase interaction.",
            "journal": "The Journal of biological chemistry",
            "date": "1997",
            "authors": "Knauper V, Cowell S, Smith B, Lopez-Otin C, O'Shea M, Morris H, Zardi L, Murphy G",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9065415",
                    "url": "https://glygen.org/publication/PubMed/9065415"
                }
            ]
        },
        {
            "title": "Expression of three membrane-type matrix metalloproteinases (MT-MMPs) in rat vascular smooth muscle cells and characterization of MT3-MMPs with and without transmembrane domain.",
            "journal": "The Journal of biological chemistry",
            "date": "1997",
            "authors": "Shofuda K, Yasumitsu H, Nishihashi A, Miki K, Miyazaki K",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9092507",
                    "url": "https://glygen.org/publication/PubMed/9092507"
                }
            ]
        },
        {
            "title": "Hydrolysis of a broad spectrum of extracellular matrix proteins by human macrophage elastase.",
            "journal": "The Journal of biological chemistry",
            "date": "1997",
            "authors": "Gronski TJ Jr, Martin RL, Kobayashi DK, Walsh BC, Holman MC, Huber M, Van Wart HE, Shapiro SD",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9115292",
                    "url": "https://glygen.org/publication/PubMed/9115292"
                }
            ]
        },
        {
            "title": "Degradation of decorin by matrix metalloproteinases: identification of the cleavage sites, kinetic analyses and transforming growth factor-beta1 release.",
            "journal": "The Biochemical journal",
            "date": "1997",
            "authors": "Imai K, Hiramatsu A, Fukushima D, Pierschbacher MD, Okada Y",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9148753",
                    "url": "https://glygen.org/publication/PubMed/9148753"
                }
            ]
        },
        {
            "title": "Activation of type IV procollagenases by human tumor-associated trypsin-2.",
            "journal": "The Journal of biological chemistry",
            "date": "1997",
            "authors": "Sorsa T, Salo T, Koivunen E, Tyynela J, Konttinen YT, Bergmann U, Tuuttila A, Niemi E, Teronen O, Heikkila P, Tschesche H, Leinonen J, Osman S, Stenman UH",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9261109",
                    "url": "https://glygen.org/publication/PubMed/9261109"
                }
            ]
        },
        {
            "title": "Activation of progelatinase B (proMMP-9) by active collagenase-3 (MMP-13).",
            "journal": "European journal of biochemistry",
            "date": "1997",
            "authors": "Knauper V, Smith B, Lopez-Otin C, Murphy G",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9346290",
                    "url": "https://glygen.org/publication/PubMed/9346290"
                }
            ]
        },
        {
            "title": "The TIMP2 membrane type 1 metalloproteinase `receptor` regulates the concentration and efficient activation of progelatinase A. A kinetic study.",
            "journal": "The Journal of biological chemistry",
            "date": "1998",
            "authors": "Butler GS, Butler MJ, Atkinson SJ, Will H, Tamura T, Schade van Westrum S, Crabbe T, Clements J, d'Ortho MP, Murphy G",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9422744",
                    "url": "https://glygen.org/publication/PubMed/9422744"
                }
            ]
        },
        {
            "title": "Membrane-type matrix metalloproteinases 1 and 2 exhibit broad-spectrum proteolytic capacities comparable to many matrix metalloproteinases.",
            "journal": "European journal of biochemistry",
            "date": "1997",
            "authors": "d'Ortho MP, Will H, Atkinson S, Butler G, Messent A, Gavrilovic J, Smith B, Timpl R, Zardi L, Murphy G",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9461298",
                    "url": "https://glygen.org/publication/PubMed/9461298"
                }
            ]
        },
        {
            "title": "Activation of the precursor of human stromelysin 2 and its interactions with other matrix metalloproteinases.",
            "journal": "European journal of biochemistry",
            "date": "1998",
            "authors": "Nakamura H, Fujii Y, Ohuchi E, Yamamoto E, Okada Y",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9578462",
                    "url": "https://glygen.org/publication/PubMed/9578462"
                }
            ]
        },
        {
            "title": "TIMP-2 promotes activation of progelatinase A by membrane-type 1 matrix metalloproteinase immobilized on agarose beads.",
            "journal": "The Journal of biological chemistry",
            "date": "1998",
            "authors": "Kinoshita T, Sato H, Okada A, Ohuchi E, Imai K, Okada Y, Seiki M",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1592389",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9632662",
                    "url": "https://glygen.org/publication/PubMed/9632662"
                }
            ]
        },
        {
            "title": "Cloning and characterization of a novel matrix metalloproteinase (MMP), CMMP, from chicken embryo fibroblasts. CMMP, Xenopus XMMP, and human MMP19 have a conserved unique cysteine in the catalytic domain.",
            "journal": "The Journal of biological chemistry",
            "date": "1998",
            "authors": "Yang M, Kurkinen M",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1442490",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9651395",
                    "url": "https://glygen.org/publication/PubMed/9651395"
                }
            ]
        },
        {
            "title": "Human HtrA, an evolutionarily conserved serine protease identified as a differentially expressed gene product in osteoarthritic cartilage.",
            "journal": "The Journal of biological chemistry",
            "date": "1998",
            "authors": "Hu SI, Carozza M, Klein M, Nantermet P, Luk D, Crowl RM",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1474228",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9852107",
                    "url": "https://glygen.org/publication/PubMed/9852107"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "hsa:4319",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4319",
            "resource": "KEGG Pathway"
        },
        {
            "id": "R-HSA-1442490",
            "name": "Collagen degradation",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490",
            "resource": "Reactome",
            "description": "Collagen degradation"
        },
        {
            "id": "R-HSA-1474228",
            "name": "Degradation of the extracellular matrix",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228",
            "resource": "Reactome",
            "description": "Degradation of the extracellular matrix"
        },
        {
            "id": "R-HSA-1592389",
            "name": "Activation of Matrix Metalloproteinases",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389",
            "resource": "Reactome",
            "description": "Activation of Matrix Metalloproteinases"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "O55123-1",
            "protein_name": "Stromelysin-2",
            "gene_name": "Mmp10",
            "tax_id": 10090,
            "organism": "Mus musculus",
            "sequence": {
                "sequence": "MEPLAILALLSLPICSAYPLHGAVTQGHPSMDLAQQYLEKYYNFKKNEKQIFKRKDSSPVVKKIQEMQKFLGLEMTGKLDSNTMELMHKPRCGVPDVGGFSTFPGSPKWRKSHITYRIVNYTPDLPRQSVDSAIEKALKVWEEVTPLTFSRISEGEADIMISFAVGEHGDFYPFDGPGQSLAHAYPPGPGFYGDVHFDDDEKWTLAPSGTNLFLVAAHELGHSLGLFHSDKKESLMYPVYRFSTSPANFHLSQDDIEGIQSLYGAGPSSDATVVPVLSVSPRPETPDKCDPALSFDSVSTLRGEVLFFKDRYFWRRSHWNPEPEFHLISAFWPTLPSDLDAAYEAHNTDSVLIFKGSQFWAVRGNEVQAGYPKGIHTLGFPPTVKKIDAAVFEKEKKKTYFFVGDKYWRFDETRHVMDKGFPRQITDDFPGIEPQVDAVLHEFGFFYFFRGSSQFEFDPNARTVTHILKSNSWLLC",
                "length": 476
            },
            "evidence": [
                {
                    "id": "45934914",
                    "url": "http://www.informatics.jax.org/homology/45934914",
                    "database": "MGI"
                },
                {
                    "id": "P09238",
                    "url": "https://omabrowser.org/oma/group/P09238/",
                    "database": "OMA"
                }
            ],
            "common_name": "Mouse"
        },
        {
            "uniprot_canonical_ac": "P07152-1",
            "protein_name": "Stromelysin-2",
            "gene_name": "Mmp10",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MEPLAILVLLCFPICSAYPLHGAVRQDHSTMDLAQQYLEKYYNFRKNEKQFFKRKDSSPVVKKIEEMQKFLGLEMTGKLDSNTVEMMHKPRCGVPDVGGFSTFPGSPKWRKNHISYRIVNYTLDLPRESVDSAIERALKVWEEVTPLTFSRISEGEADIMISFAVGEHGDFYPFDGVGQSLAHAYPPGPGFYGDAHFDDDEKWSLGPSGTNLFLVAAHELGHSLGLFHSNNKESLMYPVYRFSTSQANIRLSQDDIEGIQSLYGARPSSDATVVPVPSVSPKPETPVKCDPALSFDAVTMLRGEFLFFKDRHFWRRTQWNPEPEFHLISAFWPSLPSGLDAAYEANNKDRVLIFKGSQFWAVRGNEVQAGYPKRIHTLGFPPTVKKIDAAVFEKEKKKTYFFVGDKYWRFDETRQLMDKGFPRLITDDFPGIEPQVDAVLHAFGFFYFFCGSSQFEFDPNARTVTHTLKSNSWLLC",
                "length": 476
            },
            "evidence": [
                {
                    "id": "45934914",
                    "url": "http://www.informatics.jax.org/homology/45934914",
                    "database": "MGI"
                }
            ],
            "common_name": "Rat"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Molecular Function",
                "total": 3,
                "go_terms": [
                    {
                        "name": "metalloendopeptidase activity",
                        "id": "GO:0004222",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004222",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P09238",
                                "url": "https://www.uniprot.org/uniprot/P09238"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "serine-type endopeptidase activity",
                        "id": "GO:0004252",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004252",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P09238",
                                "url": "https://www.uniprot.org/uniprot/P09238"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "zinc ion binding",
                        "id": "GO:0008270",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P09238",
                                "url": "https://www.uniprot.org/uniprot/P09238"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 3,
                "go_terms": [
                    {
                        "name": "extracellular region",
                        "id": "GO:0005576",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P09238",
                                "url": "https://www.uniprot.org/uniprot/P09238"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "extracellular space",
                        "id": "GO:0005615",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P09238",
                                "url": "https://www.uniprot.org/uniprot/P09238"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "extracellular matrix",
                        "id": "GO:0031012",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031012",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P09238",
                                "url": "https://www.uniprot.org/uniprot/P09238"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 4,
                "go_terms": [
                    {
                        "name": "proteolysis",
                        "id": "GO:0006508",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006508",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P09238",
                                "url": "https://www.uniprot.org/uniprot/P09238"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "extracellular matrix disassembly",
                        "id": "GO:0022617",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022617",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P09238",
                                "url": "https://www.uniprot.org/uniprot/P09238"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "extracellular matrix organization",
                        "id": "GO:0030198",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030198",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P09238",
                                "url": "https://www.uniprot.org/uniprot/P09238"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "collagen catabolic process",
                        "id": "GO:0030574",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030574",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P09238",
                                "url": "https://www.uniprot.org/uniprot/P09238"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 119,
            "end_pos": 121,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [
        {
            "id": "R-HSA-1454781",
            "name": "MMP1,3,13 (2, 7-12, 19) binding by Alpha-2 macroglubulin",
            "equation": "",
            "summary": "Alpha 2-macroglobulin (A2M) is a plasma glycoprotein consisting of 4 near-identical subunits (Andersen et al. 1995). A2M inhibits almost all endopeptidases regardless of their specificities (Barrett 1981). A2M binding to an endopeptidase is triggered by cleavage of a peptide bond in the 'bait region' of A2M, triggering a conformational change in A2M that in turn entraps the peptidase without blocking the active site (Barrett & Starkey 1973). This blocks enzyme activity against large protein substrates while not preventing activity on low molecular weight substrates. <br><br>Once bound, A2M-proteinase complexes are endocytosed by low density lipoprotein receptor-related protein-1 (LRP1) (Strickland et al. 1990). <br><br>Active metalloproteinases (MMPs) that can be entrapped by A2M include MMP3 (Enghild et al. 1989) MMP1 (Grinnell et al. 1998) and MMP 13 (Beekman et al. 1999).<br><br>The significance of this mechanism as a regulator of MMP activity is unclear (Baker et al. 2002, Nagase et al. 2006).",
            "cellular_location": "extracellular region",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P03956-1",
                "P39900-1",
                "P14780-1",
                "P08253-1",
                "P24347-1",
                "P45452-1",
                "P09238-1",
                "P09237-1",
                "P08254-1",
                "O60882-1",
                "P22894-1",
                "Q99542-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-1454781",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1454781"
                }
            ]
        },
        {
            "id": "R-HSA-1564142",
            "name": "Collagen type IV degradation by MMP2,3,4,9,10,12",
            "equation": "",
            "summary": "Type IV collagen is the most abundant structural basement membrane (BM) component, providing a scaffold for other major BM proteins such as laminin (Charonis et al. 1985, 1986). There are six different genes encoding type IV collagen chains, alpha-1 to alpha-6(IV) with distinct tissue distributions. Three alpha chains fold to form the triple helical unit of collagen IV. Three chain combinations have been identified, alpha-1X2 alpha-2(IV), alpha-3,alpha-4, alpha-5(IV) and alpha-5X2, alpha-6(IV) (Borza et al. 2001). The first is the major form, found in all basement membranes, the other types have more restricted distributions. <br><br>Collagen IV forms a lattice network rather than extended fibrils. It can be digested by MMP2 (Liotta et al. 1981, Salo et al. 1983, Bergers et al. 2000, Monaco et al. 2006), MMP3 (Okada et al. 1986, Wilhelm et al. 1987, Bejarano et al. 1988, Nicholson et al. 1989), MMP7 (Miyazaki et al. 1990, Murphy et al. 1991), MMP9 (Moll et al. 1990, Morodomi et al. 1992, Murphy et al. 1991, Watanabe et al. 1993, Bergers et al. 2000), MMP10 (Nicholson et al. 1989) and MMP12 (Chandler et al. 1996).",
            "cellular_location": "extracellular region",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P39900-1",
                "P14780-1",
                "P08253-1",
                "P09238-1",
                "P09237-1",
                "P08254-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-1564142",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1564142"
                }
            ]
        },
        {
            "id": "R-HSA-1564164",
            "name": "Collagen type V degradation by MMP2,9,10",
            "equation": "",
            "summary": "Type V collagen is a fibril-forming collagen forming a group with collagen types I, II, III and XI (Gelse et al. 2003). Three different alpha chains exist that can combine in three distinct trimers. Collagen V forms fibrils that are associated with type I and to a lesser extent III collagen, as a minor but critical component of bone matrix, corneal stroma and the interstitial matrix of muscle, liver, lung and placenta (Birk et al. 1988). COL5A1-/- mice have an almost complete lack of collagen fibrils reflecting a central role in fibrillogenesis (Wenstrup et al. 2004). Type V collagen mutation results in a range of connective tissue diseases including Ehlers-Danlos syndrome (EDS), which is a heterogeneous group of disorders characterized by joint hypermobility and skin hyperextensibility, thinness and fragility. These result from mutations in the COL5A1 and COL5A2 genes (Michalickova et al. 1998, Schwarze et al. 2000).  ; ; ; Type V collagen is digested by MMP2 (Murphy et al. 1981, Veidal et al. 2011), MMP10 (Nicholson et al. 1989), and MMP9 (Murphy et al. 1982, Watanabe et al. 1993, Pourmotabbed et al. 1994, Niyibizi et al. 1994, Veidal et al. 2011).",
            "cellular_location": "extracellular region",
            "input_participant_list": [
                "R-HSA-1609685"
            ],
            "output_participant_list": [
                "R-HSA-2470128"
            ],
            "enzyme_list": [
                "P14780-1",
                "P08253-1",
                "P09238-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-1564164",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1564164"
                }
            ]
        },
        {
            "id": "R-HSA-1566962",
            "name": "Elastin degradation by elastin-degrading extracellular proteinases",
            "equation": "",
            "summary": "The elastin component of elastic fibres is degraded to soluble fragments by MMP2 (Murphy et al. 1991), MMP7 (Quantin et al. 1989, Murphy et al. 1991), MMP9 (Murphy et al. 1991, Katsuda et al. 1994) and MMP12 (macrophage elastase) (Shapiro et al. 1993, Taddese et al. 2008), and to a limited extent by MMP3 and 10 (Murphy et al. 1991). In addition, elastin is a substrate for neutrophil elastase (Reilly & Travis 1980).<br>Eighty-nine tropoelastin cleavage sites were identified for MMP-12, whereas MMP-7 and MMP-9 were found to cleave at only 58 and 63 sites, respectively (Heinz et al. 2010).",
            "cellular_location": "extracellular region",
            "input_participant_list": [
                "R-HSA-2161232"
            ],
            "output_participant_list": [
                "R-HSA-2514799"
            ],
            "enzyme_list": [
                "P08246-1",
                "P39900-1",
                "P14780-1",
                "P08253-1",
                "P09238-1",
                "P09237-1",
                "P08254-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-1566962",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566962"
                }
            ]
        },
        {
            "id": "R-HSA-1592297",
            "name": "Full activation of MMP1",
            "equation": "",
            "summary": "The 42 kDa intermediate form of MMP1 is fully activated by cleavage of the Gln99-Phe100 bond, producing a 41 kDa protein. MMP2 (Crabbe et al. 1994), MMP3 (Suzuki et al. 1990, Nagase et al. 1992), MMP7 (Imai et al. 1995), MMP10 (Nicholson et al. 1989) and MMP11 (Murphy et al. 1993) are able to convert the 42 kDa intermediate to fully activated 41 kDa form though they are not able to initiate activation of proMMP1 effectively (Nagase et al. 1992). MMP3 regulates MMP1 collagenase activity in human rheumatoid synovial fibroblasts (Unemori et al. 1991).",
            "cellular_location": "extracellular region",
            "input_participant_list": [],
            "output_participant_list": [
                "R-HSA-375064"
            ],
            "enzyme_list": [
                "P03956-1",
                "P08253-1",
                "P24347-1",
                "P09238-1",
                "P09237-1",
                "P08254-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-1592297",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592297"
                }
            ]
        },
        {
            "id": "R-HSA-1592436",
            "name": "Initial activation of proMMP9 by MMPs",
            "equation": "",
            "summary": "MMP1 (Sang et al. 1995), MMP2 (Fridman et al. 1995), MMP3 (Goldberg et al. 1992, Ogata et al. 1992, Okada et al. 1992), MMP7 (Imai et al. 1995, Sang et al. 1995), MMP10 (Nakamura et al. 1998) and MMP13 (Knauper et al. 1997) activate MMP9 by a stepwise mechanism but the second cleavage is apparently not an autocatalytic event as is the case for MMP1 (Okada et al. 1992). The first site is the Glu59-Met60 bond, generating an inactive 85-86 kDa intermediate (O'Connell et al. 1994), followed by cleavage of the Arg106-Phe107 peptide bond producing the fullly active 82 kDa form of MMP9 (Okada et al. 1992, Fridman et al. 1995).",
            "cellular_location": "extracellular region",
            "input_participant_list": [
                "R-HSA-1604376"
            ],
            "output_participant_list": [
                "R-HSA-1604685"
            ],
            "enzyme_list": [
                "P03956-1",
                "P14780-1",
                "P08253-1",
                "P45452-1",
                "P09238-1",
                "P09237-1",
                "P08254-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-1592436",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592436"
                }
            ]
        },
        {
            "id": "R-HSA-1602458",
            "name": "Activation of proMMP10",
            "equation": "",
            "summary": "proMMP10 is similar in sequence to proMMP3 with just one residue difference in the bait region. The activation mechanism is believed to be similar, namely cleavage in the N-terminal bait region, followed by autocatalytic cleavage at  His81-Phe82 (Woessner & Nagasse 2000). proMMP10 is activated by plasmin, trypsin and chymotrypsin.",
            "cellular_location": "extracellular region",
            "input_participant_list": [
                "R-HSA-1604748"
            ],
            "output_participant_list": [
                "R-HSA-1442488"
            ],
            "enzyme_list": [
                "P17538-1",
                "Q6GPI1-1",
                "P00747-1",
                "P09238-1",
                "P07477-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-1602458",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1602458"
                }
            ]
        },
        {
            "id": "R-HSA-1604690",
            "name": "Activation of MMP9 intermediate form by MMPs",
            "equation": "",
            "summary": "The intermediate form of MMP9 is activated by cleavage of the Arg106-Phe107 peptide bond producing the fullly active 82-kDa MMP-9 species (Ogata et al. 1992, Fridman et al. 1995).",
            "cellular_location": "extracellular region",
            "input_participant_list": [
                "R-HSA-1604726"
            ],
            "output_participant_list": [
                "R-HSA-1604699"
            ],
            "enzyme_list": [
                "P03956-1",
                "P14780-1",
                "P08253-1",
                "P45452-1",
                "P09238-1",
                "P09237-1",
                "P08254-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-1604690",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1604690"
                }
            ]
        },
        {
            "id": "R-HSA-2485111",
            "name": "Collagen type III degradation by MMP10",
            "equation": "",
            "summary": "MMP10 (Stromelysin-2) is able to degrade collagen type III (Nicholson et al. 1989).",
            "cellular_location": "extracellular region",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P09238-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-2485111",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2485111"
                }
            ]
        },
        {
            "id": "R-HSA-2533944",
            "name": "Fibronectin degradation by MMP10",
            "equation": "",
            "summary": "MMP10 can degrade fibronectin (Nicholson et al. 1989).",
            "cellular_location": "extracellular region",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P09238-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-2533944",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2533944"
                }
            ]
        },
        {
            "id": "R-HSA-3791149",
            "name": "Brevican degradation by MMP1, 2, 3, 7,8,10,13,19",
            "equation": "",
            "summary": "Brevican, a member of the lectican family, is one of the most abundant proteoglycans in normal adult brain tissues. It is thought to form lattice structures by linking hyaluronan and tenascin-R through its  N- and C-terminal globular domains, respectively. As brain extracellular matrix (ECM) contains no collagen fibrils, this matrix of hyaluronan/brevican/tenascin-R is considered essential to maintain the integrity of brain ECM. Degradation of brevican by proteinases disrupts ECM structures and facilitates invasion of glioma cells (Yamaguchi 2000). \n; \n; The major brevican cleavage site observed under physiological conditions (Yamada et al. 1994) and during glioma invasion (Zhang et al. 1998) is the Glu395-Ser396 bond present within the central domain of the core protein, forming an ~50-kDa N-terminal fragment. This bond is cleaved by ADAMTS4 and 5 (Nakamura et al. 2000, Matthews et al. 2000, Nakada et al. 2005). Matrix metalloproteinases that digest brevican (MMP-1, -2, -3, -7, -8, -10, -13 and -19) preferentially cleave the Ala360-Phe361 bond. (Nakamura et al. 2000, Nakada et al. 2005, Lettau et al. 2010).",
            "cellular_location": "extracellular region",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P03956-1",
                "P08253-1",
                "P45452-1",
                "P09238-1",
                "P09237-1",
                "P08254-1",
                "P22894-1",
                "Q99542-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-3791149",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3791149"
                }
            ]
        },
        {
            "id": "R-NUL-2485115",
            "name": "Collagen type III degradation by MMP10",
            "equation": "",
            "summary": "MMP10 (Stromelysin-2) degrades collagen type III (Nicholson et al. 1989).",
            "cellular_location": "extracellular region",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P09238-1"
            ],
            "evidence": [
                {
                    "id": "R-NUL-2485115",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-NUL-2485115"
                }
            ]
        }
    ],
    "reaction_participants": [
        {
            "participant_id": "R-HSA-1442488",
            "participant_name": "MMP10 [extracellular region]",
            "crossref": [
                {
                    "id": "MMP10_HUMAN",
                    "database": "ZINC - Investigational",
                    "url": ""
                },
                {
                    "id": "P09238",
                    "database": "ZINC target",
                    "url": ""
                },
                {
                    "id": "3.4.24.22",
                    "database": "IntEnz",
                    "url": ""
                },
                {
                    "id": "ENSG00000166670-MMP10",
                    "database": "HPA",
                    "url": ""
                },
                {
                    "id": "HMDBP07801",
                    "database": "HMDB Protein",
                    "url": ""
                },
                {
                    "id": "P09238",
                    "database": "UniProt",
                    "url": ""
                },
                {
                    "id": "ENSG00000166670",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "3V96",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENST00000279441",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "NP_002416.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "4ILW",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "MMP10_HUMAN",
                    "database": "ZINC - Predictions - Purchasable",
                    "url": ""
                },
                {
                    "id": "P09238",
                    "database": "GeneCards",
                    "url": ""
                },
                {
                    "id": "MMP10_HUMAN",
                    "database": "ZINC - Substances",
                    "url": ""
                },
                {
                    "id": "P09238",
                    "database": "Pharos - Targets",
                    "url": ""
                },
                {
                    "id": "1Q3A",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSP00000279441",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "1634",
                    "database": "Guide to Pharmacology - Targets",
                    "url": ""
                },
                {
                    "id": "P09238",
                    "database": "PRO",
                    "url": ""
                },
                {
                    "id": "ENSG00000166670",
                    "database": "OpenTargets",
                    "url": ""
                }
            ]
        },
        {
            "participant_id": "R-HSA-1604376",
            "participant_name": "MMP9(20-707) [extracellular region]",
            "crossref": [
                {
                    "id": "P14780",
                    "database": "UniProt",
                    "url": ""
                },
                {
                    "id": "MMP9_HUMAN",
                    "database": "ZINC - Investigational",
                    "url": ""
                },
                {
                    "id": "4XCT",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2OW0",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "HMDBP02128",
                    "database": "HMDB Protein",
                    "url": ""
                },
                {
                    "id": "4WZV",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2OVZ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSG00000100985-MMP9",
                    "database": "HPA",
                    "url": ""
                },
                {
                    "id": "P14780",
                    "database": "ZINC target",
                    "url": ""
                },
                {
                    "id": "P14780",
                    "database": "Pharos - Targets",
                    "url": ""
                },
                {
                    "id": "1ITV",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4JQG",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "P14780",
                    "database": "GeneCards",
                    "url": ""
                },
                {
                    "id": "MMP9_HUMAN",
                    "database": "ZINC - Substances",
                    "url": ""
                },
                {
                    "id": "1L6J",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4JIJ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "6ESM",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "MMP9_HUMAN",
                    "database": "ZINC - Biogenic",
                    "url": ""
                },
                {
                    "id": "2OVX",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4H3X",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5TH9",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4H2E",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5TH6",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "MMP9_HUMAN",
                    "database": "ZINC - Metabolites",
                    "url": ""
                },
                {
                    "id": "MMP9_HUMAN",
                    "database": "ZINC - Predictions - Purchasable",
                    "url": ""
                },
                {
                    "id": "ENSG00000100985",
                    "database": "OpenTargets",
                    "url": ""
                },
                {
                    "id": "NP_004985.2",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "1GKD",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4HMA",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5UE4",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1GKC",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4H82",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5UE3",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2OW1",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5CUH",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSG00000100985",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "18601",
                    "database": "Orphanet",
                    "url": ""
                },
                {
                    "id": "ENSP00000361405",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENST00000372330",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "1633",
                    "database": "Guide to Pharmacology - Targets",
                    "url": ""
                },
                {
                    "id": "2OW2",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "P14780",
                    "database": "PRO",
                    "url": ""
                },
                {
                    "id": "MMP9_HUMAN",
                    "database": "ZINC - FDA approved",
                    "url": ""
                },
                {
                    "id": "5I12",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "MMP9_HUMAN",
                    "database": "ZINC - World Drugs",
                    "url": ""
                },
                {
                    "id": "4H1Q",
                    "database": "PDB",
                    "url": ""
                }
            ]
        },
        {
            "participant_id": "R-HSA-1604685",
            "participant_name": "MMP9(20-59) [extracellular region]",
            "crossref": [
                {
                    "id": "MMP9_HUMAN",
                    "database": "ZINC - Metabolites",
                    "url": ""
                },
                {
                    "id": "1633",
                    "database": "Guide to Pharmacology - Targets",
                    "url": ""
                },
                {
                    "id": "ENSG00000100985-MMP9",
                    "database": "HPA",
                    "url": ""
                },
                {
                    "id": "4H82",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4JIJ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5I12",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4JQG",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1GKD",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2OW0",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSG00000100985",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "4H3X",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "MMP9_HUMAN",
                    "database": "ZINC - Investigational",
                    "url": ""
                },
                {
                    "id": "2OW1",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "MMP9_HUMAN",
                    "database": "ZINC - Biogenic",
                    "url": ""
                },
                {
                    "id": "P14780",
                    "database": "PRO",
                    "url": ""
                },
                {
                    "id": "P14780",
                    "database": "Pharos - Targets",
                    "url": ""
                },
                {
                    "id": "ENSG00000100985",
                    "database": "OpenTargets",
                    "url": ""
                },
                {
                    "id": "4H1Q",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "MMP9_HUMAN",
                    "database": "ZINC - Substances",
                    "url": ""
                },
                {
                    "id": "5UE4",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4WZV",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSP00000361405",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "4H2E",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "P14780",
                    "database": "UniProt",
                    "url": ""
                },
                {
                    "id": "1GKC",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1L6J",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENST00000372330",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "2OVZ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5TH6",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "MMP9_HUMAN",
                    "database": "ZINC - FDA approved",
                    "url": ""
                },
                {
                    "id": "1ITV",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "NP_004985.2",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "4XCT",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5CUH",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2OVX",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "MMP9_HUMAN",
                    "database": "ZINC - World Drugs",
                    "url": ""
                },
                {
                    "id": "6ESM",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5UE3",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "P14780",
                    "database": "ZINC target",
                    "url": ""
                },
                {
                    "id": "2OW2",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "MMP9_HUMAN",
                    "database": "ZINC - Predictions - Purchasable",
                    "url": ""
                },
                {
                    "id": "HMDBP02128",
                    "database": "HMDB Protein",
                    "url": ""
                },
                {
                    "id": "5TH9",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "18601",
                    "database": "Orphanet",
                    "url": ""
                },
                {
                    "id": "4HMA",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "P14780",
                    "database": "GeneCards",
                    "url": ""
                }
            ]
        },
        {
            "participant_id": "R-HSA-1604699",
            "participant_name": "MMP9(60-106) [extracellular region]",
            "crossref": [
                {
                    "id": "MMP9_HUMAN",
                    "database": "ZINC - Substances",
                    "url": ""
                },
                {
                    "id": "4WZV",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "P14780",
                    "database": "Pharos - Targets",
                    "url": ""
                },
                {
                    "id": "MMP9_HUMAN",
                    "database": "ZINC - Investigational",
                    "url": ""
                },
                {
                    "id": "ENSG00000100985-MMP9",
                    "database": "HPA",
                    "url": ""
                },
                {
                    "id": "4JQG",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2OW0",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1L6J",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "P14780",
                    "database": "ZINC target",
                    "url": ""
                },
                {
                    "id": "HMDBP02128",
                    "database": "HMDB Protein",
                    "url": ""
                },
                {
                    "id": "P14780",
                    "database": "GeneCards",
                    "url": ""
                },
                {
                    "id": "P14780",
                    "database": "UniProt",
                    "url": ""
                },
                {
                    "id": "2OVZ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1ITV",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4XCT",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5TH9",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "18601",
                    "database": "Orphanet",
                    "url": ""
                },
                {
                    "id": "4HMA",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "6ESM",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5UE3",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2OW2",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "MMP9_HUMAN",
                    "database": "ZINC - Predictions - Purchasable",
                    "url": ""
                },
                {
                    "id": "MMP9_HUMAN",
                    "database": "ZINC - World Drugs",
                    "url": ""
                },
                {
                    "id": "1GKC",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5TH6",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENST00000372330",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "2OVX",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5CUH",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "MMP9_HUMAN",
                    "database": "ZINC - FDA approved",
                    "url": ""
                },
                {
                    "id": "NP_004985.2",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "4JIJ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5UE4",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSP00000361405",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "4H2E",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "P14780",
                    "database": "PRO",
                    "url": ""
                },
                {
                    "id": "ENSG00000100985",
                    "database": "OpenTargets",
                    "url": ""
                },
                {
                    "id": "MMP9_HUMAN",
                    "database": "ZINC - Biogenic",
                    "url": ""
                },
                {
                    "id": "2OW1",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4H1Q",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4H82",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "MMP9_HUMAN",
                    "database": "ZINC - Metabolites",
                    "url": ""
                },
                {
                    "id": "1633",
                    "database": "Guide to Pharmacology - Targets",
                    "url": ""
                },
                {
                    "id": "4H3X",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSG00000100985",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "5I12",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1GKD",
                    "database": "PDB",
                    "url": ""
                }
            ]
        },
        {
            "participant_id": "R-HSA-1604726",
            "participant_name": "MMP9(60-707) [extracellular region]",
            "crossref": [
                {
                    "id": "P14780",
                    "database": "UniProt",
                    "url": ""
                },
                {
                    "id": "MMP9_HUMAN",
                    "database": "ZINC - Investigational",
                    "url": ""
                },
                {
                    "id": "4XCT",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2OW0",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "HMDBP02128",
                    "database": "HMDB Protein",
                    "url": ""
                },
                {
                    "id": "4WZV",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2OVZ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSG00000100985-MMP9",
                    "database": "HPA",
                    "url": ""
                },
                {
                    "id": "P14780",
                    "database": "ZINC target",
                    "url": ""
                },
                {
                    "id": "P14780",
                    "database": "Pharos - Targets",
                    "url": ""
                },
                {
                    "id": "1ITV",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4JQG",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "P14780",
                    "database": "GeneCards",
                    "url": ""
                },
                {
                    "id": "MMP9_HUMAN",
                    "database": "ZINC - Substances",
                    "url": ""
                },
                {
                    "id": "1L6J",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4JIJ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "6ESM",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "MMP9_HUMAN",
                    "database": "ZINC - Biogenic",
                    "url": ""
                },
                {
                    "id": "2OVX",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4H3X",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5TH9",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4H2E",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5TH6",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "MMP9_HUMAN",
                    "database": "ZINC - Metabolites",
                    "url": ""
                },
                {
                    "id": "MMP9_HUMAN",
                    "database": "ZINC - Predictions - Purchasable",
                    "url": ""
                },
                {
                    "id": "ENSG00000100985",
                    "database": "OpenTargets",
                    "url": ""
                },
                {
                    "id": "NP_004985.2",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "1GKD",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4HMA",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5UE4",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1GKC",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4H82",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5UE3",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2OW1",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5CUH",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSG00000100985",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "18601",
                    "database": "Orphanet",
                    "url": ""
                },
                {
                    "id": "ENSP00000361405",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENST00000372330",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "1633",
                    "database": "Guide to Pharmacology - Targets",
                    "url": ""
                },
                {
                    "id": "2OW2",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "P14780",
                    "database": "PRO",
                    "url": ""
                },
                {
                    "id": "MMP9_HUMAN",
                    "database": "ZINC - FDA approved",
                    "url": ""
                },
                {
                    "id": "5I12",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "MMP9_HUMAN",
                    "database": "ZINC - World Drugs",
                    "url": ""
                },
                {
                    "id": "4H1Q",
                    "database": "PDB",
                    "url": ""
                }
            ]
        },
        {
            "participant_id": "R-HSA-1604748",
            "participant_name": "MMP10(18-476) [extracellular region]",
            "crossref": [
                {
                    "id": "P09238",
                    "database": "UniProt",
                    "url": ""
                },
                {
                    "id": "1Q3A",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSG00000166670-MMP10",
                    "database": "HPA",
                    "url": ""
                },
                {
                    "id": "MMP10_HUMAN",
                    "database": "ZINC - Substances",
                    "url": ""
                },
                {
                    "id": "3V96",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1634",
                    "database": "Guide to Pharmacology - Targets",
                    "url": ""
                },
                {
                    "id": "MMP10_HUMAN",
                    "database": "ZINC - Investigational",
                    "url": ""
                },
                {
                    "id": "MMP10_HUMAN",
                    "database": "ZINC - Predictions - Purchasable",
                    "url": ""
                },
                {
                    "id": "NP_002416.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "ENSG00000166670",
                    "database": "OpenTargets",
                    "url": ""
                },
                {
                    "id": "HMDBP07801",
                    "database": "HMDB Protein",
                    "url": ""
                },
                {
                    "id": "P09238",
                    "database": "Pharos - Targets",
                    "url": ""
                },
                {
                    "id": "ENSG00000166670",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000279441",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "P09238",
                    "database": "ZINC target",
                    "url": ""
                },
                {
                    "id": "P09238",
                    "database": "GeneCards",
                    "url": ""
                },
                {
                    "id": "ENST00000279441",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "P09238",
                    "database": "PRO",
                    "url": ""
                },
                {
                    "id": "3.4.24.22",
                    "database": "IntEnz",
                    "url": ""
                },
                {
                    "id": "4ILW",
                    "database": "PDB",
                    "url": ""
                }
            ]
        },
        {
            "participant_id": "R-HSA-1609685",
            "participant_name": "Collagen V [extracellular region]",
            "crossref": [
                {
                    "id": "36080",
                    "database": "ChEBI",
                    "url": ""
                }
            ]
        },
        {
            "participant_id": "R-HSA-2161232",
            "participant_name": "Elastin [extracellular region]",
            "crossref": [
                {
                    "id": "36080",
                    "database": "ChEBI",
                    "url": ""
                }
            ]
        },
        {
            "participant_id": "R-HSA-2470128",
            "participant_name": "Cleaved collagen type V fibril [extracellular region]",
            "crossref": [
                {
                    "id": "36080",
                    "database": "ChEBI",
                    "url": ""
                }
            ]
        },
        {
            "participant_id": "R-HSA-2514799",
            "participant_name": "Cleaved elastin [extracellular region]",
            "crossref": [
                {
                    "id": "36080",
                    "database": "ChEBI",
                    "url": ""
                }
            ]
        },
        {
            "participant_id": "R-HSA-375064",
            "participant_name": "MMP1(100-469) [extracellular region]",
            "crossref": [
                {
                    "id": "2CLT",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1CGL",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "MMP1_HUMAN",
                    "database": "ZINC - World Drugs",
                    "url": ""
                },
                {
                    "id": "HMDBP02457",
                    "database": "HMDB Protein",
                    "url": ""
                },
                {
                    "id": "MMP1_HUMAN",
                    "database": "ZINC - Investigational",
                    "url": ""
                },
                {
                    "id": "MMP1_HUMAN",
                    "database": "ZINC - Substances",
                    "url": ""
                },
                {
                    "id": "P03956",
                    "database": "GeneCards",
                    "url": ""
                },
                {
                    "id": "P03956",
                    "database": "ZINC target",
                    "url": ""
                },
                {
                    "id": "966C",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "MMP1_HUMAN",
                    "database": "ZINC - Predictions - Purchasable",
                    "url": ""
                },
                {
                    "id": "MMP1_HUMAN",
                    "database": "ZINC - Metabolites",
                    "url": ""
                },
                {
                    "id": "ENSP00000322788",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "4AUO",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2J0T",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1HFC",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "P03956",
                    "database": "Pharos - Targets",
                    "url": ""
                },
                {
                    "id": "ENSG00000196611",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "2AYK",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "P03956",
                    "database": "UniProt",
                    "url": ""
                },
                {
                    "id": "1CGE",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "3AYK",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "NP_002412.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "21204",
                    "database": "Orphanet",
                    "url": ""
                },
                {
                    "id": "1SU3",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "MMP1_HUMAN",
                    "database": "ZINC - FDA approved",
                    "url": ""
                },
                {
                    "id": "ENST00000315274",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSG00000196611",
                    "database": "OpenTargets",
                    "url": ""
                },
                {
                    "id": "P03956",
                    "database": "PRO",
                    "url": ""
                },
                {
                    "id": "MMP1_HUMAN",
                    "database": "ZINC - Biogenic",
                    "url": ""
                },
                {
                    "id": "4AYK",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1CGF",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1AYK",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "3SHI",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1628",
                    "database": "Guide to Pharmacology - Targets",
                    "url": ""
                },
                {
                    "id": "ENSG00000196611-MMP1",
                    "database": "HPA",
                    "url": ""
                },
                {
                    "id": "2TCL",
                    "database": "PDB",
                    "url": ""
                }
            ]
        }
    ],
    "reaction_enzymes": [
        {
            "uniprot_ac": "O60882",
            "gene_name": "MMP20",
            "activity": [
                {
                    "ec_number": "3.4.24.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O60882",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O60882"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P00747",
            "gene_name": "PLG",
            "activity": [
                {
                    "ec_number": "3.4.21.7",
                    "activity": "Preferential cleavage: Lys-|-Xaa > Arg-|-Xaa, higher selectivity than trypsin. Converts fibrin into soluble products.",
                    "evidence": [
                        {
                            "id": "P00747",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00747"
                        }
                    ]
                },
                {
                    "ec_number": "3.4.21.7",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P00747",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00747"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P03956",
            "gene_name": "MMP1",
            "activity": [
                {
                    "ec_number": "3.4.24.7",
                    "activity": "Cleavage of the triple helix of collagen at about three-quarters of the length of the molecule from the N-terminus, at 775-Gly-|-Ile-776 in the alpha1(I) chain. Cleaves synthetic substrates and alpha-macroglobulins at bonds where P1' is a hydrophobic residue.",
                    "evidence": [
                        {
                            "id": "P03956",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P03956"
                        }
                    ]
                },
                {
                    "ec_number": "3.4.24.7",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P03956",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P03956"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P07477",
            "gene_name": "PRSS1",
            "activity": [
                {
                    "ec_number": "3.4.21.4",
                    "activity": "Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa.",
                    "evidence": [
                        {
                            "id": "P07477",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07477"
                        }
                    ]
                },
                {
                    "ec_number": "3.4.21.4",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P07477",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07477"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P08246",
            "gene_name": "ELANE",
            "activity": [
                {
                    "ec_number": "3.4.21.37",
                    "activity": "Hydrolysis of proteins, including elastin. Preferential cleavage: Val-|-Xaa > Ala-|-Xaa.",
                    "evidence": [
                        {
                            "id": "P08246",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08246"
                        }
                    ]
                },
                {
                    "ec_number": "3.4.21.37",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P08246",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08246"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P08253",
            "gene_name": "MMP2",
            "activity": [
                {
                    "ec_number": "3.4.24.24",
                    "activity": "Cleavage of gelatin type I and collagen types IV, V, VII, X. Cleaves the collagen-like sequence Pro-Gln-Gly-|-Ile-Ala-Gly-Gln.",
                    "evidence": [
                        {
                            "id": "P08253",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08253"
                        }
                    ]
                },
                {
                    "ec_number": "3.4.24.24",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P08253",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08253"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P08254",
            "gene_name": "MMP3",
            "activity": [
                {
                    "ec_number": "3.4.24.17",
                    "activity": "Preferential cleavage where P1', P2' and P3' are hydrophobic residues.",
                    "evidence": [
                        {
                            "id": "P08254",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08254"
                        }
                    ]
                },
                {
                    "ec_number": "3.4.24.17",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P08254",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08254"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P09237",
            "gene_name": "MMP7",
            "activity": [
                {
                    "ec_number": "3.4.24.23",
                    "activity": "Cleavage of 14-Ala-|-Leu-15 and 16-Tyr-|-Leu-17 in B chain of insulin. No action on collagen types I, II, IV, V. Cleaves gelatin chain alpha2(I) > alpha1(I).",
                    "evidence": [
                        {
                            "id": "P09237",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09237"
                        }
                    ]
                },
                {
                    "ec_number": "3.4.24.23",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P09237",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09237"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P09238",
            "gene_name": "MMP10",
            "activity": [
                {
                    "ec_number": "3.4.24.22",
                    "activity": "Similar to stromelysin 1, but action on collagen types III, IV and V is weak.",
                    "evidence": [
                        {
                            "id": "P09238",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09238"
                        }
                    ]
                },
                {
                    "ec_number": "3.4.24.22",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P09238",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09238"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P14780",
            "gene_name": "MMP9",
            "activity": [
                {
                    "ec_number": "3.4.24.35",
                    "activity": "Cleavage of gelatin types I and V and collagen types IV and V.",
                    "evidence": [
                        {
                            "id": "P14780",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14780"
                        }
                    ]
                },
                {
                    "ec_number": "3.4.24.35",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P14780",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14780"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P17538",
            "gene_name": "CTRB1",
            "activity": [
                {
                    "ec_number": "3.4.21.1",
                    "activity": "Preferential cleavage: Tyr-|-Xaa, Trp-|-Xaa, Phe-|-Xaa, Leu-|-Xaa.",
                    "evidence": [
                        {
                            "id": "P17538",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P17538"
                        }
                    ]
                },
                {
                    "ec_number": "3.4.21.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P17538",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P17538"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P22894",
            "gene_name": "MMP8",
            "activity": [
                {
                    "ec_number": "3.4.24.34",
                    "activity": "Cleavage of interstitial collagens in the triple helical domain. Unlike EC 3.4.24.7, this enzyme cleaves type III collagen more slowly than type I.",
                    "evidence": [
                        {
                            "id": "P22894",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22894"
                        }
                    ]
                },
                {
                    "ec_number": "3.4.24.34",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P22894",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22894"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P24347",
            "gene_name": "MMP11",
            "activity": [
                {
                    "ec_number": "3.4.24.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P24347",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P24347"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P39900",
            "gene_name": "MMP12",
            "activity": [
                {
                    "ec_number": "3.4.24.65",
                    "activity": "Hydrolysis of soluble and insoluble elastin. Specific cleavages are also produced at 14-Ala-|-Leu-15 and 16-Tyr-|-Leu-17 in the B chain of insulin.",
                    "evidence": [
                        {
                            "id": "P39900",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P39900"
                        }
                    ]
                },
                {
                    "ec_number": "3.4.24.65",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P39900",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P39900"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P45452",
            "gene_name": "MMP13",
            "activity": [
                {
                    "ec_number": "3.4.24.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P45452",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P45452"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q6GPI1",
            "gene_name": "CTRB2",
            "activity": [
                {
                    "ec_number": "3.4.21.1",
                    "activity": "Preferential cleavage: Tyr-|-Xaa, Trp-|-Xaa, Phe-|-Xaa, Leu-|-Xaa.",
                    "evidence": [
                        {
                            "id": "Q6GPI1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6GPI1"
                        }
                    ]
                },
                {
                    "ec_number": "3.4.21.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q6GPI1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6GPI1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q99542",
            "gene_name": "MMP19",
            "activity": [
                {
                    "ec_number": "3.4.24.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q99542",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q99542"
                        }
                    ]
                }
            ]
        }
    ],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        },
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        },
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "sequence_features": {
        "n_linked_sites": [],
        "o_linked_sites": [],
        "snv_sites": [
            192
        ],
        "glycation_sites": [],
        "phosphorylation_sites": [],
        "sequon_annotation_sites": [
            {
                "start_pos": 119,
                "end_pos": 121
            }
        ]
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "subjects_tested",
                "subjects_positive",
                "frequency",
                "sequence_org",
                "sequence_mut",
                "comment",
                "chr_id",
                "chr_pos",
                "ref_nt",
                "alt_nt",
                "minor_allelic_frequency",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "subjects_tested",
                "subjects_positive",
                "frequency",
                "sequence_org",
                "sequence_mut",
                "comment",
                "chr_id",
                "chr_pos",
                "ref_nt",
                "alt_nt",
                "minor_allelic_frequency",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 130
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}