{ "uniprot_canonical_ac": "P09211-1", "uniprot_ac": "P09211", "uniprot_id": "GSTP1_HUMAN", "mass": { "chemical_mass": 23356.0, "monoisotopic_mass": 23356.0 }, "refseq": { "ac": "NP_000843", "name": "glutathione S-transferase P", "summary": "Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. This GST family member is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000843" }, "gene_names": [ { "name": "GSTP1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P09211", "id": "P09211" }, { "name": "DFN7; FAEES3; GST3; GSTP; HEL-S-22; PI", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000843", "id": "NP_000843" }, { "name": "FAEES3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P09211", "id": "P09211" }, { "name": "GST3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P09211", "id": "P09211" }, { "name": "GSTP1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000843", "id": "NP_000843" } ], "protein_names": [ { "name": "Glutathione S-transferase P", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P09211" }, { "name": "2.5.1.18", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P09211" }, { "name": "GST class-pi", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P09211" }, { "name": "GSTP1-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P09211" }, { "name": "fatty acid ethyl ester synthase III; deafness, X-linked 7; GSTP1-1; GST class-pi; epididymis secretory protein Li 22", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000843", "id": "NP_000843" }, { "name": "glutathione S-transferase P", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000843", "id": "NP_000843" } ], "function": [ { "annotation": "ABERRANT METHYLATION OF CANCER-RELATED GENES IN VIETNAMESE BREAST CANCER PATIENTS: ASSOCIATIONS WITH CLINICOPATHOLOGICAL FEATURES. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000843", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000843" }, { "database": "PubMed", "id": "37824772", "url": "https://glygen.org/publication/PubMed/37824772" } ] }, { "annotation": "Absence of GSTT1 and polymorphisms in GSTP1 and TP53 are associated with the incidence of acne vulgaris.", "evidence": [ { "database": "RefSeq", "id": "NP_000843", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000843" }, { "database": "PubMed", "id": "37113088", "url": "https://glygen.org/publication/PubMed/37113088" } ] }, { "annotation": "Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2) (PubMed:9084911). Participates in the formation of novel hepoxilin regioisomers (PubMed:21046276). Negatively regulates CDK5 activity via p25/p35 translocation to prevent neurodegeneration.", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211#function" }, { "database": "PubMed", "id": "21668448", "url": "https://glygen.org/publication/PubMed/21668448" }, { "database": "PubMed", "id": "9084911", "url": "https://glygen.org/publication/PubMed/9084911" }, { "database": "PubMed", "id": "21046276", "url": "https://glygen.org/publication/PubMed/21046276" } ] }, { "annotation": "Factors associated with blood mercury concentrations and their interactions with three glutathione S-transferase genes (GSTT1, GSTM1, and GSTP1): an exposure assessment study of typically developing Jamaican children. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000843", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000843" }, { "database": "PubMed", "id": "38178055", "url": "https://glygen.org/publication/PubMed/38178055" } ] }, { "annotation": "Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. This GST family member is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_000843", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000843" } ] }, { "annotation": "Progressive Spreading of DNA Methylation in the GSTP1 Promoter CpG Island across Transitions from Precursors to Invasive Prostate Cancer.", "evidence": [ { "database": "RefSeq", "id": "NP_000843", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000843" }, { "database": "PubMed", "id": "37347938", "url": "https://glygen.org/publication/PubMed/37347938" } ] }, { "annotation": "Promoter hypermethylation of RARB and GSTP1 genes in plasma cell-free DNA as breast cancer biomarkers in Peruvian women.", "evidence": [ { "database": "RefSeq", "id": "NP_000843", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000843" }, { "database": "PubMed", "id": "37548362", "url": "https://glygen.org/publication/PubMed/37548362" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "P09211", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P09211" } ], "glycoeffect": [], "start_pos": 105, "end_pos": 105, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "I", "sequence_mut": "V", "comment": "Somatic mutation passed 2 out of 6 filters: num. of cancers (3); Lit. mined (74).", "chr_id": "11", "chr_pos": "67585218", "ref_nt": "A", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "I105", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] }, { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [ { "start_pos": 8, "end_pos": 8, "sequence_org": "Y", "sequence_mut": "F", "comment": "Reduces catalytic activity about 50-fold.", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" }, { "database": "PubMed", "id": "1540159", "url": "https://glygen.org/publication/PubMed/1540159" }, { "database": "PubMed", "id": "1567427", "url": "https://glygen.org/publication/PubMed/1567427" } ] }, { "start_pos": 99, "end_pos": 99, "sequence_org": "D", "sequence_mut": "A", "comment": "Reduces affinity for glutathione. Slightly reduced catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" }, { "database": "PubMed", "id": "8433974", "url": "https://glygen.org/publication/PubMed/8433974" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "96.56", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000084207", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000084207" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "98.98", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000084207", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000084207" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "96.93", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000084207", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000084207" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "94.51", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000084207", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000084207" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.31", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000084207", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000084207" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "98.37", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000084207", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000084207" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "95.37", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000084207", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000084207" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "97.95", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000084207", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000084207" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "99.4", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000084207", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000084207" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "94.34", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000084207", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000084207" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "86.28", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000084207", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000084207" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "99.07", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000084207", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000084207" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "98.08", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000084207", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000084207" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P09211", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09211" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P09211", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09211" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P09211", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09211" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P09211", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09211" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P09211", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09211" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P09211", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09211" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P09211", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09211" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P09211", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09211" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P09211", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09211" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P09211", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09211" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P09211", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09211" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P09211", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09211" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "common_name": "Human" } ], "gene": [ { "name": "GSTP1", "url": "https://www.uniprot.org/uniprot/P09211", "locus": { "chromosome": "11", "start_pos": 8059, "end_pos": 5001, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "LRG_723", "url": "https://www.ensembl.org/id/LRG_723" } ] } } ], "crossref": [ { "id": "ENSG00000084207", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000084207", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P09211", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P09211", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "2.5.1.18", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.5.1.18&UniProtAcc=P09211", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd03076", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03076", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd03210", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03210", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL3902", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3902", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "GSTP1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=GSTP1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "4638", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4638", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "A8MX94", "url": "https://www.ebi.ac.uk/intact/interactors/id:A8MX94*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "P09211", "url": "https://www.ebi.ac.uk/intact/interactors/id:P09211*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR003082", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003082", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004045", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004045", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004046", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004046", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR010987", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010987", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036249", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036249", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036282", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036282", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040079", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040079", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:2950", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2950", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "134660", "url": "http://www.omim.org/entry/134660", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P09211", "url": "https://www.nextprot.org/entry/NX_P09211", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P09211", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09211", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "IKPKMIF", "url": "https://omabrowser.org/oma/group/IKPKMIF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5302341at2759", "url": "http://www.orthodb.org/?query=5302341at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11571", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11571", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11571:SF255", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11571:SF255", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "10GS", "url": "https://www.rcsb.org/structure/10GS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "11GS", "url": "https://www.rcsb.org/structure/11GS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "12GS", "url": "https://www.rcsb.org/structure/12GS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "13GS", "url": "https://www.rcsb.org/structure/13GS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "14GS", "url": "https://www.rcsb.org/structure/14GS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "16GS", "url": "https://www.rcsb.org/structure/16GS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "17GS", "url": "https://www.rcsb.org/structure/17GS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "18GS", "url": "https://www.rcsb.org/structure/18GS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "19GS", "url": "https://www.rcsb.org/structure/19GS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1AQV", "url": "https://www.rcsb.org/structure/1AQV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1AQW", "url": "https://www.rcsb.org/structure/1AQW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1AQX", "url": "https://www.rcsb.org/structure/1AQX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1EOG", "url": "https://www.rcsb.org/structure/1EOG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1EOH", "url": "https://www.rcsb.org/structure/1EOH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1GSS", "url": "https://www.rcsb.org/structure/1GSS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1KBN", "url": "https://www.rcsb.org/structure/1KBN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1LBK", "url": "https://www.rcsb.org/structure/1LBK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1MD3", "url": "https://www.rcsb.org/structure/1MD3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1MD4", "url": "https://www.rcsb.org/structure/1MD4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1PGT", "url": "https://www.rcsb.org/structure/1PGT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1PX6", "url": "https://www.rcsb.org/structure/1PX6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1PX7", "url": "https://www.rcsb.org/structure/1PX7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1ZGN", "url": "https://www.rcsb.org/structure/1ZGN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "20GS", "url": "https://www.rcsb.org/structure/20GS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "22GS", "url": "https://www.rcsb.org/structure/22GS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2A2R", "url": "https://www.rcsb.org/structure/2A2R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2A2S", "url": "https://www.rcsb.org/structure/2A2S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GSS", "url": "https://www.rcsb.org/structure/2GSS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2J9H", "url": "https://www.rcsb.org/structure/2J9H", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2PGT", "url": "https://www.rcsb.org/structure/2PGT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3CSH", "url": "https://www.rcsb.org/structure/3CSH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3CSI", "url": "https://www.rcsb.org/structure/3CSI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3CSJ", "url": "https://www.rcsb.org/structure/3CSJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3DD3", "url": "https://www.rcsb.org/structure/3DD3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3DGQ", "url": "https://www.rcsb.org/structure/3DGQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3GSS", "url": "https://www.rcsb.org/structure/3GSS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3GUS", "url": "https://www.rcsb.org/structure/3GUS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3HJM", "url": "https://www.rcsb.org/structure/3HJM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3HJO", "url": "https://www.rcsb.org/structure/3HJO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3HKR", "url": "https://www.rcsb.org/structure/3HKR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3IE3", "url": "https://www.rcsb.org/structure/3IE3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KM6", "url": "https://www.rcsb.org/structure/3KM6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KMN", "url": "https://www.rcsb.org/structure/3KMN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KMO", "url": "https://www.rcsb.org/structure/3KMO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3N9J", "url": "https://www.rcsb.org/structure/3N9J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3PGT", "url": "https://www.rcsb.org/structure/3PGT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4GSS", "url": "https://www.rcsb.org/structure/4GSS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4PGT", "url": "https://www.rcsb.org/structure/4PGT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5DAK", "url": "https://www.rcsb.org/structure/5DAK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5DAL", "url": "https://www.rcsb.org/structure/5DAL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5DCG", "url": "https://www.rcsb.org/structure/5DCG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5DDL", "url": "https://www.rcsb.org/structure/5DDL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5DJL", "url": "https://www.rcsb.org/structure/5DJL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5DJM", "url": "https://www.rcsb.org/structure/5DJM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5GSS", "url": "https://www.rcsb.org/structure/5GSS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5J41", "url": "https://www.rcsb.org/structure/5J41", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5JCW", "url": "https://www.rcsb.org/structure/5JCW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5L6X", "url": "https://www.rcsb.org/structure/5L6X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5X79", "url": "https://www.rcsb.org/structure/5X79", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6AP9", "url": "https://www.rcsb.org/structure/6AP9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6GSS", "url": "https://www.rcsb.org/structure/6GSS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6LLX", "url": "https://www.rcsb.org/structure/6LLX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6Y1E", "url": "https://www.rcsb.org/structure/6Y1E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7BIA", "url": "https://www.rcsb.org/structure/7BIA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7GSS", "url": "https://www.rcsb.org/structure/7GSS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XBA", "url": "https://www.rcsb.org/structure/7XBA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8GSS", "url": "https://www.rcsb.org/structure/8GSS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9GSS", "url": "https://www.rcsb.org/structure/9GSS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00043", "url": "http://pfam.xfam.org/family/PF00043", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02798", "url": "http://pfam.xfam.org/family/PF02798", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF14497", "url": "http://pfam.xfam.org/family/PF14497", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P09211", "url": "https://pharos.nih.gov/targets/P09211", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P09211", "url": "http://purl.obolibrary.org/obo/PR_P09211", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000843", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000843", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "16437", "url": "https://www.rhea-db.org/rhea/16437", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "50260", "url": "https://www.rhea-db.org/rhea/50260", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "50800", "url": "https://www.rhea-db.org/rhea/50800", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "50804", "url": "https://www.rhea-db.org/rhea/50804", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "50808", "url": "https://www.rhea-db.org/rhea/50808", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A087X243", "url": "https://www.uniprot.org/uniprot/A0A087X243", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087X243-1", "url": "https://www.uniprot.org/uniprot/A0A087X243-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087X2E9", "url": "https://www.uniprot.org/uniprot/A0A087X2E9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087X2E9-1", "url": "https://www.uniprot.org/uniprot/A0A087X2E9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8Y5E5", "url": "https://www.uniprot.org/uniprot/A0A2R8Y5E5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8Y5E5-1", "url": "https://www.uniprot.org/uniprot/A0A2R8Y5E5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A8MX94", "url": "https://www.uniprot.org/uniprot/A8MX94", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A8MX94-1", "url": "https://www.uniprot.org/uniprot/A8MX94-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P09211-1", "url": "https://www.uniprot.org/uniprot/P09211-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ", "length": 210, "header": "sp|P09211-1|GSTP1_HUMAN Isoform 1 of Glutathione S-transferase P OS=Homo sapiens OX=9606 GN=GSTP1 PE=1 SV=2 CANONICAL=P09211-1" }, "isoforms": [ { "isoform_ac": "A0A087X243-1", "url": "", "sequence": { "sequence": "EAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQVSIWPHAVPSSPPSASRWTQVSPSLTTTCWTCC", "length": 69, "header": "tr|A0A087X243-1|GSTP1_HUMAN Computationally mapped isoform of Glutathione S-transferase P OS=Homo sapiens OX=9606 GN=GSTP1 PE=1 SV=1 CANONICAL=P09211-1" }, "locus": { "chromosome": "11", "start_pos": 67586425, "end_pos": 67586104, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000495996.1", "url": "https://www.ensembl.org/id/ENST00000495996.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000484686.1", "url": "https://www.ensembl.org/id/ENSP00000484686.1" } ] } }, { "isoform_ac": "A0A087X2E9-1", "url": "", "sequence": { "sequence": "XRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGWGSQTAPWLAHPQ", "length": 79, "header": "tr|A0A087X2E9-1|GSTP1_HUMAN Computationally mapped isoform of Glutathione S-transferase P OS=Homo sapiens OX=9606 GN=GSTP1 PE=1 SV=1 CANONICAL=P09211-1" }, "locus": { "chromosome": "11", "start_pos": 67585079, "end_pos": 67584464, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000498765.5", "url": "https://www.ensembl.org/id/ENST00000498765.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000484929.1", "url": "https://www.ensembl.org/id/ENSP00000484929.1" } ] } }, { "isoform_ac": "A0A2R8Y5E5-1", "url": "", "sequence": { "sequence": "MPPYTVVYFPVRAIRAAPQVPGRRPHPVPVQYHPASPGPHPWALWEGPAGGSPGGHGE", "length": 58, "header": "tr|A0A2R8Y5E5-1|GSTP1_HUMAN Computationally mapped isoform of Glutathione S-transferase P OS=Homo sapiens OX=9606 GN=GSTP1 PE=1 SV=1 CANONICAL=P09211-1" }, "locus": { "chromosome": "11", "start_pos": 67585186, "end_pos": 67583844, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000646888.1", "url": "https://www.ensembl.org/id/ENST00000646888.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000494477.1", "url": "https://www.ensembl.org/id/ENSP00000494477.1" } ] } }, { "isoform_ac": "A8MX94-1", "url": "", "sequence": { "sequence": "MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ", "length": 174, "header": "tr|A8MX94-1|A8MX94_HUMAN Computationally mapped isoform of glutathione transferase OS=Homo sapiens OX=9606 GN=GSTP1 PE=1 SV=1 CANONICAL=P09211-1" }, "locus": { "chromosome": "11", "start_pos": 67586574, "end_pos": 67583844, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000398603.6", "url": "https://www.ensembl.org/id/ENST00000398603.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000381604.1", "url": "https://www.ensembl.org/id/ENSP00000381604.1" } ] } }, { "isoform_ac": "P09211-1", "url": "", "sequence": { "sequence": "MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ", "length": 210, "header": "sp|P09211-1|GSTP1_HUMAN Isoform 1 of Glutathione S-transferase P OS=Homo sapiens OX=9606 GN=GSTP1 PE=1 SV=2 CANONICAL=P09211-1" }, "locus": { "chromosome": "11", "start_pos": 67586574, "end_pos": 67583844, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000398606.10", "url": "https://www.ensembl.org/id/ENST00000398606.10" }, { "database": "Ensembl Peptide", "id": "ENSP00000381607.3", "url": "https://www.ensembl.org/id/ENSP00000381607.3" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P09211", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09211" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" } ] } ], "phosphorylation": [ { "start_pos": 185, "end_pos": 185, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P09211", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09211" }, { "database": "PubMed", "id": "15604283", "url": "https://glygen.org/publication/PubMed/15604283" } ], "site_lbl": "Ser185" }, { "start_pos": 199, "end_pos": 199, "kinase_uniprot_canonical_ac": "P00533-1", "kinase_gene_name": "EGFR", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P09211", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09211" }, { "database": "PubMed", "id": "19254954", "url": "https://glygen.org/publication/PubMed/19254954" } ], "site_lbl": "Tyr199" }, { "start_pos": 199, "end_pos": 199, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by EGFR", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" }, { "database": "iPTMnet", "id": "P09211", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09211" }, { "database": "PubMed", "id": "19254954", "url": "https://glygen.org/publication/PubMed/19254954" } ], "site_lbl": "Tyr199" }, { "start_pos": 43, "end_pos": 43, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P09211", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09211" }, { "database": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" } ], "site_lbl": "Ser43" }, { "start_pos": 4, "end_pos": 4, "kinase_uniprot_canonical_ac": "P00533-1", "kinase_gene_name": "EGFR", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P09211", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09211" }, { "database": "PubMed", "id": "19254954", "url": "https://glygen.org/publication/PubMed/19254954" } ], "site_lbl": "Tyr4" }, { "start_pos": 4, "end_pos": 4, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by EGFR", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" }, { "database": "iPTMnet", "id": "P09211", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09211" }, { "database": "PubMed", "id": "19254954", "url": "https://glygen.org/publication/PubMed/19254954" } ], "site_lbl": "Tyr4" }, { "start_pos": 62, "end_pos": 62, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P09211", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09211" } ], "site_lbl": "Thr62" }, { "start_pos": 8, "end_pos": 8, "kinase_uniprot_canonical_ac": "P00533-1", "kinase_gene_name": "EGFR", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P09211", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09211" }, { "database": "PubMed", "id": "19254954", "url": "https://glygen.org/publication/PubMed/19254954" } ], "site_lbl": "Tyr8" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "NADPH oxidase: an update.", "journal": "Blood", "date": "1999", "authors": "Babior BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "10029572", "url": "https://glygen.org/publication/PubMed/10029572" } ] }, { "title": "Human glutathione transferase A4-4 crystal structures and mutagenesis reveal the basis of high catalytic efficiency with toxic lipid peroxidation products.", "journal": "Journal of molecular biology", "date": "1999", "authors": "Bruns CM, Hubatsch I, Ridderstrom M, Mannervik B, Tainer JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "10329152", "url": "https://glygen.org/publication/PubMed/10329152" } ] }, { "title": "Genetic polymorphism of glutathione S-transferase P1 gene and lung cancer risk.", "journal": "Cancer causes & control : CCC", "date": "1999", "authors": "To-Figueras J, Gene M, Gomez-Catalan J, Pique E, Borrego N, Carrasco JL, Ramon J, Corbella J", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "10334644", "url": "https://glygen.org/publication/PubMed/10334644" } ] }, { "title": "Structure and function of residue 104 and water molecules in the xenobiotic substrate-binding site in human glutathione S-transferase P1-1.", "journal": "Biochemistry", "date": "1999", "authors": "Ji X, Blaszczyk J, Xiao B, O'Donnell R, Hu X, Herzog C, Singh S V, Zimniak P", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "reference": [ { "type": "PubMed", "id": "10441116", "url": "https://glygen.org/publication/PubMed/10441116" } ] }, { "title": "Characterization of human and murine PMP20 peroxisomal proteins that exhibit antioxidant activity in vitro.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Yamashita H, Avraham S, Jiang S, London R, Van Veldhoven PP, Subramani S, Rogers RA, Avraham H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "10514471", "url": "https://glygen.org/publication/PubMed/10514471" } ] }, { "title": "Cloning and characterization of AOEB166, a novel mammalian antioxidant enzyme of the peroxiredoxin family.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Knoops B, Clippe A, Bogard C, Arsalane K, Wattiez R, Hermans C, Duconseille E, Falmagne P, Bernard A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "10521424", "url": "https://glygen.org/publication/PubMed/10521424" } ] }, { "title": "An asparagine-phenylalanine substitution accounts for catalytic differences between hGSTM3-3 and other human class mu glutathione S-transferases.", "journal": "Biochemistry", "date": "1999", "authors": "Patskovsky YV, Patskovska LN, Listowsky I", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "10587441", "url": "https://glygen.org/publication/PubMed/10587441" } ] }, { "title": "Active and inhibited human catalase structures: ligand and NADPH binding and catalytic mechanism.", "journal": "Journal of molecular biology", "date": "2000", "authors": "Putnam CD, Arvai AS, Bourne Y, Tainer JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "10656833", "url": "https://glygen.org/publication/PubMed/10656833" } ] }, { "title": "Contribution of CYP2E1 and CYP3A to acetaminophen reactive metabolite formation.", "journal": "Clinical pharmacology and therapeutics", "date": "2000", "authors": "Manyike PT, Kharasch ED, Kalhorn TF, Slattery JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "10741631", "url": "https://glygen.org/publication/PubMed/10741631" } ] }, { "title": "Identification, characterization, and crystal structure of the Omega class glutathione transferases.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Board PG, Coggan M, Chelvanayagam G, Easteal S, Jermiin LS, Schulte GK, Danley DE, Hoth LR, Griffor MC, Kamath AV, Rosner MH, Chrunyk BA, Perregaux DE, Gabel CA, Geoghegan KF, Pandit J", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "10783391", "url": "https://glygen.org/publication/PubMed/10783391" } ] }, { "title": "Mitochondrial GPx1 decreases induced but not basal oxidative damage to mtDNA in T47D cells.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Legault J, Carrier C, Petrov P, Renard P, Remacle J, Mirault ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "10833429", "url": "https://glygen.org/publication/PubMed/10833429" } ] }, { "title": "The role of cellular glutathione peroxidase redox regulation in the suppression of tumor cell growth by manganese superoxide dismutase.", "journal": "Cancer research", "date": "2000", "authors": "Li S, Yan T, Yang JQ, Oberley TD, Oberley LW", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "10919671", "url": "https://glygen.org/publication/PubMed/10919671" } ] }, { "title": "The kinetics of the reduction of cytochrome c by the superoxide anion radical.", "journal": "Biochimica et biophysica acta", "date": "1976", "authors": "Koppenol WH, van Buuren KJ, Butler J, Braams R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "10982", "url": "https://glygen.org/publication/PubMed/10982" } ] }, { "title": "Mechanism of Cu,Zn-superoxide dismutase activation by the human metallochaperone hCCS.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Rae TD, Torres AS, Pufahl RA, O'Halloran TV", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "11018045", "url": "https://glygen.org/publication/PubMed/11018045" } ] }, { "title": "Association between survival after treatment for breast cancer and glutathione S-transferase P1 Ile105Val polymorphism.", "journal": "Cancer research", "date": "2000", "authors": "Sweeney C, McClure GY, Fares MY, Stone A, Coles BF, Thompson PA, Korourian S, Hutchins LF, Kadlubar FF, Ambrosone CB", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "11059750", "url": "https://glygen.org/publication/PubMed/11059750" } ] }, { "title": "No association between the I105V polymorphism of the glutathione S-transferase P1 gene (GSTP1) and prostate cancer risk: a prospective study.", "journal": "Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology", "date": "2000", "authors": "Shepard TF, Platz EA, Kantoff PW, Nelson WG, Isaacs WB, Freije D, Febbo PG, Stampfer MJ, Giovannucci E", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "11097238", "url": "https://glygen.org/publication/PubMed/11097238" } ] }, { "title": "Mitochondrial respiratory chain-dependent generation of superoxide anion and its release into the intermembrane space.", "journal": "The Biochemical journal", "date": "2001", "authors": "Han D, Williams E, Cadenas E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "11139407", "url": "https://glygen.org/publication/PubMed/11139407" } ] }, { "title": "Crystal structure of maleylacetoacetate isomerase/glutathione transferase zeta reveals the molecular basis for its remarkable catalytic promiscuity.", "journal": "Biochemistry", "date": "2001", "authors": "Polekhina G, Board PG, Blackburn AC, Parker MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "11327815", "url": "https://glygen.org/publication/PubMed/11327815" } ] }, { "title": "Subcellular distribution of superoxide dismutases (SOD) in rat liver: Cu,Zn-SOD in mitochondria.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Okado-Matsumoto A, Fridovich I", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "11507097", "url": "https://glygen.org/publication/PubMed/11507097" } ] }, { "title": "Crystal structure of human peroxiredoxin 5, a novel type of mammalian peroxiredoxin at 1.5 A resolution.", "journal": "Journal of molecular biology", "date": "2001", "authors": "Declercq JP, Evrard C, Clippe A, Stricht DV, Bernard A, Knoops B", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "11518528", "url": "https://glygen.org/publication/PubMed/11518528" } ] }, { "title": "Interindividual variability in acetaminophen glucuronidation by human liver microsomes: identification of relevant acetaminophen UDP-glucuronosyltransferase isoforms.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2001", "authors": "Court MH, Duan SX, von Moltke LL, Greenblatt DJ, Patten CJ, Miners JO, Mackenzie PI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "11714888", "url": "https://glygen.org/publication/PubMed/11714888" } ] }, { "title": "Mutant Cu, Zn superoxide dismutase that causes motoneuron degeneration is present in mitochondria in the CNS.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2002", "authors": "Higgins CM, Jung C, Ding H, Xu Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "11886899", "url": "https://glygen.org/publication/PubMed/11886899" } ] }, { "title": "The 3-D structure of microsomal glutathione transferase 1 at 6 A resolution as determined by electron crystallography of p22(1)2(1) crystals.", "journal": "Biochimica et biophysica acta", "date": "2002", "authors": "Holm PJ, Morgenstern R, Hebert H", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "11904223", "url": "https://glygen.org/publication/PubMed/11904223" } ] }, { "title": "Catalytic pathway of manganese superoxide dismutase by direct observation of superoxide.", "journal": "Methods in enzymology", "date": "2002", "authors": "Silverman DN, Nick HS", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "11912930", "url": "https://glygen.org/publication/PubMed/11912930" } ] }, { "title": "I105V polymorphism and promoter methylation of the GSTP1 gene in prostate adenocarcinoma.", "journal": "Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology", "date": "2002", "authors": "Jeronimo C, Varzim G, Henrique R, Oliveira J, Bento MJ, Silva C, Lopes C, Sidransky D", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "12010858", "url": "https://glygen.org/publication/PubMed/12010858" } ] }, { "title": "The human glutathione transferase alpha locus: genomic organization of the gene cluster and functional characterization of the genetic polymorphism in the hGSTA1 promoter.", "journal": "Pharmacogenetics", "date": "2002", "authors": "Morel F, Rauch C, Coles B, Le Ferrec E, Guillouzo A", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "12042665", "url": "https://glygen.org/publication/PubMed/12042665" } ] }, { "title": "1.3-A resolution structure of human glutathione S-transferase with S-hexyl glutathione bound reveals possible extended ligandin binding site.", "journal": "Proteins", "date": "2002", "authors": "Le Trong I, Stenkamp RE, Ibarra C, Atkins WM, Adman ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "12211029", "url": "https://glygen.org/publication/PubMed/12211029" } ] }, { "title": "Peroxynitrite reactions and formation in mitochondria.", "journal": "Free radical biology & medicine", "date": "2002", "authors": "Radi R, Cassina A, Hodara R, Quijano C, Castro L", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "12446202", "url": "https://glygen.org/publication/PubMed/12446202" } ] }, { "title": "Sequence identification and characterization of human carnosinase and a closely related non-specific dipeptidase.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Teufel M, Saudek V, Ledig JP, Bernhardt A, Boularand S, Carreau A, Cairns NJ, Carter C, Cowley DJ, Duverger D, Ganzhorn AJ, Guenet C, Heintzelmann B, Laucher V, Sauvage C, Smirnova T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "12473676", "url": "https://glygen.org/publication/PubMed/12473676" } ] }, { "title": "Genetic polymorphisms in GSTM1, -P1, -T1, and CYP2E1 and the risk of adult brain tumors.", "journal": "Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology", "date": "2003", "authors": "De Roos AJ, Rothman N, Inskip PD, Linet MS, Shapiro WR, Selker RG, Fine HA, Black PM, Pittman GS, Bell DA", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "12540498", "url": "https://glygen.org/publication/PubMed/12540498" } ] }, { "title": "Mechanism of metal activation of human hematopoietic prostaglandin D synthase.", "journal": "Nature structural biology", "date": "2003", "authors": "Inoue T, Irikura D, Okazaki N, Kinugasa S, Matsumura H, Uodome N, Yamamoto M, Kumasaka T, Miyano M, Kai Y, Urade Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "12627223", "url": "https://glygen.org/publication/PubMed/12627223" } ] }, { "title": "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.", "journal": "Nat. Biotechnol.", "date": "2003", "authors": "Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "reference": [ { "type": "PubMed", "id": "12665801", "url": "https://glygen.org/publication/PubMed/12665801" } ] }, { "title": "Overexpression of cytosolic glutathione peroxidase (GPX1) delays endothelial cell growth and increases resistance to toxic challenges.", "journal": "Biochimie", "date": "2003", "authors": "Faucher K, Rabinovitch-Chable H, Barriere G, Cook-Moreau J, Rigaud M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "12829378", "url": "https://glygen.org/publication/PubMed/12829378" } ] }, { "title": "Gene and protein characterization of the human glutathione S-transferase kappa and evidence for a peroxisomal localization.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Morel F, Rauch C, Petit E, Piton A, Theret N, Coles B, Guillouzo A", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "14742434", "url": "https://glygen.org/publication/PubMed/14742434" } ] }, { "title": "The intracellular proteolytic processing of extracellular superoxide dismutase (EC-SOD) is a two-step event.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Olsen DA, Petersen SV, Oury TD, Valnickova Z, Thogersen IB, Kristensen T, Bowler RP, Crapo JD, Enghild JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "15044467", "url": "https://glygen.org/publication/PubMed/15044467" } ] }, { "title": "Crystal structure of a dimeric oxidized form of human peroxiredoxin 5.", "journal": "Journal of molecular biology", "date": "2004", "authors": "Evrard C, Capron A, Marchand C, Clippe A, Wattiez R, Soumillion P, Knoops B, Declercq JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "15046979", "url": "https://glygen.org/publication/PubMed/15046979" } ] }, { "title": "Oxygen and the copper chaperone CCS regulate posttranslational activation of Cu,Zn superoxide dismutase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Brown NM, Torres AS, Doan PE, O'Halloran TV", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "15064408", "url": "https://glygen.org/publication/PubMed/15064408" } ] }, { "title": "Three-dimensional structure of class pi glutathione S-transferase from human placenta in complex with S-hexylglutathione at 2.8-A resolution.", "journal": "J. Mol. Biol.", "date": "1992", "authors": "Reinemer P, Dirr HW, Ladenstein R, Huber R, Lo Bello M, Federici G, Parker MW", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "reference": [ { "type": "PubMed", "id": "1522586", "url": "https://glygen.org/publication/PubMed/1522586" } ] }, { "title": "Human peroxiredoxin 5 is a peroxynitrite reductase.", "journal": "FEBS letters", "date": "2004", "authors": "Dubuisson M, Vander Stricht D, Clippe A, Etienne F, Nauser T, Kissner R, Koppenol WH, Rees JF, Knoops B", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "15280035", "url": "https://glygen.org/publication/PubMed/15280035" } ] }, { "title": "Complex III releases superoxide to both sides of the inner mitochondrial membrane.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Muller FL, Liu Y, Van Remmen H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "15317809", "url": "https://glygen.org/publication/PubMed/15317809" } ] }, { "title": "Tyrosine-7 is an essential residue for the catalytic activity of human class PI glutathione S-transferase: chemical modification and site-directed mutagenesis studies.", "journal": "Biochemical and biophysical research communications", "date": "1992", "authors": "Kong KH, Nishida M, Inoue H, Takahashi K", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "reference": [ { "type": "PubMed", "id": "1540159", "url": "https://glygen.org/publication/PubMed/1540159" } ] }, { "title": "Structure and substrate-binding mechanism of human Ap4A hydrolase.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Swarbrick JD, Buyya S, Gunawardana D, Gayler KR, McLennan AG, Gooley PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "15596429", "url": "https://glygen.org/publication/PubMed/15596429" } ] }, { "title": "The human glutathione S-transferase P1 protein is phosphorylated and its metabolic function enhanced by the Ser/Thr protein kinases, cAMP-dependent protein kinase and protein kinase C, in glioblastoma cells.", "journal": "Cancer research", "date": "2004", "authors": "Lo HW, Antoun GR, Ali-Osman F", "evidence": [ { "database": "iPTMnet", "id": "P09211", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09211" } ], "reference": [ { "type": "PubMed", "id": "15604283", "url": "https://glygen.org/publication/PubMed/15604283" } ] }, { "title": "Genetic polymorphisms of GSTs and their association with primary brain tumor incidence.", "journal": "Cancer genetics and cytogenetics", "date": "2005", "authors": "Pinarbasi H, Silig Y, Gurelik M", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "15642394", "url": "https://glygen.org/publication/PubMed/15642394" } ] }, { "title": "Tyrosine-7 in human class Pi glutathione S-transferase is important for lowering the pKa of the thiol group of glutathione in the enzyme-glutathione complex.", "journal": "Biochemical and biophysical research communications", "date": "1992", "authors": "Kong KH, Takasu K, Inoue H, Takahashi K", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "reference": [ { "type": "PubMed", "id": "1567427", "url": "https://glygen.org/publication/PubMed/1567427" } ] }, { "title": "Rapid detection of single nucleotide polymorphisms related with lung cancer susceptibility of Chinese population.", "journal": "Cancer letters", "date": "2005", "authors": "Liang G, Pu Y, Yin L", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "15896461", "url": "https://glygen.org/publication/PubMed/15896461" } ] }, { "title": "Functional analysis of Nox4 reveals unique characteristics compared to other NADPH oxidases.", "journal": "Cellular signalling", "date": "2006", "authors": "Martyn KD, Frederick LM, von Loehneysen K, Dinauer MC, Knaus UG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "15927447", "url": "https://glygen.org/publication/PubMed/15927447" } ] }, { "title": "Thioredoxin-like domain of human kappa class glutathione transferase reveals sequence homology and structure similarity to the theta class enzyme.", "journal": "Protein science : a publication of the Protein Society", "date": "2005", "authors": "Li J, Xia Z, Ding J", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "16081649", "url": "https://glygen.org/publication/PubMed/16081649" } ] }, { "title": "Structural basis of the suppressed catalytic activity of wild-type human glutathione transferase T1-1 compared to its W234R mutant.", "journal": "Journal of molecular biology", "date": "2006", "authors": "Tars K, Larsson AK, Shokeer A, Olin B, Mannervik B, Kleywegt GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "16298388", "url": "https://glygen.org/publication/PubMed/16298388" } ] }, { "title": "Direct evidence for the formation of a complex between 1-cysteine peroxiredoxin and glutathione S-transferase pi with activity changes in both enzymes.", "journal": "Biochemistry", "date": "2006", "authors": "Ralat LA, Manevich Y, Fisher AB, Colman RF", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "16401067", "url": "https://glygen.org/publication/PubMed/16401067" } ] }, { "title": "Transition state model and mechanism of nucleophilic aromatic substitution reactions catalyzed by human glutathione S-transferase M1a-1a.", "journal": "Biochemistry", "date": "2006", "authors": "Patskovsky Y, Patskovska L, Almo SC, Listowsky I", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "16548513", "url": "https://glygen.org/publication/PubMed/16548513" } ] }, { "title": "Mitochondrial metabolic states regulate nitric oxide and hydrogen peroxide diffusion to the cytosol.", "journal": "Biochimica et biophysica acta", "date": "2006", "authors": "Boveris A, Valdez LB, Zaobornyj T, Bustamante J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "16615992", "url": "https://glygen.org/publication/PubMed/16615992" } ] }, { "title": "A three-step purification of manganese superoxide dismutase from human liver on both large and small scales.", "journal": "Protein expression and purification", "date": "1991", "authors": "Matsuda Y, Suzuki K, Ookawara T, Nakata T, Seo HG, Kawata S, Tarui S, Deutsch HF, Taniguchi N", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "1668270", "url": "https://glygen.org/publication/PubMed/1668270" } ] }, { "title": "Kinetics of acetaminophen glucuronidation by UDP-glucuronosyltransferases 1A1, 1A6, 1A9 and 2B15. Potential implications in acetaminophen-induced hepatotoxicity.", "journal": "Chemical research in toxicology", "date": "2006", "authors": "Mutlib AE, Goosen TC, Bauman JN, Williams JA, Kulkarni S, Kostrubsky S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "16696573", "url": "https://glygen.org/publication/PubMed/16696573" } ] }, { "title": "Truncated mutants of human thioredoxin reductase 1 do not exhibit glutathione reductase activity.", "journal": "FEBS letters", "date": "2006", "authors": "Urig S, Lieske J, Fritz-Wolf K, Irmler A, Becker K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "16750198", "url": "https://glygen.org/publication/PubMed/16750198" } ] }, { "title": "The effects of glutaredoxin and copper activation pathways on the disulfide and stability of Cu,Zn superoxide dismutase.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Carroll MC, Outten CE, Proescher JB, Rosenfeld L, Watson WH, Whitson LJ, Hart PJ, Jensen LT, Cizewski Culotta V", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "16880213", "url": "https://glygen.org/publication/PubMed/16880213" } ] }, { "title": "Prostate cancer risk from occupational exposure to polycyclic aromatic hydrocarbons interacting with the GSTP1 Ile105Val polymorphism.", "journal": "Cancer detection and prevention", "date": "2006", "authors": "Rybicki BA, Neslund-Dudas C, Nock NL, Schultz LR, Eklund L, Rosbolt J, Bock CH, Monaghan KG", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "17067754", "url": "https://glygen.org/publication/PubMed/17067754" } ] }, { "title": "NOX5 variants are functionally active in endothelial cells.", "journal": "Free radical biology & medicine", "date": "2007", "authors": "BelAiba RS, Djordjevic T, Petry A, Diemer K, Bonello S, Banfi B, Hess J, Pogrebniak A, Bickel C, Gorlach A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "17275676", "url": "https://glygen.org/publication/PubMed/17275676" } ] }, { "title": "Ile105Val GSTP1 polymorphism and susceptibility to colorectal carcinoma in Bulgarian population.", "journal": "International journal of colorectal disease", "date": "2007", "authors": "Vlaykova T, Miteva L, Gulubova M, Stanilova S", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "17404745", "url": "https://glygen.org/publication/PubMed/17404745" } ] }, { "title": "Human peroxiredoxin 1 and 2 are not duplicate proteins: the unique presence of CYS83 in Prx1 underscores the structural and functional differences between Prx1 and Prx2.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Lee W, Choi KS, Riddell J, Ip C, Ghosh D, Park JH, Park YM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "17519234", "url": "https://glygen.org/publication/PubMed/17519234" } ] }, { "title": "Induction of hepatobiliary efflux transporters in acetaminophen-induced acute liver failure cases.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2007", "authors": "Barnes SN, Aleksunes LM, Augustine L, Scheffer GL, Goedken MJ, Jakowski AB, Pruimboom-Brees IM, Cherrington NJ, Manautou JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "17627974", "url": "https://glygen.org/publication/PubMed/17627974" } ] }, { "title": "Point mutation in the cytoplasmic domain of the neutrophil p22-phox cytochrome b subunit is associated with a nonfunctional NADPH oxidase and chronic granulomatous disease.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Dinauer MC, Pierce EA, Erickson RW, Muhlebach TJ, Messner H, Orkin SH, Seger RA, Curnutte JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "1763037", "url": "https://glygen.org/publication/PubMed/1763037" } ] }, { "title": "Role of GSTM1 (Null/Present), GSTP1 (Ile105Val) and P53 (Arg72Pro) genetic polymorphisms and the risk of breast cancer: a case control study from South India.", "journal": "Asian Pacific journal of cancer prevention : APJCP", "date": "2007", "authors": "Samson M, Swaminathan R, Rama R, Sridevi V, Nancy KN, Rajkumar T", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "17696741", "url": "https://glygen.org/publication/PubMed/17696741" } ] }, { "title": "Reconstitution of the mitochondrial PrxIII antioxidant defence pathway: general properties and factors affecting PrxIII activity and oligomeric state.", "journal": "Journal of molecular biology", "date": "2007", "authors": "Cao Z, Bhella D, Lindsay JG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "17707404", "url": "https://glygen.org/publication/PubMed/17707404" } ] }, { "title": "Kinetic characterization and identification of the acylation and glycosylation sites of recombinant human gamma-glutamyltranspeptidase.", "journal": "Biochemistry", "date": "2007", "authors": "Castonguay R, Halim D, Morin M, Furtos A, Lherbet C, Bonneil E, Thibault P, Keillor JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "17924658", "url": "https://glygen.org/publication/PubMed/17924658" } ] }, { "title": "Lack of association of NQO1 and GSTP1 polymorphisms with multiple myeloma risk.", "journal": "Leukemia research", "date": "2008", "authors": "Maggini V, Buda G, Galimberti S, Martino A, Orciuolo E, Morabito F, Bono R, Barale R, Petrini M, Rossi AM", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "18061666", "url": "https://glygen.org/publication/PubMed/18061666" } ] }, { "title": "Determination of ERCC2 Lys751Gln and GSTP1 Ile105Val gene polymorphisms in colorectal cancer patients: relationships with treatment outcome.", "journal": "Pharmacogenomics", "date": "2007", "authors": "Le Morvan V, Smith D, Laurand A, Brouste V, Bellott R, Soubeyran I, Mathoulin-Pelissier S, Robert J", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "18085999", "url": "https://glygen.org/publication/PubMed/18085999" } ] }, { "title": "SNPs of GSTM1, T1, P1, epoxide hydrolase and DNA repair enzyme XRCC1 and risk of urinary transitional cell carcinoma in southwestern Taiwan.", "journal": "Toxicology and applied pharmacology", "date": "2008", "authors": "Hsu LI, Chiu AW, Huan SK, Chen CL, Wang YH, Hsieh FI, Chou WL, Wang LH, Chen CJ", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "18199464", "url": "https://glygen.org/publication/PubMed/18199464" } ] }, { "title": "Interindividual variability in acetaminophen sulfation by human fetal liver: implications for pharmacogenetic investigations of drug-induced birth defects.", "journal": "Birth defects research. Part A, Clinical and molecular teratology", "date": "2008", "authors": "Adjei AA, Gaedigk A, Simon SD, Weinshilboum RM, Leeder JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "18232020", "url": "https://glygen.org/publication/PubMed/18232020" } ] }, { "title": "Cruciferous vegetables, the GSTP1 Ile105Val genetic polymorphism, and breast cancer risk.", "journal": "The American journal of clinical nutrition", "date": "2008", "authors": "Lee SA, Fowke JH, Lu W, Ye C, Zheng Y, Cai Q, Gu K, Gao YT, Shu XO, Zheng W", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "18326615", "url": "https://glygen.org/publication/PubMed/18326615" } ] }, { "title": "The human gamma-glutamyltransferase gene family.", "journal": "Human genetics", "date": "2008", "authors": "Heisterkamp N, Groffen J, Warburton D, Sneddon TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "18357469", "url": "https://glygen.org/publication/PubMed/18357469" } ] }, { "title": "Characterization of the complex of glutathione S-transferase pi and 1-cysteine peroxiredoxin.", "journal": "Archives of biochemistry and biophysics", "date": "2008", "authors": "Ralat LA, Misquitta SA, Manevich Y, Fisher AB, Colman RF", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "18358825", "url": "https://glygen.org/publication/PubMed/18358825" } ] }, { "title": "Glutathione S-transferase P1 Ile105Val polymorphism is associated with haematological toxicity in elderly rectal cancer patients receiving preoperative chemoradiotherapy.", "journal": "Drugs & aging", "date": "2008", "authors": "Agostini M, Pasetto LM, Pucciarelli S, Terrazzino S, Ambrosi A, Bedin C, Galdi F, Friso ML, Mescoli C, Urso E, Leon A, Lise M, Nitti D", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "18540691", "url": "https://glygen.org/publication/PubMed/18540691" } ] }, { "title": "Glutathione S-transferase P1 ILE105Val polymorphism in occupationally exposed bladder cancer cases.", "journal": "Journal of toxicology and environmental health. Part A", "date": "2008", "authors": "Kopps S, Angeli-Greaves M, Blaszkewicz M, Prager HM, Roemer HC, Lohlein D, Weistenhofer W, Bolt HM, Golka K", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "18569592", "url": "https://glygen.org/publication/PubMed/18569592" } ] }, { "title": "Relevance of glutathione S-transferase M1 and cytochrome P450 1A1 genetic polymorphisms to the development of head and neck cancers.", "journal": "Clinical chemistry and laboratory medicine", "date": "2008", "authors": "Reszka E, Czekaj P, Adamska J, Wasowicz W", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "18590468", "url": "https://glygen.org/publication/PubMed/18590468" } ] }, { "title": "Different regulation of wild-type and mutant Cu,Zn superoxide dismutase localization in mammalian mitochondria.", "journal": "Human molecular genetics", "date": "2008", "authors": "Kawamata H, Manfredi G", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "18703498", "url": "https://glygen.org/publication/PubMed/18703498" } ] }, { "title": "GSTP1 Ile105Val polymorphism correlates with progression-free survival in MCRC patients treated with or without irinotecan: a study of the Dutch Colorectal Cancer Group.", "journal": "British journal of cancer", "date": "2008", "authors": "Kweekel DM, Koopman M, Antonini NF, Van der Straaten T, Nortier JW, Gelderblom H, Punt CJ, Guchelaar HJ", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "18797455", "url": "https://glygen.org/publication/PubMed/18797455" } ] }, { "title": "Glutathione peroxidase 3 mediates the antioxidant effect of peroxisome proliferator-activated receptor gamma in human skeletal muscle cells.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Chung SS, Kim M, Youn BS, Lee NS, Park JW, Lee IK, Lee YS, Kim JB, Cho YM, Lee HK, Park KS", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "18936159", "url": "https://glygen.org/publication/PubMed/18936159" } ] }, { "title": "Regulation of the extracellular antioxidant selenoprotein plasma glutathione peroxidase (GPx-3) in mammalian cells.", "journal": "Molecular and cellular biochemistry", "date": "2009", "authors": "Ottaviano FG, Tang SS, Handy DE, Loscalzo J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "19219623", "url": "https://glygen.org/publication/PubMed/19219623" } ] }, { "title": "Polymorphisms in p53, GSTP1 and XRCC1 predict relapse and survival of gastric cancer patients treated with oxaliplatin-based adjuvant chemotherapy.", "journal": "Cancer chemotherapy and pharmacology", "date": "2009", "authors": "Huang ZH, Hua D, Du X", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "19247656", "url": "https://glygen.org/publication/PubMed/19247656" } ] }, { "title": "Tyrosine phosphorylation of the human glutathione S-transferase P1 by epidermal growth factor receptor.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Okamura T, Singh S, Buolamwini J, Haystead T, Friedman H, Bigner D, Ali-Osman F", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" }, { "database": "iPTMnet", "id": "P09211", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09211" } ], "reference": [ { "type": "PubMed", "id": "19254954", "url": "https://glygen.org/publication/PubMed/19254954" } ] }, { "title": "Role of GSTM1 (Present/Null) and GSTP1 (Ile105Val) polymorphisms in susceptibility to acute lymphoblastic leukemia among the South Indian population.", "journal": "Asian Pacific journal of cancer prevention : APJCP", "date": "2008", "authors": "Suneetha KJ, Nancy KN, Rajalekshmy KR, Sagar TG, Rajkumar T", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "19256768", "url": "https://glygen.org/publication/PubMed/19256768" } ] }, { "title": "Glutathione S-transferase pi localizes in mitochondria and protects against oxidative stress.", "journal": "Free Radic. Biol. Med.", "date": "2009", "authors": "Goto Shinji, Kawakatsu Miho, Izumi Shin-Ichi, Urata Yoshishige, Kageyama Kan, Ihara Yoshito, Koji Takehiko, Kondo Takahito", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "reference": [ { "type": "PubMed", "id": "19269317", "url": "https://glygen.org/publication/PubMed/19269317" } ] }, { "title": "CYP17, GSTP1, PON1 and GLO1 gene polymorphisms as risk factors for breast cancer: an Italian case-control study.", "journal": "BMC cancer", "date": "2009", "authors": "Antognelli C, Del Buono C, Ludovini V, Gori S, Talesa VN, Crino L, Barberini F, Rulli A", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "19379515", "url": "https://glygen.org/publication/PubMed/19379515" } ] }, { "title": "Rational design of an organometallic glutathione transferase inhibitor.", "journal": "Angew. Chem. Int. Ed.", "date": "2009", "authors": "Ang WH, Parker LJ, De Luca A, Juillerat-Jeanneret L, Morton CJ, Lo Bello M, Parker MW, Dyson PJ", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "reference": [ { "type": "PubMed", "id": "19396894", "url": "https://glygen.org/publication/PubMed/19396894" } ] }, { "title": "Human kidney gamma-glutamyl transpeptidase. Catalytic properties, subunit structure, and localization of the gamma-glutamyl binding site on the light subunit.", "journal": "The Journal of biological chemistry", "date": "1977", "authors": "Tate SS, Ross ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "19463", "url": "https://glygen.org/publication/PubMed/19463" } ] }, { "title": "Glutathione s-transferase polymorphisms in breast cancers of Thai patients.", "journal": "Asian Pacific journal of cancer prevention : APJCP", "date": "2009", "authors": "Pongtheerat T, Treetrisool M, Purisa W", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "19469640", "url": "https://glygen.org/publication/PubMed/19469640" } ] }, { "title": "Activation of Cu,Zn-superoxide dismutase in the absence of oxygen and the copper chaperone CCS.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Leitch JM, Jensen LT, Bouldin SD, Outten CE, Hart PJ, Culotta VC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "19542232", "url": "https://glygen.org/publication/PubMed/19542232" } ] }, { "title": "MRP2 and GSTP1 polymorphisms and chemotherapy response in advanced non-small cell lung cancer.", "journal": "Cancer chemotherapy and pharmacology", "date": "2010", "authors": "Sun N, Sun X, Chen B, Cheng H, Feng J, Cheng L, Lu Z", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "19568750", "url": "https://glygen.org/publication/PubMed/19568750" } ] }, { "title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "reference": [ { "type": "PubMed", "id": "19608861", "url": "https://glygen.org/publication/PubMed/19608861" } ] }, { "title": "Glutathione S-transferase P1 Ile105Val polymorphism and colorectal cancer risk: a meta-analysis and HuGE review.", "journal": "European journal of cancer (Oxford, England : 1990)", "date": "2009", "authors": "Gao Y, Pan X, Su T, Mo Z, Cao Y, Gao F", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "19643601", "url": "https://glygen.org/publication/PubMed/19643601" } ] }, { "title": "Phosphoproteomic analysis of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Brill LM, Xiong W, Lee KB, Ficarro SB, Crain A, Xu Y, Terskikh A, Snyder EY, Ding S", "evidence": [ { "database": "iPTMnet", "id": "P09211", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09211" } ], "reference": [ { "type": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" } ] }, { "title": "Structural basis for the binding of the anticancer compound 6-(7-nitro-2,1,3-benzoxadiazol-4-ylthio)hexanol to human glutathione s-transferases.", "journal": "Cancer Res.", "date": "2009", "authors": "Federici L, Lo Sterzo C, Pezzola S, Di Matteo A, Scaloni F, Federici G, Caccuri AM", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "reference": [ { "type": "PubMed", "id": "19808963", "url": "https://glygen.org/publication/PubMed/19808963" } ] }, { "title": "Isoform-selective inactivation of human arylamine N-acetyltransferases by reactive metabolites of carcinogenic arylamines.", "journal": "Chemical research in toxicology", "date": "2009", "authors": "Liu L, Wagner CR, Hanna PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "19842618", "url": "https://glygen.org/publication/PubMed/19842618" } ] }, { "title": "Pooled analysis indicates that the GSTT1 deletion, GSTM1 deletion, and GSTP1 Ile105Val polymorphisms do not modify breast cancer risk in BRCA1 and BRCA2 mutation carriers.", "journal": "Breast cancer research and treatment", "date": "2010", "authors": "Spurdle AB, Fahey P, Chen X, McGuffog L, Easton D, Peock S, Cook M, Simard J, Rebbeck TR, Antoniou AC, Chenevix-Trench G", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "19921428", "url": "https://glygen.org/publication/PubMed/19921428" } ] }, { "title": "Acatalasemia.", "journal": "Human genetics", "date": "1991", "authors": "Ogata M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "1999334", "url": "https://glygen.org/publication/PubMed/1999334" } ] }, { "title": "Irreversible inactivation of glutathione peroxidase 1 and reversible inactivation of peroxiredoxin II by H2O2 in red blood cells.", "journal": "Antioxidants & redox signaling", "date": "2010", "authors": "Cho CS, Lee S, Lee GT, Woo HA, Choi EJ, Rhee SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "20070187", "url": "https://glygen.org/publication/PubMed/20070187" } ] }, { "title": "Structural basis for featuring of steroid isomerase activity in alpha class glutathione transferases.", "journal": "Journal of molecular biology", "date": "2010", "authors": "Tars K, Olin B, Mannervik B", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "20083122", "url": "https://glygen.org/publication/PubMed/20083122" } ] }, { "title": "Substrate specificity combined with stereopromiscuity in glutathione transferase A4-4-dependent metabolism of 4-hydroxynonenal.", "journal": "Biochemistry", "date": "2010", "authors": "Balogh LM, Le Trong I, Kripps KA, Shireman LM, Stenkamp RE, Zhang W, Mannervik B, Atkins WM", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "20085333", "url": "https://glygen.org/publication/PubMed/20085333" } ] }, { "title": "Membrane transporters in drug development.", "journal": "Nature reviews. Drug discovery", "date": "2010", "authors": "Giacomini KM, Huang SM, Tweedie DJ, Benet LZ, Brouwer KL, Chu X, Dahlin A, Evers R, Fischer V, Hillgren KM, Hoffmaster KA, Ishikawa T, Keppler D, Kim RB, Lee CA, Niemi M, Polli JW, Sugiyama Y, Swaan PW, Ware JA, Wright SH, Yee SW, Zamek-Gliszczynski MJ, Zhang L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "20190787", "url": "https://glygen.org/publication/PubMed/20190787" } ] }, { "title": "Glycopeptide-specific monoclonal antibodies suggest new roles for O-GlcNAc.", "journal": "Nature chemical biology", "date": "2010", "authors": "Teo CF, Ingale S, Wolfert MA, Elsayed GA, Not LG, Chatham JC, Wells L, Boons GJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09211", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09211" } ], "reference": [ { "type": "PubMed", "id": "20305658", "url": "https://glygen.org/publication/PubMed/20305658" } ] }, { "title": "Import, maturation, and function of SOD1 and its copper chaperone CCS in the mitochondrial intermembrane space.", "journal": "Antioxidants & redox signaling", "date": "2010", "authors": "Kawamata H, Manfredi G", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "20367259", "url": "https://glygen.org/publication/PubMed/20367259" } ] }, { "title": "Glutathione S-transferase P1 Ile105Val polymorphism and breast cancer risk: a meta-analysis involving 34,658 subjects.", "journal": "Breast cancer research and treatment", "date": "2011", "authors": "Lu S, Wang Z, Cui D, Liu H, Hao X", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "20526737", "url": "https://glygen.org/publication/PubMed/20526737" } ] }, { "title": "Does cellular hydrogen peroxide diffuse or act locally?", "journal": "Antioxidants & redox signaling", "date": "2011", "authors": "Mishina NM, Tyurin-Kuzmin PA, Markvicheva KN, Vorotnikov AV, Tkachuk VA, Laketa V, Schultz C, Lukyanov S, Belousov VV", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "20690882", "url": "https://glygen.org/publication/PubMed/20690882" } ] }, { "title": "Biochemical and stability properties of recombinant human MnSOD.", "journal": "Free radical research communications", "date": "1991", "authors": "Werber MM, Greenstein LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "2071038", "url": "https://glygen.org/publication/PubMed/2071038" } ] }, { "title": "Glutathione S-transferase P1 Ile105Val polymorphism and breast cancer risk: convergence and divergence of the two recent meta-analyses.", "journal": "Breast cancer research and treatment", "date": "2010", "authors": "Economopoulos KP, Sergentanis TN", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "20809359", "url": "https://glygen.org/publication/PubMed/20809359" } ] }, { "title": "Genetic polymorphism of p53, but not GSTP1, is association with susceptibility to esophageal cancer risk - a meta-analysis.", "journal": "International journal of medical sciences", "date": "2010", "authors": "Zhao Y, Wang F, Shan S, Zhao Y, Qiu X, Li X, Jiao F, Wang J, Du Y", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "20827430", "url": "https://glygen.org/publication/PubMed/20827430" } ] }, { "title": "Association of the GSTP1 gene (Ile105Val) polymorphism with chronic myeloid leukemia.", "journal": "Asian Pacific journal of cancer prevention : APJCP", "date": "2010", "authors": "Sailaja K, Surekha D, Rao DN, Rao DR, Vishnupriya S", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "20843134", "url": "https://glygen.org/publication/PubMed/20843134" } ] }, { "title": "Glutathione S-transferase M1, T1, and P1 polymorphisms and ovarian cancer risk: a meta-analysis.", "journal": "International journal of gynecological cancer : official journal of the International Gynecological Cancer Society", "date": "2010", "authors": "Economopoulos KP, Sergentanis TN, Vlahos NF", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "20966642", "url": "https://glygen.org/publication/PubMed/20966642" } ] }, { "title": "Biosynthesis of 14,15-hepoxilins in human l1236 Hodgkin lymphoma cells and eosinophils.", "journal": "Lipids", "date": "2011-01", "authors": "Brunnstr\u00f6m Asa, Hamberg Mats, Griffiths William J, Mannervik Bengt, Claesson Hans-Erik", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "reference": [ { "type": "PubMed", "id": "21046276", "url": "https://glygen.org/publication/PubMed/21046276" } ] }, { "title": "Novel folding and stability defects cause a deficiency of human glutathione transferase omega 1.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Zhou H, Brock J, Casarotto MG, Oakley AJ, Board PG", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "21106529", "url": "https://glygen.org/publication/PubMed/21106529" } ] }, { "title": "GSTP1 Ile105Val polymorphism in astrocytomas and glioblastomas.", "journal": "Genetics and molecular research : GMR", "date": "2010", "authors": "Custodio AC, Almeida LO, Pinto GR, Santos MJ, Almeida JR, Clara CA, Rey JA, Casartelli C", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "21128213", "url": "https://glygen.org/publication/PubMed/21128213" } ] }, { "title": "Two endoplasmic reticulum PDI peroxidases increase the efficiency of the use of peroxide during disulfide bond formation.", "journal": "Journal of molecular biology", "date": "2011", "authors": "Nguyen VD, Saaranen MJ, Karala AR, Lappi AK, Wang L, Raykhel IB, Alanen HI, Salo KE, Wang CC, Ruddock LW", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "21215271", "url": "https://glygen.org/publication/PubMed/21215271" } ] }, { "title": "Model for the exceptional reactivity of peroxiredoxins 2 and 3 with hydrogen peroxide: a kinetic and computational study.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Nagy P, Karton A, Betz A, Peskin AV, Pace P, O'Reilly RJ, Hampton MB, Radom L, Winterbourn CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "21385867", "url": "https://glygen.org/publication/PubMed/21385867" } ] }, { "title": "Mitochondrial Cu,Zn-superoxide dismutase mediates pulmonary fibrosis by augmenting H2O2 generation.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "He C, Murthy S, McCormick ML, Spitz DR, Ryan AJ, Carter AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "21393238", "url": "https://glygen.org/publication/PubMed/21393238" } ] }, { "title": "Carcinogen metabolism genes, red meat and poultry intake, and colorectal cancer risk.", "journal": "International journal of cancer", "date": "2012", "authors": "Wang J, Joshi AD, Corral R, Siegmund KD, Marchand LL, Martinez ME, Haile RW, Ahnen DJ, Sandler RS, Lance P, Stern MC", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "21618522", "url": "https://glygen.org/publication/PubMed/21618522" } ] }, { "title": "UGT1A6 and UGT2B15 polymorphisms and acetaminophen conjugation in response to a randomized, controlled diet of select fruits and vegetables.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2011", "authors": "Navarro SL, Chen Y, Li L, Li SS, Chang JL, Schwarz Y, King IB, Potter JD, Bigler J, Lampe JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "21666065", "url": "https://glygen.org/publication/PubMed/21666065" } ] }, { "title": "Glutathione-S-transferase P1 is a critical regulator of Cdk5 kinase activity.", "journal": "Journal of neurochemistry", "date": "2011", "authors": "Sun KH, Chang KH, Clawson S, Ghosh S, Mirzaei H, Regnier F, Shah K", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" }, { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "21668448", "url": "https://glygen.org/publication/PubMed/21668448" } ] }, { "title": "GSTP1 I105V polymorphism and susceptibility to colorectal cancer in Kashmiri population.", "journal": "DNA and cell biology", "date": "2012", "authors": "Sameer AS, Qadri Q, Siddiqi MA", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "21711092", "url": "https://glygen.org/publication/PubMed/21711092" } ] }, { "title": "Autocatalytic cleavage of human gamma-glutamyl transpeptidase is highly dependent on N-glycosylation at asparagine 95.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "West MB, Wickham S, Quinalty LM, Pavlovicz RE, Li C, Hanigan MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "21712391", "url": "https://glygen.org/publication/PubMed/21712391" } ] }, { "title": "Combining high-energy C-trap dissociation and electron transfer dissociation for protein O-GlcNAc modification site assignment.", "journal": "Journal of proteome research", "date": "2011", "authors": "Zhao P, Viner R, Teo CF, Boons GJ, Horn D, Wells L", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09211", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09211" } ], "reference": [ { "type": "PubMed", "id": "21740066", "url": "https://glygen.org/publication/PubMed/21740066" } ] }, { "title": "Mitochondrial regulation of cell cycle and proliferation.", "journal": "Antioxidants & redox signaling", "date": "2012", "authors": "Antico Arciuch VG, Elguero ME, Poderoso JJ, Carreras MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "21967640", "url": "https://glygen.org/publication/PubMed/21967640" } ] }, { "title": "Association of a deletion of GSTT2B with an altered risk of oesophageal squamous cell carcinoma in a South African population: a case-control study.", "journal": "PloS one", "date": "2011", "authors": "Matejcic M, Li D, Prescott NJ, Lewis CM, Mathew CG, Parker MI", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "22216261", "url": "https://glygen.org/publication/PubMed/22216261" } ] }, { "title": "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features.", "journal": "Mol. Cell. Proteomics", "date": "2012", "authors": "Bienvenut WV, Sumpton D, Martinez A, Lilla S, Espagne C, Meinnel T, Giglione C", "evidence": [ { "database": "UniProtKB", "id": "A0A2R8Y5E5", "url": "https://www.uniprot.org/uniprot/A0A2R8Y5E5" } ], "reference": [ { "type": "PubMed", "id": "22223895", "url": "https://glygen.org/publication/PubMed/22223895" } ] }, { "title": "Evaluation of glutathione S-transferase P1 polymorphisms (Ile105Val and Ala114Val) in patients with small cell lung cancer.", "journal": "Genetic testing and molecular biomarkers", "date": "2012", "authors": "Vural B, Yakar F, Derin D, Saip P, Yakar A, Demirkan A, Karabulut A, Ugurel E, Cine N, Kilicaslan Z, Tuzun E, Ozbek U", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "22339038", "url": "https://glygen.org/publication/PubMed/22339038" } ] }, { "title": "Aminoacylase 1-catalysed deacetylation of bioactives epoxides mycotoxin-derived mercapturates; 3,4-epoxyprecocenes as models of cytotoxic epoxides.", "journal": "Biochimie", "date": "2012", "authors": "Stocker P, Brunel JM, de Rezende L, do Amaral AT, Morelli X, Roche P, Vidal N, Giardina T, Perrier J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "22349737", "url": "https://glygen.org/publication/PubMed/22349737" } ] }, { "title": "Impact of probe compound in MRP2 vesicular transport assays.", "journal": "European journal of pharmaceutical sciences : official journal of the European Federation for Pharmaceutical Sciences", "date": "2012", "authors": "Kidron H, Wissel G, Manevski N, Hakli M, Ketola RA, Finel M, Yliperttula M, Xhaard H, Urtti A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "22406294", "url": "https://glygen.org/publication/PubMed/22406294" } ] }, { "title": "Site of mitochondrial reactive oxygen species production in skeletal muscle of chronic obstructive pulmonary disease and its relationship with exercise oxidative stress.", "journal": "American journal of respiratory cell and molecular biology", "date": "2012", "authors": "Puente-Maestu L, Tejedor A, Lazaro A, de Miguel J, Alvarez-Sala L, Gonzalez-Aragoneses F, Simon C, Agusti A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "22493009", "url": "https://glygen.org/publication/PubMed/22493009" } ] }, { "title": "An updated pooled analysis of glutathione S-transferase genotype polymorphisms and risk of adult gliomas.", "journal": "Asian Pacific journal of cancer prevention : APJCP", "date": "2012", "authors": "Yao L, Ji G, Gu A, Zhao P, Liu N", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "22502660", "url": "https://glygen.org/publication/PubMed/22502660" } ] }, { "title": "Structural insights into the dehydroascorbate reductase activity of human omega-class glutathione transferases.", "journal": "Journal of molecular biology", "date": "2012", "authors": "Zhou H, Brock J, Liu D, Board PG, Oakley AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "22522127", "url": "https://glygen.org/publication/PubMed/22522127" } ] }, { "title": "Association of GSTP1 gene (I105V) polymorphism with acute leukaemia.", "journal": "Journal of genetics", "date": "2012", "authors": "Dunna NR, Vuree S, Kagita S, Surekha D, Digumarti R, Rajappa S, Satti V", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "22552346", "url": "https://glygen.org/publication/PubMed/22552346" } ] }, { "title": "Role of polymorphisms of GSTM1, GSTT1 and GSTP1 Ile105Val in Hodgkin and non-Hodgkin lymphoma risk: a Human Genome Epidemiology (HuGE) review.", "journal": "Leukemia & lymphoma", "date": "2013", "authors": "Bin Q, Luo J", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "22734843", "url": "https://glygen.org/publication/PubMed/22734843" } ] }, { "title": "Glutathione S-transferase P1 gene Ile105Val polymorphism might be associated with lung cancer risk in the Chinese Han population.", "journal": "Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine", "date": "2012", "authors": "Chen X, Liang L, Hu X, Chen Y", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "22797821", "url": "https://glygen.org/publication/PubMed/22797821" } ] }, { "title": "Human superoxide dismutase 1 (hSOD1) maturation through interaction with human copper chaperone for SOD1 (hCCS).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Banci L, Bertini I, Cantini F, Kozyreva T, Massagni C, Palumaa P, Rubino JT, Zovo K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "22869735", "url": "https://glygen.org/publication/PubMed/22869735" } ] }, { "title": "Mitochondrial aquaporin-8 knockdown in human hepatoma HepG2 cells causes ROS-induced mitochondrial depolarization and loss of viability.", "journal": "Toxicology and applied pharmacology", "date": "2012", "authors": "Marchissio MJ, Frances DE, Carnovale CE, Marinelli RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "22910329", "url": "https://glygen.org/publication/PubMed/22910329" } ] }, { "title": "The GSTP1 Ile105Val polymorphism is not associated with susceptibility to colorectal cancer.", "journal": "Asian Pacific journal of cancer prevention : APJCP", "date": "2012", "authors": "Khabaz MN", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "22938488", "url": "https://glygen.org/publication/PubMed/22938488" } ] }, { "title": "Polymorphisms of glutathione S-transferase Mu 1 (GSTM1), Theta 1 (GSTT1), and Pi 1 (GSTP1) genes and epithelial ovarian cancer risk.", "journal": "Disease markers", "date": "2012", "authors": "Oliveira C, Lourenco GJ, Sagarra RA, Derchain SF, Segalla JG, Lima CS", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "22960333", "url": "https://glygen.org/publication/PubMed/22960333" } ] }, { "title": "Glutathione S-transferase M1, T1, and P1 polymorphisms and risk of glioma: a meta-analysis.", "journal": "Molecular biology reports", "date": "2013", "authors": "Fan Z, Wu Y, Shen J, Zhan R", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "23079710", "url": "https://glygen.org/publication/PubMed/23079710" } ] }, { "title": "Association of GSTP1 Ile105Val polymorphism and risk of head and neck cancers: a meta-analysis of 28 case-control studies.", "journal": "PloS one", "date": "2012", "authors": "Lang J, Song X, Cheng J, Zhao S, Fan J", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "23144854", "url": "https://glygen.org/publication/PubMed/23144854" } ] }, { "title": "ZNF143 transcription factor mediates cell survival through upregulation of the GPX1 activity in the mitochondrial respiratory dysfunction.", "journal": "Cell death & disease", "date": "2012", "authors": "Lu W, Chen Z, Zhang H, Wang Y, Luo Y, Huang P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "23152058", "url": "https://glygen.org/publication/PubMed/23152058" } ] }, { "title": "The Role of Human Aldo-Keto Reductases in the Metabolic Activation and Detoxication of Polycyclic Aromatic Hydrocarbons: Interconversion of PAH Catechols and PAH o-Quinones.", "journal": "Frontiers in pharmacology", "date": "2012", "authors": "Zhang L, Jin Y, Huang M, Penning TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "23162467", "url": "https://glygen.org/publication/PubMed/23162467" } ] }, { "title": "Functional interaction of glutathione S-transferase pi and peroxiredoxin 6 in intact cells.", "journal": "The international journal of biochemistry & cell biology", "date": "2013", "authors": "Zhou S, Lien YC, Shuvaeva T, DeBolt K, Feinstein SI, Fisher AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "23164639", "url": "https://glygen.org/publication/PubMed/23164639" } ] }, { "title": "Prognostic significance of GSTP1, XRCC1 and XRCC3 polymorphisms in non-small cell lung cancer patients.", "journal": "Asian Pacific journal of cancer prevention : APJCP", "date": "2012", "authors": "Ke HG, Li J, Shen Y, You QS, Yan Y, Dong HX, Liu JH, Shen ZY", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "23167352", "url": "https://glygen.org/publication/PubMed/23167352" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" }, { "database": "iPTMnet", "id": "P09211", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09211" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Primary and secondary structural analyses of glutathione S-transferase pi from human placenta.", "journal": "Arch. Biochem. Biophys.", "date": "1990", "authors": "Ahmad H, Wilson D E, Fritz R R, Singh S V, Medh R D, Nagle G T, Awasthi Y C, Kurosky A", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "reference": [ { "type": "PubMed", "id": "2327795", "url": "https://glygen.org/publication/PubMed/2327795" } ] }, { "title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.", "journal": "Journal of proteome research", "date": "2013", "authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09211", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09211" } ], "reference": [ { "type": "PubMed", "id": "23301498", "url": "https://glygen.org/publication/PubMed/23301498" } ] }, { "title": "Protein disulfide isomerase and glutathione are alternative substrates in the one Cys catalytic cycle of glutathione peroxidase 7.", "journal": "Biochimica et biophysica acta", "date": "2013", "authors": "Bosello-Travain V, Conrad M, Cozza G, Negro A, Quartesan S, Rossetto M, Roveri A, Toppo S, Ursini F, Zaccarin M, Maiorino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "23454490", "url": "https://glygen.org/publication/PubMed/23454490" } ] }, { "title": "Mechanistic insights into the superoxide-cytochrome c reaction by lysine surface scanning.", "journal": "Journal of biological inorganic chemistry : JBIC : a publication of the Society of Biological Inorganic Chemistry", "date": "2013", "authors": "Wegerich F, Giachetti A, Allegrozzi M, Lisdat F, Turano P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "23455484", "url": "https://glygen.org/publication/PubMed/23455484" } ] }, { "title": "Glutathione S-transferase P1 Ile105Val polymorphism contributes to increased risk of gastric cancer in East Asians.", "journal": "Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine", "date": "2013", "authors": "Ma Y, Wei X, Han G, Xue M, Li G, Li Y", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "23456768", "url": "https://glygen.org/publication/PubMed/23456768" } ] }, { "title": "Quantitative assessment of the association between glutathione S-transferase P1 Ile105Val polymorphism and bladder cancer risk.", "journal": "Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine", "date": "2013", "authors": "Wang Z, Xue L, Chong T, Li H, Chen H, Wang Z", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "23483487", "url": "https://glygen.org/publication/PubMed/23483487" } ] }, { "title": "Association between the GSTP1 Ile105Val polymorphism and prostate cancer risk: a systematic review and meta-analysis.", "journal": "Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine", "date": "2013", "authors": "Yu Z, Li Z, Cai B, Wang Z, Gan W, Chen H, Li H, Zhang P, Li H", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "23494181", "url": "https://glygen.org/publication/PubMed/23494181" } ] }, { "title": "GSTP1 Ala114Val polymorphism and colorectal cancer risk: a meta-analysis.", "journal": "Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine", "date": "2013", "authors": "Li F, Xu B, Yang Z, Wu Y, Dong S, Qian J", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "23504587", "url": "https://glygen.org/publication/PubMed/23504587" } ] }, { "title": "Assessment of the XPC (A2920C), XPF (T30028C), TP53 (Arg72Pro) and GSTP1 (Ile105Val) polymorphisms in the risk of cutaneous melanoma.", "journal": "Journal of cancer research and clinical oncology", "date": "2013", "authors": "Oliveira C, Rinck-Junior JA, Lourenco GJ, Moraes AM, Lima CS", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "23568549", "url": "https://glygen.org/publication/PubMed/23568549" } ] }, { "title": "Proteome profiling of human neutrophil granule subsets, secretory vesicles, and cell membrane: correlation with transcriptome profiling of neutrophil precursors.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Rorvig S, Ostergaard O, Heegaard NH, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "23650620", "url": "https://glygen.org/publication/PubMed/23650620" } ] }, { "title": "Human GGT2 does not autocleave into a functional enzyme: A cautionary tale for interpretation of microarray data on redox signaling.", "journal": "Antioxidants & redox signaling", "date": "2013", "authors": "West MB, Wickham S, Parks EE, Sherry DM, Hanigan MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "23682772", "url": "https://glygen.org/publication/PubMed/23682772" } ] }, { "title": "Quantitative assessment of the association between GSTP1 gene Ile105Val polymorphism and susceptibility to hepatocellular carcinoma.", "journal": "Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine", "date": "2013", "authors": "Zhao Y, Wang Q, Deng X, Shi P, Wang Z", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "23765758", "url": "https://glygen.org/publication/PubMed/23765758" } ] }, { "title": "GSTP1 Ile105Val polymorphism and colorectal cancer risk: an updated analysis.", "journal": "Gene", "date": "2013", "authors": "Tan Z, Feng M, Luo Y, Sun C, Fan Z, Tan Y, Fu B, Lang J", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "23811488", "url": "https://glygen.org/publication/PubMed/23811488" } ] }, { "title": "Genetic polymorphisms in glutathione S-transferases P1 (GSTP1) Ile105Val and prostate cancer risk: a systematic review and meta-analysis.", "journal": "Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine", "date": "2013", "authors": "Cai Q, Wu T, Zhang W, Guo X, Shang Z, Jiang N, Tian J, Niu Y", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "23843029", "url": "https://glygen.org/publication/PubMed/23843029" } ] }, { "title": "Association between GSTP1 Ile105Val polymorphism and glioma risk: a systematic review and meta-analysis.", "journal": "Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine", "date": "2014", "authors": "Xie P, Liang Y, Liang G, Liu B", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "23975366", "url": "https://glygen.org/publication/PubMed/23975366" } ] }, { "title": "GSTP1 Ile105Val polymorphism and prostate cancer risk: evidence from a meta-analysis.", "journal": "PloS one", "date": "2013", "authors": "Wei B, Zhou Y, Xu Z, Ruan J, Cheng H, Zhu M, Hu Q, Jin K, Yan Z, Zhou D, Xuan F, Zhou H, Wang Z, Huang X, Wang Q", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "23977100", "url": "https://glygen.org/publication/PubMed/23977100" } ] }, { "title": "GSTP1 Ile105Val polymorphism is associated with lung cancer risk among Asian population and smokers: an updated meta-analysis.", "journal": "Molecular biology reports", "date": "2014", "authors": "Xu CH, Wang Q, Zhan P, Qian Q, Yu LK", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "24566690", "url": "https://glygen.org/publication/PubMed/24566690" } ] }, { "title": "Expression of anionic glutathione-S-transferase and P-glycoprotein genes in human tissues and tumors.", "journal": "Cancer Res.", "date": "1989", "authors": "Moscow J A, Fairchild C R, Madden M J, Ransom D T, Wieand H S, O'Brien E E, Poplack D G, Cossman J, Myers C E, Cowan K H", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "reference": [ { "type": "PubMed", "id": "2466554", "url": "https://glygen.org/publication/PubMed/2466554" } ] }, { "title": "A systemic review of glutathione S-transferase P1 Ile105Val polymorphism and colorectal cancer risk.", "journal": "Chinese journal of cancer research = Chung-kuo yen cheng yen chiu", "date": "2014", "authors": "Song QB, Wang Q, Hu WG", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "25035652", "url": "https://glygen.org/publication/PubMed/25035652" } ] }, { "title": "Natural allelic variations in glutathione peroxidase-1 affect its subcellular localization and function.", "journal": "Cancer research", "date": "2014", "authors": "Bera S, Weinberg F, Ekoue DN, Ansenberger-Fricano K, Mao M, Bonini MG, Diamond AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "25047527", "url": "https://glygen.org/publication/PubMed/25047527" } ] }, { "title": "Lack of any association of GST genetic polymorphisms with susceptibility to ovarian cancer--a meta-analysis.", "journal": "Asian Pacific journal of cancer prevention : APJCP", "date": "2014", "authors": "Han LY, Liu K, Lin XL, Zou BB, Zhao JS", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "25124586", "url": "https://glygen.org/publication/PubMed/25124586" } ] }, { "title": "Association between glutathione S-transferases P1 Ile105Val polymorphism and susceptibility to esophageal cancer: evidence from 20 case-control studies.", "journal": "Molecular biology reports", "date": "2015", "authors": "Tan X, Chen M", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "25280543", "url": "https://glygen.org/publication/PubMed/25280543" } ] }, { "title": "GSTM1, GSTT1 and GSTP1 in patients with multiple breast cancers and breast cancer in association with another type of cancer.", "journal": "Chirurgia (Bucharest, Romania : 1990)", "date": "2014", "authors": "Chirila DN, Balacescu O, Popp R, Oprea A, Constantea NA, Vesa S, Ciuce C", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "25375048", "url": "https://glygen.org/publication/PubMed/25375048" } ] }, { "title": "Association of GSTP1 Ile105Val polymorphism with risk of esophageal cancer: a meta-analysis of 21 case-control studies.", "journal": "International journal of clinical and experimental medicine", "date": "2014", "authors": "Song Y, Du Y, Zhou Q, Ma J, Yu J, Tao X, Zhang F", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "25419352", "url": "https://glygen.org/publication/PubMed/25419352" } ] }, { "title": "Structure of the human genomic glutathione S-transferase-pi gene.", "journal": "Gene", "date": "1989", "authors": "Morrow C S, Cowan K H, Goldsmith M E", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "reference": [ { "type": "PubMed", "id": "2542132", "url": "https://glygen.org/publication/PubMed/2542132" } ] }, { "title": "CAT, GPX1, MnSOD, GSTM1, GSTT1, and GSTP1 genetic polymorphisms in chronic myeloid leukemia: a case-control study.", "journal": "Oxidative medicine and cellular longevity", "date": "2014", "authors": "Banescu C, Trifa AP, Voidazan S, Moldovan VG, Macarie I, Benedek Lazar E, Dima D, Duicu C, Dobreanu M", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "25436036", "url": "https://glygen.org/publication/PubMed/25436036" } ] }, { "title": "Different gamma-glutamyl transpeptidase mRNAs are expressed in human liver and kidney.", "journal": "Biochemical and biophysical research communications", "date": "1989", "authors": "Pawlak A, Wu SJ, Bulle F, Suzuki A, Chikhi N, Ferry N, Baik JH, Siegrist S, Guellaen G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "2573352", "url": "https://glygen.org/publication/PubMed/2573352" } ] }, { "title": "Contribution of glutathione S-transferase gene polymorphisms to development of skin cancer.", "journal": "International journal of clinical and experimental medicine", "date": "2015", "authors": "Lei Z, Liu T, Li X, Xu X, Fan D", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "25785008", "url": "https://glygen.org/publication/PubMed/25785008" } ] }, { "title": "Association of GSTP1 and RRM1 Polymorphisms with the Response and Toxicity of Gemcitabine-cisplatin Combination Chemotherapy in Chinese Patients with Non-small Cell Lung Cancer.", "journal": "Asian Pacific journal of cancer prevention : APJCP", "date": "2015", "authors": "Yuan ZJ, Zhou WW, Liu W, Wu BP, Zhao J, Wu W, He Y, Yang S, Su J, Luo Y", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "26028097", "url": "https://glygen.org/publication/PubMed/26028097" } ] }, { "title": "Association of glutathione S-transferase pi (GSTP1) Ile105Val polymorphism with the risk of skin cancer: a meta-analysis.", "journal": "Archives of dermatological research", "date": "2015", "authors": "Zhou CF, Ma T, Zhou DC, Shen T, Zhu QX", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "26044055", "url": "https://glygen.org/publication/PubMed/26044055" } ] }, { "title": "PharmGKB summary: pathways of acetaminophen metabolism at the therapeutic versus toxic doses.", "journal": "Pharmacogenetics and genomics", "date": "2015", "authors": "Mazaleuskaya LL, Sangkuhl K, Thorn CF, FitzGerald GA, Altman RB, Klein TE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "26049587", "url": "https://glygen.org/publication/PubMed/26049587" } ] }, { "title": "Sulphation of acetaminophen by the human cytosolic sulfotransferases: a systematic analysis.", "journal": "Journal of biochemistry", "date": "2015", "authors": "Yamamoto A, Liu MY, Kurogi K, Sakakibara Y, Saeki Y, Suiko M, Liu MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "26067475", "url": "https://glygen.org/publication/PubMed/26067475" } ] }, { "title": "Proteomic analysis of O-GlcNAcylated proteins in invasive ductal breast carcinomas with and without lymph node metastasis.", "journal": "Amino acids", "date": "2016", "authors": "Jiang K, Gao Y, Hou W, Tian F, Ying W, Li L, Bai B, Hou G, Wang PG, Zhang L", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09211", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09211" } ], "reference": [ { "type": "PubMed", "id": "26374642", "url": "https://glygen.org/publication/PubMed/26374642" } ] }, { "title": "XPC (A2920C), XPF (T30028C), TP53 (Arg72Pro), and GSTP1 (Ile105Val) polymorphisms in prognosis of cutaneous melanoma.", "journal": "Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine", "date": "2016", "authors": "Gomez GV, de Oliveira C, Rinck-Junior JA, de Moraes AM, Lourenco GJ, Lima CS", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "26427666", "url": "https://glygen.org/publication/PubMed/26427666" } ] }, { "title": "Glutathione S-transferase P1 Genetic Polymorphisms and Breast Cancer Risk.", "journal": "Cancer research and treatment", "date": "2002", "authors": "Kim SU, Lee KM, Park SK, Yoo KY, Noh DY, Choe KJ, Ahn SH, Kang D", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "26680864", "url": "https://glygen.org/publication/PubMed/26680864" } ] }, { "title": "Role of GSTP1 Ile105Val and XRCC1 Arg194Trp, Arg280His and Arg399Gln gene polymorphisms in the clinical outcome of advanced non-small cell lung cancer.", "journal": "International journal of clinical and experimental pathology", "date": "2015", "authors": "Zhao R, Chen G", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "26823821", "url": "https://glygen.org/publication/PubMed/26823821" } ] }, { "title": "From Six Gene Polymorphisms of the Antioxidant System, Only GPX Pro198Leu and GSTP1 Ile105Val Modulate the Risk of Acute Myeloid Leukemia.", "journal": "Oxidative medicine and cellular longevity", "date": "2016", "authors": "Banescu C, Iancu M, Trifa AP, Candea M, Benedek Lazar E, Moldovan VG, Duicu C, Tripon F, Crauciuc A, Dobreanu M", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "26823947", "url": "https://glygen.org/publication/PubMed/26823947" } ] }, { "title": "Predictive value of GSTP1 Ile105Val polymorphism in clinical outcomes of chemotherapy in gastric and colorectal cancers: a systematic review and meta-analysis.", "journal": "Cancer chemotherapy and pharmacology", "date": "2016", "authors": "Shen X, Wang J, Yan X, Ren X, Wang F, Chen X, Xu Y", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "27154175", "url": "https://glygen.org/publication/PubMed/27154175" } ] }, { "title": "GSTP1 Ile105Val and XRCC1 Arg399Gln gene polymorphisms contribute to the clinical outcome of patients with advanced non-small cell lung cancer.", "journal": "Genetics and molecular research : GMR", "date": "2016", "authors": "Bu L, Zhang LB, Mao X, Wang P", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "27323109", "url": "https://glygen.org/publication/PubMed/27323109" } ] }, { "title": "Association between GSTP1 Ile105Val polymorphism and urinary system cancer risk: evidence from 51 studies.", "journal": "OncoTargets and therapy", "date": "2016", "authors": "Zhang Y, Yuan Y, Chen Y, Wang Z, Li F, Zhao Q", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "27366093", "url": "https://glygen.org/publication/PubMed/27366093" } ] }, { "title": "Association between the TP53 and CYP2E1*5B gene polymorphisms and non-small cell lung cancer.", "journal": "Arhiv za higijenu rada i toksikologiju", "date": "2016", "authors": "Ada AO, Bilgen S, Karacaoglan V, Kunak CS, Soydas E, Alpar S, Gulhan M, Iscan M", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "28033105", "url": "https://glygen.org/publication/PubMed/28033105" } ] }, { "title": "Role of polymorphisms of GSTM1, GSTT1 and GSTP1 Ile105Val in childhood acute lymphoblastic leukemia risk: an updated meta-analysis.", "journal": "Minerva pediatrica", "date": "2018", "authors": "Zhao T, Ma F, Yin F", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "28176509", "url": "https://glygen.org/publication/PubMed/28176509" } ] }, { "title": "Association between GSTM1, GSTT1, and GSTP1 polymorphisms and gastric cancer risk, and their interactions with environmental factors.", "journal": "Genetics and molecular research : GMR", "date": "2017", "authors": "Chen ZH, Xian JF, Luo LP", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "28198496", "url": "https://glygen.org/publication/PubMed/28198496" } ] }, { "title": "Through translational prospective study, the GSTP1 Ile105Val polymorphism emerges as prognostic marker in de novo large B-cell lymphoma patients.", "journal": "Blood cancer journal", "date": "2017", "authors": "Delamain MT, Miranda ECM, Lourenco GJ, de Souza CA, Lima CSP", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "28452985", "url": "https://glygen.org/publication/PubMed/28452985" } ] }, { "title": "Association of GSTM1, GSTT1 and GSTP1 Ile105Val polymorphisms with clinical response to imatinib mesylate treatment among Malaysian chronic myeloid leukaemia patients.", "journal": "Journal of genetics", "date": "2017", "authors": "Makhtar SM, Husin A, Baba AA, Ankathil R", "evidence": [ { "database": "Entrez", "id": "2950", "url": "https://www.ncbi.nlm.nih.gov/gene/2950" } ], "reference": [ { "type": "PubMed", "id": "28947711", "url": "https://glygen.org/publication/PubMed/28947711" } ] }, { "title": "Combinatorial regulation of hepatic cytoplasmic signaling and nuclear transcriptional events by the OGT/REV-ERBalpha complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2018", "authors": "Berthier A, Vinod M, Porez G, Steenackers A, Alexandre J, Yamakawa N, Gheeraert C, Ploton M, Marechal X, Dubois-Chevalier J, Hovasse A, Schaeffer-Reiss C, Cianferani S, Rolando C, Bray F, Duez H, Eeckhoute J, Lefebvre T, Staels B, Lefebvre P", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09211", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09211" } ], "reference": [ { "type": "PubMed", "id": "30397120", "url": "https://glygen.org/publication/PubMed/30397120" } ] }, { "title": "The structure of the human glutathione S-transferase pi gene.", "journal": "Biochem. J.", "date": "1988", "authors": "Cowell I G, Dixon K H, Pemble S E, Ketterer B, Taylor J B", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "reference": [ { "type": "PubMed", "id": "3196325", "url": "https://glygen.org/publication/PubMed/3196325" } ] }, { "title": "Engineering a Proximity-Directed O-GlcNAc Transferase for Selective Protein O-GlcNAcylation in Cells.", "journal": "ACS chemical biology", "date": "2020", "authors": "Ramirez DH, Aonbangkhen C, Wu HY, Naftaly JA, Tang S, O'Meara TR, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09211", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09211" } ], "reference": [ { "type": "PubMed", "id": "32119511", "url": "https://glygen.org/publication/PubMed/32119511" } ] }, { "title": "Human multidrug resistance protein 4 (MRP4) is a cellular efflux transporter for paracetamol glutathione and cysteine conjugates.", "journal": "Archives of toxicology", "date": "2020", "authors": "Koenderink JB, van den Heuvel JJMW, Bilos A, Vredenburg G, Vermeulen NPE, Russel FGM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "32472168", "url": "https://glygen.org/publication/PubMed/32472168" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09211", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09211" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "Gene expression of rat and human microsomal glutathione S-transferases.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "DeJong JL, Morgenstern R, Jornvall H, DePierre JW, Tu CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "3372534", "url": "https://glygen.org/publication/PubMed/3372534" } ] }, { "title": "Purification and characterization of unique glutathione S-transferases from human muscle.", "journal": "Arch. Biochem. Biophys.", "date": "1988", "authors": "Singh S V, Ahmad H, Kurosky A, Awasthi Y C", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "reference": [ { "type": "PubMed", "id": "3395118", "url": "https://glygen.org/publication/PubMed/3395118" } ] }, { "title": "The spontaneous and enzymatic reaction of N-acetyl-p-benzoquinonimine with glutathione: a stopped-flow kinetic study.", "journal": "Archives of biochemistry and biophysics", "date": "1988", "authors": "Coles B, Wilson I, Wardman P, Hinson JA, Nelson SD, Ketterer B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "3395122", "url": "https://glygen.org/publication/PubMed/3395122" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09211", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09211" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Glutathione peroxidase protein. Absence in selenium deficiency states and correlation with enzymatic activity.", "journal": "The Journal of clinical investigation", "date": "1986", "authors": "Takahashi K, Newburger PE, Cohen HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "3457020", "url": "https://glygen.org/publication/PubMed/3457020" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09211", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09211" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "Simultaneously Identifying and Distinguishing Glycoproteins with O-GlcNAc and O-GalNAc (the Tn Antigen) in Human Cancer Cells.", "journal": "Analytical chemistry", "date": "2022", "authors": "Xu S, Zheng J, Xiao H, Wu R", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09211", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09211" } ], "reference": [ { "type": "PubMed", "id": "35132862", "url": "https://glygen.org/publication/PubMed/35132862" } ] }, { "title": "Spatiotemporal Activation of Protein O-GlcNAcylation in Living Cells.", "journal": "Journal of the American Chemical Society", "date": "2022", "authors": "He J, Fan Z, Tian Y, Yang W, Zhou Y, Zhu Q, Zhang W, Qin W, Yi W", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09211", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09211" } ], "reference": [ { "type": "PubMed", "id": "35138101", "url": "https://glygen.org/publication/PubMed/35138101" } ] }, { "title": "High-level expression of enzymatically active human Cu/Zn superoxide dismutase in Escherichia coli.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1986", "authors": "Hartman JR, Geller T, Yavin Z, Bartfeld D, Kanner D, Aviv H, Gorecki M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "3532102", "url": "https://glygen.org/publication/PubMed/3532102" } ] }, { "title": "Purification and characterization of human plasma glutathione peroxidase: a selenoglycoprotein distinct from the known cellular enzyme.", "journal": "Archives of biochemistry and biophysics", "date": "1987", "authors": "Takahashi K, Avissar N, Whitin J, Cohen H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "3619451", "url": "https://glygen.org/publication/PubMed/3619451" } ] }, { "title": "Structure and expression of a human class pi glutathione S-transferase messenger RNA.", "journal": "Cancer Res.", "date": "1987", "authors": "Kano T, Sakai M, Muramatsu M", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "reference": [ { "type": "PubMed", "id": "3664469", "url": "https://glygen.org/publication/PubMed/3664469" } ] }, { "title": "Characterization of the major hydroperoxide-reducing activity of human plasma. Purification and properties of a selenium-dependent glutathione peroxidase.", "journal": "The Journal of biological chemistry", "date": "1987", "authors": "Maddipati KR, Marnett LJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "3693360", "url": "https://glygen.org/publication/PubMed/3693360" } ] }, { "title": "Absence of GSTT1 and polymorphisms in GSTP1 and TP53 are associated with the incidence of acne vulgaris.", "journal": "Skin research and technology : official journal of International Society for Bioengineering and the Skin (ISBS) [and] International Society for Digital Imaging of Skin (ISDIS) [and] International Society for Skin Imaging (ISSI)", "date": "2023-04", "authors": "Ullah Rehmat, Afgan Sher, Akhtar Mariyam, Asif Muhammad, Latif Muhammad, Mehmood Rashid, Naeem Muhammad, Zahra Kiran, Farooq Muhammad, Ben Said Mourad, Iqbal Furhan", "evidence": [ { "database": "RefSeq", "id": "NP_000843", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000843" } ], "reference": [ { "type": "PubMed", "id": "37113088", "url": "https://glygen.org/publication/PubMed/37113088" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "P09211", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09211" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "Progressive Spreading of DNA Methylation in the GSTP1 Promoter CpG Island across Transitions from Precursors to Invasive Prostate Cancer.", "journal": "Cancer prevention research (Philadelphia, Pa.)", "date": "2023-08-01", "authors": "Gupta Harshath, Inoue Hitoshi, Nakai Yasutomo, Nakayama Masashi, Jones Tracy, Hicks Jessica L, Kumar Balasubramanian, Gurel Meltem, Nelson William G, De Marzo Angelo M, Yegnasubramanian Srinivasan", "evidence": [ { "database": "RefSeq", "id": "NP_000843", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000843" } ], "reference": [ { "type": "PubMed", "id": "37347938", "url": "https://glygen.org/publication/PubMed/37347938" } ] }, { "title": "Promoter hypermethylation of RARB and GSTP1 genes in plasma cell-free DNA as breast cancer biomarkers in Peruvian women.", "journal": "Molecular genetics & genomic medicine", "date": "2023-12", "authors": "Danos Pierina, Giannoni-Luza Stefano, Murillo Carrasco Alexis Germ\u00e1n, Acosta Oscar, Guevara-Fujita Maria Luisa, Cotrina Concha Jos\u00e9 Manuel, Guerra Miller Henry, Pinto Oblitas Joseph, Aguilar Cartagena Alfredo, Araujo Jhajaira M, Fujita Ricardo, Buleje Sono Jos\u00e9 Luis", "evidence": [ { "database": "RefSeq", "id": "NP_000843", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000843" } ], "reference": [ { "type": "PubMed", "id": "37548362", "url": "https://glygen.org/publication/PubMed/37548362" } ] }, { "title": "Identity of the polymorphisms for esterase D and S-formylglutathione hydrolase in red blood cells.", "journal": "Human genetics", "date": "1986", "authors": "Eiberg H, Mohr J", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "3770744", "url": "https://glygen.org/publication/PubMed/3770744" } ] }, { "title": "ABERRANT METHYLATION OF CANCER-RELATED GENES IN VIETNAMESE BREAST CANCER PATIENTS: ASSOCIATIONS WITH CLINICOPATHOLOGICAL FEATURES.", "journal": "Experimental oncology", "date": "2023-10-11", "authors": "Dieu Vuong Linh, Ngoc Nguyen Quang", "evidence": [ { "database": "RefSeq", "id": "NP_000843", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000843" } ], "reference": [ { "type": "PubMed", "id": "37824772", "url": "https://glygen.org/publication/PubMed/37824772" } ] }, { "title": "Factors associated with blood mercury concentrations and their interactions with three glutathione S-transferase genes (GSTT1, GSTM1, and GSTP1): an exposure assessment study of typically developing Jamaican children.", "journal": "BMC pediatrics", "date": "2024-01-04", "authors": "Zaman Sheikh Farzana, Samms-Vaughan Maureen, Saroukhani Sepideh, Bressler Jan, Hessabi Manouchehr, Grove Megan L, Pellington Sydonnie Shakespeare, Loveland Katherine A, Rahbar Mohammad H", "evidence": [ { "database": "RefSeq", "id": "NP_000843", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000843" } ], "reference": [ { "type": "PubMed", "id": "38178055", "url": "https://glygen.org/publication/PubMed/38178055" } ] }, { "title": "Identification of three classes of cytosolic glutathione transferase common to several mammalian species: correlation between structural data and enzymatic properties.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1985", "authors": "Mannervik B, Alin P, Guthenberg C, Jensson H, Tahir MK, Warholm M, Jornvall H", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "reference": [ { "type": "PubMed", "id": "3864155", "url": "https://glygen.org/publication/PubMed/3864155" } ] }, { "title": "Structural evidence for three different types of glutathione transferase in human tissues.", "journal": "FEBS Lett.", "date": "1985", "authors": "Alin P, Mannervik B, J\u00f6rnvall H", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "reference": [ { "type": "PubMed", "id": "3979555", "url": "https://glygen.org/publication/PubMed/3979555" } ] }, { "title": "Esterase D: a new human polymorphism.", "journal": "Annals of human genetics", "date": "1973", "authors": "Hopkinson DA, Mestriner MA, Cortner J, Harris H", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "4768551", "url": "https://glygen.org/publication/PubMed/4768551" } ] }, { "title": "Superoxide dismutase. An enzymic function for erythrocuprein (hemocuprein).", "journal": "The Journal of biological chemistry", "date": "1969", "authors": "McCord JM, Fridovich I", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "5389100", "url": "https://glygen.org/publication/PubMed/5389100" } ] }, { "title": "The reaction between the superoxide anion radical and cytochrome c.", "journal": "Biochimica et biophysica acta", "date": "1975", "authors": "Butler J, Jayson GG, Swallow AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "60", "url": "https://glygen.org/publication/PubMed/60" } ] }, { "title": "Kinetics and mechanism of the reduction of ferricytochrome c by the superoxide anion.", "journal": "The Journal of biological chemistry", "date": "1982", "authors": "Butler J, Koppenol WH, Margoliash E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "6286671", "url": "https://glygen.org/publication/PubMed/6286671" } ] }, { "title": "Acetaminophen and phenol: substrates for both a thermostable and a thermolabile form of human platelet phenol sulfotransferase.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "1982", "authors": "Reiter C, Weinshilboum RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "6950087", "url": "https://glygen.org/publication/PubMed/6950087" } ] }, { "title": "Human copper-containing superoxide dismutase of high molecular weight.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1982", "authors": "Marklund SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "6961438", "url": "https://glygen.org/publication/PubMed/6961438" } ] }, { "title": "Purification of superoxide dismutases from human placenta using immunoadsorbent columns.", "journal": "Journal of pharmacobio-dynamics", "date": "1981", "authors": "Sugiura M, Adachi T, Inoue H, Ito Y, Hirano K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "7021796", "url": "https://glygen.org/publication/PubMed/7021796" } ] }, { "title": "Treatment of paracetamol (acetaminophen) poisoning with N-acetylcysteine.", "journal": "Lancet (London, England)", "date": "1977", "authors": "Prescott LF, Park J, Ballantyne A, Adriaenssens P, Proudfoot AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "70646", "url": "https://glygen.org/publication/PubMed/70646" } ] }, { "title": "Superoxide dismutase in extracellular fluids.", "journal": "Clinica chimica acta; international journal of clinical chemistry", "date": "1982", "authors": "Marklund SL, Holme E, Hellner L", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "7172448", "url": "https://glygen.org/publication/PubMed/7172448" } ] }, { "title": "Treatment of severe acetaminophen poisoning with intravenous acetylcysteine.", "journal": "Archives of internal medicine", "date": "1981", "authors": "Prescott LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "7469630", "url": "https://glygen.org/publication/PubMed/7469630" } ] }, { "title": "Human diadenosine 5',5`'-P1,P4-tetraphosphate pyrophosphohydrolase is a member of the MutT family of nucleotide pyrophosphatases.", "journal": "The Biochemical journal", "date": "1995", "authors": "Thorne NM, Hankin S, Wilkinson MC, Nunez C, Barraclough R, McLennan AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "7487923", "url": "https://glygen.org/publication/PubMed/7487923" } ] }, { "title": "Purification and properties of human erythrocyte glutathione peroxidase.", "journal": "The Journal of biological chemistry", "date": "1975", "authors": "Awasthi YC, Beutler E, Srivastava SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "807573", "url": "https://glygen.org/publication/PubMed/807573" } ] }, { "title": "Crystal structure of human class mu glutathione transferase GSTM2-2. Effects of lattice packing on conformational heterogeneity.", "journal": "Journal of molecular biology", "date": "1994", "authors": "Raghunathan S, Chandross RJ, Kretsinger RH, Allison TJ, Penington CJ, Rule GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "8182750", "url": "https://glygen.org/publication/PubMed/8182750" } ] }, { "title": "A comparison of the enzymatic and physicochemical properties of human glutathione transferase M4-4 and three other human Mu class enzymes.", "journal": "Archives of biochemistry and biophysics", "date": "1994", "authors": "Comstock KE, Widersten M, Hao XY, Henner WD, Mannervik B", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "8203914", "url": "https://glygen.org/publication/PubMed/8203914" } ] }, { "title": "Structure determination and refinement of human alpha class glutathione transferase A1-1, and a comparison with the Mu and Pi class enzymes.", "journal": "Journal of molecular biology", "date": "1993", "authors": "Sinning I, Kleywegt GJ, Cowan SW, Reinemer P, Dirr HW, Huber R, Gilliland GL, Armstrong RN, Ji X, Board PG, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "8331657", "url": "https://glygen.org/publication/PubMed/8331657" } ] }, { "title": "Heparin-affinity patterns and composition of extracellular superoxide dismutase in human plasma and tissues.", "journal": "The Biochemical journal", "date": "1993", "authors": "Sandstrom J, Karlsson K, Edlund T, Marklund SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "8379940", "url": "https://glygen.org/publication/PubMed/8379940" } ] }, { "title": "Expression, characterization, and tissue distribution of a new cellular selenium-dependent glutathione peroxidase, GSHPx-GI.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Chu FF, Doroshow JH, Esworthy RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "8428933", "url": "https://glygen.org/publication/PubMed/8428933" } ] }, { "title": "Characterization of two novel subunits of the alpha-class glutathione S-transferases of human liver.", "journal": "Biochimica et biophysica acta", "date": "1993", "authors": "Ahmad H, Singhal SS, Saxena M, Awasthi YC", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "8431482", "url": "https://glygen.org/publication/PubMed/8431482" } ] }, { "title": "Site-directed mutagenesis study on the roles of evolutionally conserved aspartic acid residues in human glutathione S-transferase P1-1.", "journal": "Protein engineering", "date": "1993", "authors": "Kong KH, Inoue H, Takahashi K", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "reference": [ { "type": "PubMed", "id": "8433974", "url": "https://glygen.org/publication/PubMed/8433974" } ] }, { "title": "Proteolytic modification of the heparin-binding affinity of extracellular superoxide dismutase.", "journal": "The Biochemical journal", "date": "1993", "authors": "Karlsson K, Edlund A, Sandstrom J, Marklund SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "8452552", "url": "https://glygen.org/publication/PubMed/8452552" } ] }, { "title": "Catalytic properties of human manganese superoxide dismutase.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Hsu JL, Hsieh Y, Tu C, O'Connor D, Nick HS, Silverman DN", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "8663465", "url": "https://glygen.org/publication/PubMed/8663465" } ] }, { "title": "Targeting of proteins to granule subsets is determined by timing and not by sorting: The specific granule protein NGAL is localized to azurophil granules when expressed in HL-60 cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Le Cabec V, Cowland JB, Calafat J, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "8692836", "url": "https://glygen.org/publication/PubMed/8692836" } ] }, { "title": "Identification and characterization of a novel human microsomal glutathione S-transferase with leukotriene C4 synthase activity and significant sequence identity to 5-lipoxygenase-activating protein and leukotriene C4 synthase.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Jakobsson PJ, Mancini JA, Ford-Hutchinson AW", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "8703034", "url": "https://glygen.org/publication/PubMed/8703034" } ] }, { "title": "Structural organization of the human microsomal glutathione S-transferase gene (GST12).", "journal": "Genomics", "date": "1996", "authors": "Kelner MJ, Stokely MN, Stovall NE, Montoya MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "8812420", "url": "https://glygen.org/publication/PubMed/8812420" } ] }, { "title": "Immunohistochemical detection of gamma-glutamyl transpeptidase in normal human tissue.", "journal": "The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society", "date": "1996", "authors": "Hanigan MH, Frierson HF Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "8813074", "url": "https://glygen.org/publication/PubMed/8813074" } ] }, { "title": "The three-dimensional structure of the human Pi class glutathione transferase P1-1 in complex with the inhibitor ethacrynic acid and its glutathione conjugate.", "journal": "Biochemistry", "date": "1997", "authors": "Oakley AJ, Rossjohn J, Lo Bello M, Caccuri AM, Federici G, Parker MW", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "reference": [ { "type": "PubMed", "id": "9012673", "url": "https://glygen.org/publication/PubMed/9012673" } ] }, { "title": "Influence of polymorphic N-acetyltransferase phenotype on the inhibition and induction of acetaminophen bioactivation with long-term isoniazid.", "journal": "Clinical pharmacology and therapeutics", "date": "1997", "authors": "Chien JY, Peter RM, Nolan CM, Wartell C, Slattery JT, Nelson SD, Carithers RL Jr, Thummel KE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "9024171", "url": "https://glygen.org/publication/PubMed/9024171" } ] }, { "title": "Hydrolysis and transfer reactions catalyzed by gamma-glutamyl transpeptidase; evidence for separate substrate sites and for high affinity of L-cystine.", "journal": "Biochemical and biophysical research communications", "date": "1976", "authors": "Thompson GA, Meister A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "9080", "url": "https://glygen.org/publication/PubMed/9080" } ] }, { "title": "Stereoselective conjugation of prostaglandin A2 and prostaglandin J2 with glutathione, catalyzed by the human glutathione S-transferases A1-1, A2-2, M1a-1a, and P1-1.", "journal": "Chemical research in toxicology", "date": "1997-03", "authors": "Bogaards J J, Venekamp J C, van Bladeren P J", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "reference": [ { "type": "PubMed", "id": "9084911", "url": "https://glygen.org/publication/PubMed/9084911" } ] }, { "title": "Molecular cloning, characterization, and expression in Escherichia coli of full-length cDNAs of three human glutathione S-transferase Pi gene variants. Evidence for differential catalytic activity of the encoded proteins.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Ali-Osman F, Akande O, Antoun G, Mao JX, Buolamwini J", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "reference": [ { "type": "PubMed", "id": "9092542", "url": "https://glygen.org/publication/PubMed/9092542" } ] }, { "title": "A two-dimensional gel database of human colon carcinoma proteins.", "journal": "Electrophoresis", "date": "1997", "authors": "Ji H, Reid GE, Moritz RL, Eddes JS, Burgess AW, Simpson RJ", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "reference": [ { "type": "PubMed", "id": "9150948", "url": "https://glygen.org/publication/PubMed/9150948" } ] }, { "title": "Structure and function of the xenobiotic substrate-binding site and location of a potential non-substrate-binding site in a class pi glutathione S-transferase.", "journal": "Biochemistry", "date": "1997", "authors": "Ji X, Tordova M, O'Donnell R, Parsons JF, Hayden JB, Gilliland GL, Zimniak P", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "reference": [ { "type": "PubMed", "id": "9245401", "url": "https://glygen.org/publication/PubMed/9245401" } ] }, { "title": "Identification and characterization of a novel microsomal enzyme with glutathione-dependent transferase and peroxidase activities.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Jakobsson PJ, Mancini JA, Riendeau D, Ford-Hutchinson AW", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "9278457", "url": "https://glygen.org/publication/PubMed/9278457" } ] }, { "title": "The copper chaperone for superoxide dismutase.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Culotta VC, Klomp LW, Strain J, Casareno RL, Krems B, Gitlin JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "9295278", "url": "https://glygen.org/publication/PubMed/9295278" } ] }, { "title": "Structures of class pi glutathione S-transferase from human placenta in complex with substrate, transition-state analogue and inhibitor.", "journal": "Structure", "date": "1997", "authors": "Prade L, Huber R, Manoharan TH, Fahl WE, Reuter W", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "reference": [ { "type": "PubMed", "id": "9351803", "url": "https://glygen.org/publication/PubMed/9351803" } ] }, { "title": "High protonic potential actuates a mechanism of production of reactive oxygen species in mitochondria.", "journal": "FEBS letters", "date": "1997", "authors": "Korshunov SS, Skulachev VP, Starkov AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "9369223", "url": "https://glygen.org/publication/PubMed/9369223" } ] }, { "title": "The structures of human glutathione transferase P1-1 in complex with glutathione and various inhibitors at high resolution.", "journal": "J. Mol. Biol.", "date": "1997", "authors": "Oakley AJ, Lo Bello M, Battistoni A, Ricci G, Rossjohn J, Villar HO, Parker MW", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "reference": [ { "type": "PubMed", "id": "9398518", "url": "https://glygen.org/publication/PubMed/9398518" } ] }, { "title": "Solution structure of glutathione bound to human glutathione transferase P1-1: comparison of NMR measurements with the crystal structure.", "journal": "Biochemistry", "date": "1998", "authors": "Nicotra M, Paci M, Sette M, Oakley A J, Parker M W, Lo Bello M, Caccuri A M, Federici G, Ricci G", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "reference": [ { "type": "PubMed", "id": "9485454", "url": "https://glygen.org/publication/PubMed/9485454" } ] }, { "title": "Human theta class glutathione transferase: the crystal structure reveals a sulfate-binding pocket within a buried active site.", "journal": "Structure (London, England : 1993)", "date": "1998", "authors": "Rossjohn J, McKinstry WJ, Oakley AJ, Verger D, Flanagan J, Chelvanayagam G, Tan KL, Board PG, Parker MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "9551553", "url": "https://glygen.org/publication/PubMed/9551553" } ] }, { "title": "The majority of human glutathione peroxidase type 5 (GPX5) transcripts are incorrectly spliced: implications for the role of GPX5 in the male reproductive tract.", "journal": "The Biochemical journal", "date": "1998", "authors": "Hall L, Williams K, Perry AC, Frayne J, Jury JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "9639555", "url": "https://glygen.org/publication/PubMed/9639555" } ] }, { "title": "The copper chaperone CCS directly interacts with copper/zinc superoxide dismutase.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Casareno RL, Waggoner D, Gitlin JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "9726962", "url": "https://glygen.org/publication/PubMed/9726962" } ] }, { "title": "Purification and characterization of a novel alpha-class glutathione transferase from human liver.", "journal": "The international journal of biochemistry & cell biology", "date": "1998", "authors": "Pastore A, Lo Bello M, Aureli G, Federici G, Ricci G, Di Ilio C, Petruzzelli R", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "9839448", "url": "https://glygen.org/publication/PubMed/9839448" } ] }, { "title": "Cloning, sequencing and functional expression of a novel human thioredoxin reductase.", "journal": "FEBS letters", "date": "1999", "authors": "Gasdaska PY, Berggren MM, Berry MJ, Powis G", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "9923614", "url": "https://glygen.org/publication/PubMed/9923614" } ] } ], "pathway": [ { "id": "hsa:2950", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2950", "resource": "KEGG Pathway" }, { "id": "R-HSA-156590", "name": "Glutathione conjugation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590", "resource": "Reactome", "description": "Glutathione conjugation" }, { "id": "R-HSA-3299685", "name": "Detoxification of Reactive Oxygen Species", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685", "resource": "Reactome", "description": "Detoxification of Reactive Oxygen Species" }, { "id": "R-HSA-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-HSA-9753281", "name": "Paracetamol ADME", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281", "resource": "Reactome", "description": "Paracetamol ADME" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0G2K4Q5-1", "protein_name": "Glutathione S-transferase", "gene_name": "Gstp3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPPYTIIYFPSRGHCEVMRMLLADQGQSWKEEVVTLDVWEQGTFKASCLFGQIPKFQDGKLTLYQSNAILRHLGHSFGLYGKDQQEAALVDMVNDGLEDVFRRIAWHYLHICKEDKGQYRKELPGHLKPFETLLAQNKGGQCFIVGDQISFADYRLLDLLLNLELLFPGYLKDFPLLSAYVARLKARPKLKAFLESPEHVNRLLAACIKM", "length": 210 }, "evidence": [ { "id": "45919507", "url": "http://www.informatics.jax.org/homology/45919507", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "F6RWR5-1", "protein_name": "Glutathione S-transferase", "gene_name": "Gstp3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "VPPYTIVYFPSRGRCEVMRMLLADQGQSWKEEVVTLDVWEQGTFKASCLFGQIPKFQDGELTLYQSNTILRHLGRSFGLYGKDQQEAALVDMVNDGLEDLFRRIARQYRHILKEGKDQYQKELPGHLKPFETLLAQNRGGQSFIVGDQISFADYRLLDVLLNLELLFPGYLNDFPLFSAYVARLKSRPKLKAFLESPEHVNRPLAACIKM", "length": 210 }, "evidence": [ { "id": "45919507", "url": "http://www.informatics.jax.org/homology/45919507", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P04906-1", "protein_name": "Glutathione S-transferase P", "gene_name": "Gstp1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPPYTIVYFPVRGRCEATRMLLADQGQSWKEEVVTIDVWLQGSLKSTCLYGQLPKFEDGDLTLYQSNAILRHLGRSLGLYGKDQKEAALVDMVNDGVEDLRCKYGTLIYTNYENGKDDYVKALPGHLKPFETLLSQNQGGKAFIVGNQISFADYNLLDLLLVHQVLAPGCLDNFPLLSAYVARLSARPKIKAFLSSPDHLNRPINGNGKQ", "length": 210 }, "evidence": [ { "id": "45917561", "url": "http://www.informatics.jax.org/homology/45917561", "database": "MGI" }, { "id": "45917562", "url": "http://www.informatics.jax.org/homology/45917562", "database": "MGI" }, { "id": "P09211", "url": "https://omabrowser.org/oma/group/P09211/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P19157-1", "protein_name": "Glutathione S-transferase P 1", "gene_name": "Gstp1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPPYTIVYFPVRGRCEAMRMLLADQGQSWKEEVVTIDTWMQGLLKPTCLYGQLPKFEDGDLTLYQSNAILRHLGRSLGLYGKNQREAAQMDMVNDGVEDLRGKYVTLIYTNYENGKNDYVKALPGHLKPFETLLSQNQGGKAFIVGDQISFADYNLLDLLLIHQVLAPGCLDNFPLLSAYVARLSARPKIKAFLSSPEHVNRPINGNGKQ", "length": 210 }, "evidence": [ { "id": "45917561", "url": "http://www.informatics.jax.org/homology/45917561", "database": "MGI" }, { "id": "P09211", "url": "https://omabrowser.org/oma/group/P09211/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P46425-1", "protein_name": "Glutathione S-transferase P 2", "gene_name": "Gstp2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPPYTIVYFPSPGRCEAMRMLLADQGQSWKEEVVTIDTWMQGLLKPTCLYGQLPKFEDGDLTLYQSNAILRHLGRSLGLYGKNQREAAQVDMVNDGVEDLRGKYGTMIYRNYENGKNDYVKALPGHLKPFETLLSQNQGGKAFIVGDQISFADYNLLDLLLIHQVLAPGCLDNFPLLSAYVARLSARPKIKAFLSSPEHVNRPINGNGKQ", "length": 210 }, "evidence": [ { "id": "45917562", "url": "http://www.informatics.jax.org/homology/45917562", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 8, "go_terms": [ { "name": "glutathione transferase activity", "id": "GO:0004364", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004364", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "fatty acid binding", "id": "GO:0005504", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005504", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "S-nitrosoglutathione binding", "id": "GO:0035730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035730", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "dinitrosyl-iron complex binding", "id": "GO:0035731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035731", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "JUN kinase binding", "id": "GO:0008432", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008432", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "kinase regulator activity", "id": "GO:0019207", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019207", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "nitric oxide binding", "id": "GO:0070026", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070026", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "glutathione peroxidase activity", "id": "GO:0004602", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004602", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 11, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "secretory granule lumen", "id": "GO:0034774", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034774", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "ficolin-1-rich granule lumen", "id": "GO:1904813", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904813", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "vesicle", "id": "GO:0031982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031982", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "TRAF2-GSTP1 complex", "id": "GO:0097057", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097057", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 32, "go_terms": [ { "name": "positive regulation of superoxide anion generation", "id": "GO:0032930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032930", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "negative regulation of apoptotic process", "id": "GO:0043066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "negative regulation of acute inflammatory response", "id": "GO:0002674", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002674", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "negative regulation of protein kinase activity", "id": "GO:0006469", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006469", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "negative regulation of interleukin-1 beta production", "id": "GO:0032691", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032691", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "negative regulation of tumor necrosis factor production", "id": "GO:0032720", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032720", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "linoleic acid metabolic process", "id": "GO:0043651", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043651", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "central nervous system development", "id": "GO:0007417", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007417", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "cellular response to lipopolysaccharide", "id": "GO:0071222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071222", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "xenobiotic metabolic process", "id": "GO:0006805", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006805", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "negative regulation of canonical NF-kappaB signal transduction", "id": "GO:0043124", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043124", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "negative regulation of fibroblast proliferation", "id": "GO:0048147", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048147", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "negative regulation of ERK1 and ERK2 cascade", "id": "GO:0070373", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070373", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "prostaglandin metabolic process", "id": "GO:0006693", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006693", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "response to reactive oxygen species", "id": "GO:0000302", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000302", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "negative regulation of monocyte chemotactic protein-1 production", "id": "GO:0071638", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071638", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "negative regulation of extrinsic apoptotic signaling pathway", "id": "GO:2001237", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001237", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "negative regulation of tumor necrosis factor-mediated signaling pathway", "id": "GO:0010804", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010804", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "negative regulation of MAP kinase activity", "id": "GO:0043407", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043407", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "negative regulation of JUN kinase activity", "id": "GO:0043508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043508", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "glutathione derivative biosynthetic process", "id": "GO:1901687", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901687", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "regulation of ERK1 and ERK2 cascade", "id": "GO:0070372", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070372", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "negative regulation of MAPK cascade", "id": "GO:0043409", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043409", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "common myeloid progenitor cell proliferation", "id": "GO:0035726", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035726", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "negative regulation of biosynthetic process", "id": "GO:0009890", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009890", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "regulation of stress-activated MAPK cascade", "id": "GO:0032872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032872", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "nitric oxide storage", "id": "GO:0035732", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035732", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "negative regulation of nitric-oxide synthase biosynthetic process", "id": "GO:0051771", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051771", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "negative regulation of leukocyte proliferation", "id": "GO:0070664", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070664", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "hepoxilin biosynthetic process", "id": "GO:0051122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051122", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "negative regulation of stress-activated MAPK cascade", "id": "GO:0032873", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032873", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" }, { "name": "glutathione metabolic process", "id": "GO:0006749", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006749", "evidence": [ { "database": "UniProtKB", "id": "P09211", "url": "https://www.uniprot.org/uniprot/P09211" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "16437", "name": "", "equation": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P04904-1", "P46418-1", "P24473-1", "P30713-1", "Q6AXY0-1", "Q9QX69-1", "O35543-1", "Q9Z339-1", "P08009-1", "P14942-1", "Q9Z1B2-1", "Q6AXV9-1", "Q5BK56-1", "P00502-1", "P04903-1", "P04905-1", "P04906-1", "P57113-1", "Q01579-1", "P08010-1", "P08011-1", "Q4V8E6-1", "A0A0G2K4Q5-1", "F1LXL7-1", "Q9Y2Q3-1", "Q9H4Y5-1", "P46439-1", "Q03013-1", "P78417-1", "P08263-1", "P0CG30-1", "P09488-1", "Q7RTV2-1", "Q16772-1", "P28161-1", "P0CG29-1", "O60760-1", "P09211-1", "P30711-1", "P09210-1", "O15217-1", "O43813-1", "P21266-1", "P10620-1", "O43708-1", "Q99735-1", "A0A1W2PR19-1", "F6RWR5-1", "Q9JHF7-1", "E9Q6L7-1", "Q9WVL0-1", "O35660-1", "P46425-1", "P19639-1", "P48774-1", "Q9DCM2-1", "Q99L20-1", "O09131-1", "P24472-1", "P19157-1", "Q61133-1", "Q8K2Q2-1", "Q80W21-1", "O89112-1", "P10648-1", "P13745-1", "P15626-1", "P30115-1", "P10649-1", "Q64471-1", "Q9D4P7-1", "Q91VS7-1", "Q6P8Q0-1", "A2RST1-1", "Q8R5I6-1", "P17695-1", "P25373-1", "P36156-1", "P40582-1", "P48239-1", "Q04806-1", "Q12390-1", "Q54GA9-1", "Q54QV7-1", "Q54VI4-1", "Q55FF3-1", "Q86AU1-1", "Q556G3-1", "Q9VG94-1", "Q9VG96-1", "Q7JYX0-1", "P41043-1", "P20432-1", "Q9VG95-1", "Q9VG98-1", "Q9VG93-1", "Q9VHD3-1", "Q9VHD2-1" ], "evidence": [ { "id": "16437", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/16437" } ] }, { "id": "50260", "name": "", "equation": "11(S)-hydroxy-14(S),15(S)-epoxy-(5Z,8Z,12E)-eicosatrienoate + glutathione = (11S,15S)-dihydroxy-14(R)-S-glutathionyl-(5Z,8Z,12E)-eicosatrienoate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P04905-1", "P04906-1", "P08010-1", "P09488-1", "P28161-1", "P09211-1", "P19157-1", "P15626-1", "P10649-1" ], "evidence": [ { "id": "50260", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/50260" } ] }, { "id": "50800", "name": "", "equation": "glutathione + prostaglandin A2 = prostaglandin A2-S-(S)-glutathione", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P04905-1", "P04906-1", "P09488-1", "P09211-1", "P19157-1", "P10649-1" ], "evidence": [ { "id": "50800", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/50800" } ] }, { "id": "50804", "name": "", "equation": "glutathione + prostaglandin J2 = prostaglandin J2-S-(R)-glutathione", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P00502-1", "P04905-1", "P04906-1", "P08263-1", "P09488-1", "P09211-1", "P13745-1", "P19157-1", "P10649-1" ], "evidence": [ { "id": "50804", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/50804" } ] }, { "id": "50808", "name": "", "equation": "glutathione + prostaglandin J2 = prostaglandin J2-S-(S)-glutathione", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P04905-1", "P04906-1", "P09488-1", "P09211-1", "P19157-1", "P10649-1" ], "evidence": [ { "id": "50808", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/50808" } ] }, { "id": "R-HSA-176054", "name": "GST dimers conjugate GSH with cytosolic substrates", "equation": "", "summary": "The glutathione S-transferases (GSTs) catalyze the nucleophilic attack by reduced glutathione (GSH) on nonpolar compounds that contain an electrophilic carbon, nitrogen, or sulphur atom. Their substrates include halogenonitrobenzenes, arene oxides, quinones, and alpha, beta-unsaturated carbonyls. Three major families of proteins are widely distributed in nature. Two of these, the cytosolic and mitochondrial GST, comprise soluble enzymes that are only distantly related whilst the third family comprises microsomal GST, referred to as membrane-associated proteins in eicosanoid and glutathione (MAPEG) metabolism.

At least 16 cytosolic GST subunits exist in human which are all in a dimeric form. Based on amino acid sequence similarities, seven classes of cytosolic GST are recognized in mammalian species; Alpha, Mu, Pi, Sigma, Theta, Omega, and Zeta (2\u20135). As well as being homodimers, the Alpha and Mu classes are also able to form heterodimers so a large number of isozymes are possible from all cytosolic GST subunits (Sinning et al. 1993, LeTrong et al. 2002, Ahmad et al. 1993, Pastore et al. 1998, Tars et al. 2010, Bruns et al. 1999, Balogh et al. 2010, Morel et al. 2002, Li et al. 2005, Patskovsky et al. 2006, Raghunathan et al. 1994, Patskovsky et al. 1999, Comstock et al. 1994, Board et al. 2000, Zhou et al. 2011, Zhou et al. 2012, Sun et al. 2011, Tars et al. 2006, Rossjohn et al. 1998, Polekhina et al. 2001, Inoue et al. 2003). Typical electrophilic substrates are chosen as examples for which the majority of the cytosolic GST isozymes act on.", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P09210-1", "Q16772-1", "P0CG29-1", "P78417-1", "Q7RTV2-1", "O60760-1", "P46439-1", "Q9H4Y5-1", "P30711-1", "P09211-1", "O15217-1", "P08263-1", "P0CG30-1", "P21266-1", "O43708-1", "P09488-1", "P28161-1", "Q03013-1" ], "evidence": [ { "id": "R-HSA-176054", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-176054" } ] }, { "id": "R-HSA-3343700", "name": "PRDX6:GSTP1 catalyzes 2 glutathione, reduced + H2O2 => glutathione, oxidized + 2 H2O", "equation": "", "summary": "Peroxiredoxin 6 (PRDX6) forms a heterodimer with GSTP1 (Pi Glutathione transferase) and catalyzes the reduction of hydrogen peroxide (H2O2) by glutathione to yield oxidized glutathione and water (Ralat et al. 2006, Ralat et al. 2008, Zhou et al. 2013).", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P09211-1", "P30041-1" ], "evidence": [ { "id": "R-HSA-3343700", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3343700" } ] }, { "id": "R-HSA-6798748", "name": "Exocytosis of secretory granule lumen proteins", "equation": "", "summary": "Secretory vesicles provide a reservoir of secreted proteins and membrane-associated receptors that are required at the earliest stages of the neutrophil-mediated inflammatory response. They are mobilized in response to a wide variety of inflammatory stimuli (Sengelov et al. 1993a,b). Resultant cell surface changes allow the neutrophil to establish firm contact with activated vascular epithelium (Faurschou & Borregaard 2003).", "cellular_location": "extracellular region, secretory granule lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P18669-1", "Q13464-1", "P32320-1", "P09917-1", "O00487-1", "P13639-1", "P12268-1", "P62937-1", "Q96G03-1", "P68402-1", "Q99436-1", "P55072-1", "P68104-1", "P11142-1", "Q9Y315-1", "P13010-1", "P04075-1", "P09972-1", "P07900-1", "P09769-1", "P09211-1", "Q16539-1", "P14618-1", "P07741-1", "Q01432-1", "P12956-1", "Q7Z6Z7-1", "Q9UNP9-1", "P14174-1", "P04040-1", "O00571-1", "P06744-1", "P52790-1", "P11678-1", "P00491-1", "P06737-1", "P00746-1", "Q13162-1", "P17858-1", "P46976-1", "P22392-1", "P13716-1", "O75874-1", "P20839-1", "O00764-1" ], "evidence": [ { "id": "R-HSA-6798748", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798748" } ] }, { "id": "R-HSA-6800434", "name": "Exocytosis of ficolin-rich granule lumen proteins", "equation": "", "summary": "Ficoli-1 rich granules are a relatively new fourth neutrophil granule population that is enriched in the microbial lectin ficolin-1. Ficolin-1 is present in tertiary granules, but ficolin-1 rich granules can be differentiated by having low levels of gelatinases and an elevated exocytosis propensity (Rorvig et al. 2009, 2013). The importance of these granules may be to provide rapid release of pattern recognition molecules to activate the lectin complement pathway (Rorvig et al. 2009).", "cellular_location": "extracellular region, ficolin-1-rich granule lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9UBR2-1", "P18669-1", "P32320-1", "P09917-1", "O00487-1", "P13639-1", "P12268-1", "P62937-1", "P15586-1", "Q96G03-1", "Q9P0J7-1", "P68402-1", "P36871-1", "Q99436-1", "P07339-1", "P13798-1", "P53396-1", "P55072-1", "P68104-1", "P11142-1", "Q9Y315-1", "P04075-1", "P09972-1", "P07900-1", "P09211-1", "Q16539-1", "P07858-1", "P14618-1", "P28482-1", "Q01432-1", "P12956-1", "Q7Z6Z7-1", "Q9UNP9-1", "Q13510-1", "P14174-1", "P15848-1", "P16278-1", "Q8WVQ1-1", "P04040-1", "O00571-1", "P14780-1", "P06744-1", "P52790-1", "P00491-1", "P06737-1", "Q16769-1", "P08236-1", "P02794-1", "P07384-1", "Q14004-1", "P00746-1", "P98066-1", "P25774-1", "Q13162-1", "P17858-1", "P46976-1", "P09960-1", "P22392-1", "P13716-1", "O75874-1", "P20839-1" ], "evidence": [ { "id": "R-HSA-6800434", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6800434" } ] }, { "id": "R-HSA-9753280", "name": "GSTs transfer GSH to NAPQI to form APAP-SG", "equation": "", "summary": "N-acetyl-p-benzoquinone imine (NAPQI) can bind to the cysteine thiol of GSH, a critical mechanism of detoxification. The reaction of NAPQI with GSH can occur both spontaneously and enzymatically (Coles et al. 1998).", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-9753466" ], "output_participant_list": [], "enzyme_list": [ "P30711-1", "P09211-1", "P09488-1" ], "evidence": [ { "id": "R-HSA-9753280", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753280" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-9753466", "participant_name": "NAPQI [cytosol]", "crossref": [ { "id": "173517", "database": "ChEBI", "url": "" }, { "id": "173517", "database": "ChEBI", "url": "" }, { "id": "173517", "database": "ChEBI", "url": "" }, { "id": "173517", "database": "ChEBI", "url": "" }, { "id": "173517", "database": "ChEBI", "url": "" }, { "id": "173517", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2K4Q5", "gene_name": "Gstp3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "A0A0G2K4Q5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K4Q5" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A0A0G2K4Q5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K4Q5" } ] } ] }, { "uniprot_ac": "A0A1W2PR19", "gene_name": "GSTT4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "A0A1W2PR19", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1W2PR19" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A0A1W2PR19", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1W2PR19" } ] } ] }, { "uniprot_ac": "A2RST1", "gene_name": "Mgst2", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "A2RST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2RST1" } ] }, { "ec_number": "4.4.1.20", "activity": "leukotriene C4 = glutathione + leukotriene A4.", "evidence": [ { "id": "A2RST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2RST1" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "A2RST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2RST1" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A2RST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2RST1" } ] } ] }, { "uniprot_ac": "E9Q6L7", "gene_name": "Gsta5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "E9Q6L7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q6L7" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "E9Q6L7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q6L7" } ] } ] }, { "uniprot_ac": "F1LXL7", "gene_name": "AC097845.1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "F1LXL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LXL7" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "F1LXL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LXL7" } ] } ] }, { "uniprot_ac": "F6RWR5", "gene_name": "Gstp3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "F6RWR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F6RWR5" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "F6RWR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F6RWR5" } ] } ] }, { "uniprot_ac": "O00487", "gene_name": "PSMD14", "activity": [ { "ec_number": "3.4.19.-", "activity": "", "evidence": [ { "id": "O00487", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00487" } ] } ] }, { "uniprot_ac": "O00571", "gene_name": "DDX3X", "activity": [ { "ec_number": "3.6.4.13", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "O00571", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00571" } ] }, { "ec_number": "3.6.4.13", "activity": "", "evidence": [ { "id": "O00571", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00571" } ] } ] }, { "uniprot_ac": "O00764", "gene_name": "PDXK", "activity": [ { "ec_number": "2.7.1.35", "activity": "ATP + pyridoxal = ADP + H(+) + pyridoxal 5'-phosphate.", "evidence": [ { "id": "O00764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00764" } ] }, { "ec_number": "2.7.1.35", "activity": "", "evidence": [ { "id": "O00764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00764" } ] } ] }, { "uniprot_ac": "O09131", "gene_name": "Gsto1", "activity": [ { "ec_number": "1.20.4.2", "activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] }, { "ec_number": "1.20.4.2", "activity": "", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] }, { "ec_number": "1.8.5.1", "activity": "", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] } ] }, { "uniprot_ac": "O15217", "gene_name": "GSTA4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O15217", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15217" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "O15217", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15217" } ] } ] }, { "uniprot_ac": "O35543", "gene_name": "Hpgds", "activity": [ { "ec_number": "5.3.99.2", "activity": "prostaglandin H2 = prostaglandin D2.", "evidence": [ { "id": "O35543", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35543" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O35543", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35543" } ] }, { "ec_number": "5.3.99.2", "activity": "", "evidence": [ { "id": "O35543", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35543" } ] } ] }, { "uniprot_ac": "O35660", "gene_name": "Gstm6", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O35660", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35660" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "O35660", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35660" } ] } ] }, { "uniprot_ac": "O43708", "gene_name": "GSTZ1", "activity": [ { "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.", "evidence": [ { "id": "O43708", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43708" } ] }, { "ec_number": "5.2.1.2", "activity": "", "evidence": [ { "id": "O43708", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43708" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O43708", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43708" } ] } ] }, { "uniprot_ac": "O43813", "gene_name": "LANCL1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O43813", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43813" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "O43813", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43813" } ] } ] }, { "uniprot_ac": "O60760", "gene_name": "HPGDS", "activity": [ { "ec_number": "5.3.99.2", "activity": "prostaglandin H2 = prostaglandin D2.", "evidence": [ { "id": "O60760", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60760" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O60760", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60760" } ] }, { "ec_number": "5.3.99.2", "activity": "", "evidence": [ { "id": "O60760", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60760" } ] } ] }, { "uniprot_ac": "O75874", "gene_name": "IDH1", "activity": [ { "ec_number": "1.1.1.42", "activity": "D-threo-isocitrate + NADP(+) = 2-oxoglutarate + CO2 + NADPH.", "evidence": [ { "id": "O75874", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75874" } ] }, { "ec_number": "1.1.1.42", "activity": "", "evidence": [ { "id": "O75874", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75874" } ] } ] }, { "uniprot_ac": "O89112", "gene_name": "Lancl1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O89112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O89112" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "O89112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O89112" } ] } ] }, { "uniprot_ac": "P00491", "gene_name": "PNP", "activity": [ { "ec_number": "2.4.2.1", "activity": "a purine 2'-deoxy-D-ribonucleoside + phosphate = 2-deoxy-alpha-D-ribose 1-phosphate + a purine nucleobase.", "evidence": [ { "id": "P00491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00491" } ] }, { "ec_number": "2.4.2.1", "activity": "", "evidence": [ { "id": "P00491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00491" } ] } ] }, { "uniprot_ac": "P00502", "gene_name": "Gsta1", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "P00502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00502" } ] }, { "ec_number": "5.3.3.-", "activity": "", "evidence": [ { "id": "P00502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00502" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P00502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00502" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P00502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00502" } ] } ] }, { "uniprot_ac": "P00746", "gene_name": "CFD", "activity": [ { "ec_number": "3.4.21.46", "activity": "Selective cleavage of Arg-|-Lys bond in complement factor B when in complex with complement subcomponent C3b or with cobra venom factor.", "evidence": [ { "id": "P00746", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00746" } ] }, { "ec_number": "3.4.21.46", "activity": "", "evidence": [ { "id": "P00746", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00746" } ] } ] }, { "uniprot_ac": "P02794", "gene_name": "FTH1", "activity": [ { "ec_number": "1.16.3.1", "activity": "4 Fe(2+) + 4 H(+) + O2 = 4 Fe(3+) + 2 H2O.", "evidence": [ { "id": "P02794", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02794" } ] }, { "ec_number": "1.16.3.1", "activity": "", "evidence": [ { "id": "P02794", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02794" } ] } ] }, { "uniprot_ac": "P04040", "gene_name": "CAT", "activity": [ { "ec_number": "1.11.1.6", "activity": "2 H2O2 = 2 H2O + O2.", "evidence": [ { "id": "P04040", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04040" } ] }, { "ec_number": "1.11.1.6", "activity": "", "evidence": [ { "id": "P04040", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04040" } ] } ] }, { "uniprot_ac": "P04075", "gene_name": "ALDOA", "activity": [ { "ec_number": "4.1.2.13", "activity": "beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3-phosphate + dihydroxyacetone phosphate.", "evidence": [ { "id": "P04075", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04075" } ] }, { "ec_number": "4.1.2.13", "activity": "", "evidence": [ { "id": "P04075", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04075" } ] } ] }, { "uniprot_ac": "P04903", "gene_name": "Gsta2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P04903", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04903" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P04903", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04903" } ] } ] }, { "uniprot_ac": "P04904", "gene_name": "Gsta3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P04904", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04904" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P04904", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04904" } ] } ] }, { "uniprot_ac": "P04905", "gene_name": "Gstm1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P04905", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04905" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P04905", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04905" } ] } ] }, { "uniprot_ac": "P04906", "gene_name": "Gstp1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P04906", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04906" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P04906", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04906" } ] } ] }, { "uniprot_ac": "P06737", "gene_name": "PYGL", "activity": [ { "ec_number": "2.4.1.1", "activity": "[(1->4)-alpha-D-glucosyl](n) + phosphate = [(1->4)-alpha-D-glucosyl](n-1) + alpha-D-glucose 1-phosphate.", "evidence": [ { "id": "P06737", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06737" } ] }, { "ec_number": "2.4.1.1", "activity": "", "evidence": [ { "id": "P06737", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06737" } ] } ] }, { "uniprot_ac": "P06744", "gene_name": "GPI", "activity": [ { "ec_number": "5.3.1.9", "activity": "alpha-D-glucose 6-phosphate = beta-D-fructose 6-phosphate.", "evidence": [ { "id": "P06744", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06744" } ] }, { "ec_number": "5.3.1.9", "activity": "", "evidence": [ { "id": "P06744", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06744" } ] } ] }, { "uniprot_ac": "P07339", "gene_name": "CTSD", "activity": [ { "ec_number": "3.4.23.5", "activity": "Specificity similar to, but narrower than, that of pepsin A. Does not cleave the 4-Gln-|-His-5 bond in B chain of insulin.", "evidence": [ { "id": "P07339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07339" } ] }, { "ec_number": "3.4.23.5", "activity": "", "evidence": [ { "id": "P07339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07339" } ] } ] }, { "uniprot_ac": "P07384", "gene_name": "CAPN1", "activity": [ { "ec_number": "3.4.22.52", "activity": "Broad endopeptidase specificity.", "evidence": [ { "id": "P07384", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07384" } ] }, { "ec_number": "3.4.22.52", "activity": "", "evidence": [ { "id": "P07384", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07384" } ] } ] }, { "uniprot_ac": "P07741", "gene_name": "APRT", "activity": [ { "ec_number": "2.4.2.7", "activity": "AMP + diphosphate = 5-phospho-alpha-D-ribose 1-diphosphate + adenine.", "evidence": [ { "id": "P07741", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07741" } ] }, { "ec_number": "2.4.2.7", "activity": "", "evidence": [ { "id": "P07741", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07741" } ] } ] }, { "uniprot_ac": "P07858", "gene_name": "CTSB", "activity": [ { "ec_number": "3.4.22.1", "activity": "Hydrolysis of proteins with broad specificity for peptide bonds. Preferentially cleaves -Arg-Arg-|-Xaa bonds in small molecule substrates (thus differing from cathepsin L). In addition to being an endopeptidase, shows peptidyl-dipeptidase activity, liberating C-terminal dipeptides.", "evidence": [ { "id": "P07858", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07858" } ] }, { "ec_number": "3.4.22.1", "activity": "", "evidence": [ { "id": "P07858", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07858" } ] } ] }, { "uniprot_ac": "P07900", "gene_name": "HSP90AA1", "activity": [ { "ec_number": "3.6.4.10", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "P07900", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07900" } ] }, { "ec_number": "3.6.4.10", "activity": "", "evidence": [ { "id": "P07900", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07900" } ] } ] }, { "uniprot_ac": "P08009", "gene_name": "Gstm7", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P08009", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08009" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P08009", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08009" } ] } ] }, { "uniprot_ac": "P08010", "gene_name": "Gstm2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P08010", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08010" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P08010", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08010" } ] } ] }, { "uniprot_ac": "P08011", "gene_name": "Mgst1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P08011", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08011" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P08011", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08011" } ] } ] }, { "uniprot_ac": "P08236", "gene_name": "GUSB", "activity": [ { "ec_number": "3.2.1.31", "activity": "a beta-D-glucuronoside + H2O = an alcohol + D-glucuronate.", "evidence": [ { "id": "P08236", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08236" } ] }, { "ec_number": "3.2.1.31", "activity": "", "evidence": [ { "id": "P08236", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08236" } ] } ] }, { "uniprot_ac": "P08263", "gene_name": "GSTA1", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "P08263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08263" } ] }, { "ec_number": "5.3.3.-", "activity": "", "evidence": [ { "id": "P08263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08263" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P08263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08263" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P08263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08263" } ] } ] }, { "uniprot_ac": "P09210", "gene_name": "GSTA2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P09210", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09210" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P09210", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09210" } ] } ] }, { "uniprot_ac": "P09211", "gene_name": "GSTP1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P09211", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09211" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P09211", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09211" } ] } ] }, { "uniprot_ac": "P09488", "gene_name": "GSTM1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P09488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09488" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P09488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09488" } ] } ] }, { "uniprot_ac": "P09769", "gene_name": "FGR", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "P09769", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09769" } ] }, { "ec_number": "2.7.10.2", "activity": "", "evidence": [ { "id": "P09769", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09769" } ] } ] }, { "uniprot_ac": "P09917", "gene_name": "ALOX5", "activity": [ { "ec_number": "1.13.11.-", "activity": "", "evidence": [ { "id": "P09917", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09917" } ] }, { "ec_number": "1.13.11.34", "activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = H2O + leukotriene A4.", "evidence": [ { "id": "P09917", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09917" } ] } ] }, { "uniprot_ac": "P09960", "gene_name": "LTA4H", "activity": [ { "ec_number": "3.3.2.6", "activity": "H2O + leukotriene A4 = leukotriene B4.", "evidence": [ { "id": "P09960", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09960" } ] }, { "ec_number": "3.4.11.4", "activity": "Release of the N-terminal residue from a tripeptide.", "evidence": [ { "id": "P09960", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09960" } ] }, { "ec_number": "3.3.2.6", "activity": "", "evidence": [ { "id": "P09960", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09960" } ] } ] }, { "uniprot_ac": "P09972", "gene_name": "ALDOC", "activity": [ { "ec_number": "4.1.2.13", "activity": "beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3-phosphate + dihydroxyacetone phosphate.", "evidence": [ { "id": "P09972", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09972" } ] }, { "ec_number": "4.1.2.13", "activity": "", "evidence": [ { "id": "P09972", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09972" } ] } ] }, { "uniprot_ac": "P0CG29", "gene_name": "GSTT2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P0CG29", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CG29" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P0CG29", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CG29" } ] } ] }, { "uniprot_ac": "P0CG30", "gene_name": "GSTT2B", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P0CG30", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CG30" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P0CG30", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CG30" } ] } ] }, { "uniprot_ac": "P10620", "gene_name": "MGST1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P10620", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10620" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P10620", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10620" } ] } ] }, { "uniprot_ac": "P10648", "gene_name": "Gsta2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P10648", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10648" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P10648", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10648" } ] } ] }, { "uniprot_ac": "P10649", "gene_name": "Gstm1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P10649", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10649" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P10649", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10649" } ] } ] }, { "uniprot_ac": "P11142", "gene_name": "HSPA8", "activity": [ { "ec_number": "3.6.4.10", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "P11142", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11142" } ] }, { "ec_number": "3.6.4.10", "activity": "", "evidence": [ { "id": "P11142", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11142" } ] } ] }, { "uniprot_ac": "P11678", "gene_name": "EPX", "activity": [ { "ec_number": "1.11.1.7", "activity": "2 a phenolic donor + H2O2 = 2 a phenolic radical donor + 2 H2O.", "evidence": [ { "id": "P11678", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11678" } ] }, { "ec_number": "1.11.1.7", "activity": "", "evidence": [ { "id": "P11678", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11678" } ] } ] }, { "uniprot_ac": "P12268", "gene_name": "IMPDH2", "activity": [ { "ec_number": "1.1.1.205", "activity": "H2O + IMP + NAD(+) = H(+) + NADH + XMP.", "evidence": [ { "id": "P12268", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12268" } ] }, { "ec_number": "1.1.1.205", "activity": "", "evidence": [ { "id": "P12268", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12268" } ] } ] }, { "uniprot_ac": "P12956", "gene_name": "XRCC6", "activity": [ { "ec_number": "4.2.99.-", "activity": "", "evidence": [ { "id": "P12956", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12956" } ] }, { "ec_number": "3.6.4.-", "activity": "", "evidence": [ { "id": "P12956", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12956" } ] } ] }, { "uniprot_ac": "P13010", "gene_name": "XRCC5", "activity": [ { "ec_number": "3.6.4.-", "activity": "", "evidence": [ { "id": "P13010", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13010" } ] } ] }, { "uniprot_ac": "P13639", "gene_name": "EEF2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P13639", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13639" } ] } ] }, { "uniprot_ac": "P13716", "gene_name": "ALAD", "activity": [ { "ec_number": "4.2.1.24", "activity": "2 5-aminolevulinate = H(+) + 2 H2O + porphobilinogen.", "evidence": [ { "id": "P13716", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13716" } ] }, { "ec_number": "4.2.1.24", "activity": "", "evidence": [ { "id": "P13716", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13716" } ] } ] }, { "uniprot_ac": "P13745", "gene_name": "Gsta1", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "P13745", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13745" } ] }, { "ec_number": "5.3.3.-", "activity": "", "evidence": [ { "id": "P13745", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13745" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P13745", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13745" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P13745", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13745" } ] } ] }, { "uniprot_ac": "P13798", "gene_name": "APEH", "activity": [ { "ec_number": "3.4.19.1", "activity": "Internal cleavage of oxidized and glycated proteins.", "evidence": [ { "id": "P13798", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13798" } ] }, { "ec_number": "3.4.19.1", "activity": "", "evidence": [ { "id": "P13798", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13798" } ] } ] }, { "uniprot_ac": "P14174", "gene_name": "MIF", "activity": [ { "ec_number": "5.3.2.1", "activity": "3-phenylpyruvate = enol-phenylpyruvate.", "evidence": [ { "id": "P14174", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14174" } ] }, { "ec_number": "5.3.3.12", "activity": "L-dopachrome = 5,6-dihydroxyindole-2-carboxylate.", "evidence": [ { "id": "P14174", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14174" } ] }, { "ec_number": "5.3.2.1", "activity": "", "evidence": [ { "id": "P14174", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14174" } ] } ] }, { "uniprot_ac": "P14618", "gene_name": "PKM", "activity": [ { "ec_number": "2.7.1.40", "activity": "CTP + pyruvate = CDP + H(+) + phosphoenolpyruvate.", "evidence": [ { "id": "P14618", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14618" } ] }, { "ec_number": "2.7.1.40", "activity": "", "evidence": [ { "id": "P14618", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14618" } ] }, { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "P14618", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14618" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P14618", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14618" } ] } ] }, { "uniprot_ac": "P14780", "gene_name": "MMP9", "activity": [ { "ec_number": "3.4.24.35", "activity": "Cleavage of gelatin types I and V and collagen types IV and V.", "evidence": [ { "id": "P14780", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14780" } ] }, { "ec_number": "3.4.24.35", "activity": "", "evidence": [ { "id": "P14780", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14780" } ] } ] }, { "uniprot_ac": "P14942", "gene_name": "Gsta4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P14942", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14942" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P14942", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14942" } ] } ] }, { "uniprot_ac": "P15586", "gene_name": "GNS", "activity": [ { "ec_number": "3.1.6.14", "activity": "Hydrolysis of the 6-sulfate groups of the N-acetyl-D-glucosamine 6-sulfate units of heparan sulfate and keratan sulfate.", "evidence": [ { "id": "P15586", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15586" } ] }, { "ec_number": "3.1.6.14", "activity": "", "evidence": [ { "id": "P15586", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15586" } ] } ] }, { "uniprot_ac": "P15626", "gene_name": "Gstm2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P15626", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15626" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P15626", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15626" } ] } ] }, { "uniprot_ac": "P15848", "gene_name": "ARSB", "activity": [ { "ec_number": "3.1.6.12", "activity": "Hydrolysis of the 4-sulfate groups of the N-acetyl-D-galactosamine 4-sulfate units of chondroitin sulfate and dermatan sulfate.", "evidence": [ { "id": "P15848", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15848" } ] }, { "ec_number": "3.1.6.12", "activity": "", "evidence": [ { "id": "P15848", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15848" } ] } ] }, { "uniprot_ac": "P16278", "gene_name": "GLB1", "activity": [ { "ec_number": "3.2.1.23", "activity": "Hydrolysis of terminal non-reducing beta-D-galactose residues in beta-D-galactosides.", "evidence": [ { "id": "P16278", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16278" } ] }, { "ec_number": "3.2.1.23", "activity": "", "evidence": [ { "id": "P16278", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16278" } ] } ] }, { "uniprot_ac": "P17695", "gene_name": "GRX2", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "P17695", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17695" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P17695", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17695" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P17695", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17695" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "P17695", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17695" } ] } ] }, { "uniprot_ac": "P17858", "gene_name": "PFKL", "activity": [ { "ec_number": "2.7.1.11", "activity": "ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 1,6-bisphosphate + H(+).", "evidence": [ { "id": "P17858", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17858" } ] }, { "ec_number": "2.7.1.11", "activity": "", "evidence": [ { "id": "P17858", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17858" } ] } ] }, { "uniprot_ac": "P18669", "gene_name": "PGAM1", "activity": [ { "ec_number": "5.4.2.11", "activity": "(2R)-2-phosphoglycerate = (2R)-3-phosphoglycerate.", "evidence": [ { "id": "P18669", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18669" } ] }, { "ec_number": "5.4.2.4", "activity": "(2R)-3-phospho-glyceroyl phosphate = (2R)-2,3-bisphosphoglycerate + H(+).", "evidence": [ { "id": "P18669", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18669" } ] }, { "ec_number": "5.4.2.4", "activity": "", "evidence": [ { "id": "P18669", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18669" } ] }, { "ec_number": "5.4.2.11", "activity": "", "evidence": [ { "id": "P18669", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18669" } ] } ] }, { "uniprot_ac": "P19157", "gene_name": "Gstp1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P19157", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19157" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P19157", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19157" } ] } ] }, { "uniprot_ac": "P19639", "gene_name": "Gstm3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P19639", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19639" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P19639", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19639" } ] } ] }, { "uniprot_ac": "P20432", "gene_name": "GstD1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P20432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20432" } ] }, { "ec_number": "4.5.1.1", "activity": "1,1,1-trichloro-2,2-bis(4-chlorophenyl)ethane = 1,1-dichloro-2,2-bis(4-chlorophenyl)ethylene + chloride + H(+).", "evidence": [ { "id": "P20432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20432" } ] }, { "ec_number": "4.5.1.1", "activity": "", "evidence": [ { "id": "P20432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20432" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P20432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20432" } ] } ] }, { "uniprot_ac": "P20839", "gene_name": "IMPDH1", "activity": [ { "ec_number": "1.1.1.205", "activity": "H2O + IMP + NAD(+) = H(+) + NADH + XMP.", "evidence": [ { "id": "P20839", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20839" } ] }, { "ec_number": "1.1.1.205", "activity": "", "evidence": [ { "id": "P20839", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20839" } ] } ] }, { "uniprot_ac": "P21266", "gene_name": "GSTM3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P21266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21266" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P21266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21266" } ] } ] }, { "uniprot_ac": "P22392", "gene_name": "NME2", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P22392", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22392" } ] }, { "ec_number": "2.7.13.3", "activity": "ATP + protein L-histidine = ADP + protein N-phospho-L-histidine.", "evidence": [ { "id": "P22392", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22392" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P22392", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22392" } ] }, { "ec_number": "2.7.13.3", "activity": "", "evidence": [ { "id": "P22392", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22392" } ] } ] }, { "uniprot_ac": "P24472", "gene_name": "Gsta4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P24472", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24472" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P24472", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24472" } ] } ] }, { "uniprot_ac": "P24473", "gene_name": "Gstk1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P24473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24473" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P24473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24473" } ] } ] }, { "uniprot_ac": "P25373", "gene_name": "GRX1", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "P25373", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25373" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P25373", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25373" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "P25373", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25373" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P25373", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25373" } ] } ] }, { "uniprot_ac": "P25774", "gene_name": "CTSS", "activity": [ { "ec_number": "3.4.22.27", "activity": "Similar to cathepsin L, but with much less activity on Z-Phe-Arg-|-NHMec, and more activity on the Z-Val-Val-Arg-|-Xaa compound.", "evidence": [ { "id": "P25774", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25774" } ] }, { "ec_number": "3.4.22.27", "activity": "", "evidence": [ { "id": "P25774", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25774" } ] } ] }, { "uniprot_ac": "P28161", "gene_name": "GSTM2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P28161", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28161" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P28161", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28161" } ] } ] }, { "uniprot_ac": "P28482", "gene_name": "MAPK1", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P28482", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28482" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P28482", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28482" } ] } ] }, { "uniprot_ac": "P30041", "gene_name": "PRDX6", "activity": [ { "ec_number": "1.11.1.27", "activity": "a hydroperoxide + 2 glutathione = an alcohol + glutathione disulfide + H2O.", "evidence": [ { "id": "P30041", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30041" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P30041", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30041" } ] }, { "ec_number": "2.3.1.23", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "P30041", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30041" } ] }, { "ec_number": "1.11.1.27", "activity": "", "evidence": [ { "id": "P30041", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30041" } ] } ] }, { "uniprot_ac": "P30115", "gene_name": "Gsta3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P30115", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30115" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P30115", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30115" } ] } ] }, { "uniprot_ac": "P30711", "gene_name": "GSTT1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P30711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30711" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P30711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30711" } ] } ] }, { "uniprot_ac": "P30713", "gene_name": "Gstt2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P30713", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30713" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P30713", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30713" } ] } ] }, { "uniprot_ac": "P32320", "gene_name": "CDA", "activity": [ { "ec_number": "3.5.4.5", "activity": "2'-deoxycytidine + H(+) + H2O = 2'-deoxyuridine + NH4(+).", "evidence": [ { "id": "P32320", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32320" } ] }, { "ec_number": "3.5.4.5", "activity": "", "evidence": [ { "id": "P32320", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32320" } ] } ] }, { "uniprot_ac": "P36156", "gene_name": "ECM4", "activity": [ { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "P36156", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36156" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P36156", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36156" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P36156", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36156" } ] } ] }, { "uniprot_ac": "P36871", "gene_name": "PGM1", "activity": [ { "ec_number": "5.4.2.2", "activity": "alpha-D-glucose 1-phosphate = alpha-D-glucose 6-phosphate.", "evidence": [ { "id": "P36871", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36871" } ] }, { "ec_number": "5.4.2.2", "activity": "", "evidence": [ { "id": "P36871", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36871" } ] } ] }, { "uniprot_ac": "P40582", "gene_name": "GTT1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P40582", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40582" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P40582", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40582" } ] } ] }, { "uniprot_ac": "P41043", "gene_name": "GstS1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P41043", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41043" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P41043", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41043" } ] } ] }, { "uniprot_ac": "P46418", "gene_name": "Gsta5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P46418", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46418" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P46418", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46418" } ] } ] }, { "uniprot_ac": "P46425", "gene_name": "Gstp2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P46425", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46425" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P46425", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46425" } ] } ] }, { "uniprot_ac": "P46439", "gene_name": "GSTM5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P46439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46439" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P46439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46439" } ] } ] }, { "uniprot_ac": "P46976", "gene_name": "GYG1", "activity": [ { "ec_number": "2.4.1.186", "activity": "[1,4-alpha-D-glucosyl](n)-L-tyrosyl-[glycogenin] + UDP-alpha-D-glucose = [1,4-alpha-D-glucosyl](n+1)-L-tyrosyl-[glycogenin] + H(+) + UDP.", "evidence": [ { "id": "P46976", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46976" } ] }, { "ec_number": "2.4.1.186", "activity": "", "evidence": [ { "id": "P46976", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46976" } ] } ] }, { "uniprot_ac": "P48239", "gene_name": "GTO1", "activity": [ { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "P48239", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48239" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P48239", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48239" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P48239", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48239" } ] } ] }, { "uniprot_ac": "P48774", "gene_name": "Gstm5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P48774", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48774" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P48774", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48774" } ] } ] }, { "uniprot_ac": "P52790", "gene_name": "HK3", "activity": [ { "ec_number": "2.7.1.1", "activity": "ATP + D-fructose = ADP + D-fructose 6-phosphate + H(+).", "evidence": [ { "id": "P52790", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52790" } ] }, { "ec_number": "2.7.1.1", "activity": "", "evidence": [ { "id": "P52790", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52790" } ] }, { "ec_number": "2.7.1.-", "activity": "", "evidence": [ { "id": "P52790", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52790" } ] } ] }, { "uniprot_ac": "P53396", "gene_name": "ACLY", "activity": [ { "ec_number": "2.3.3.8", "activity": "acetyl-CoA + ADP + oxaloacetate + phosphate = ATP + citrate + CoA.", "evidence": [ { "id": "P53396", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53396" } ] }, { "ec_number": "2.3.3.8", "activity": "", "evidence": [ { "id": "P53396", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53396" } ] } ] }, { "uniprot_ac": "P55072", "gene_name": "VCP", "activity": [ { "ec_number": "3.6.4.6", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "P55072", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55072" } ] }, { "ec_number": "3.6.4.6", "activity": "", "evidence": [ { "id": "P55072", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55072" } ] } ] }, { "uniprot_ac": "P57113", "gene_name": "Gstz1", "activity": [ { "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.", "evidence": [ { "id": "P57113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P57113" } ] }, { "ec_number": "5.2.1.2", "activity": "", "evidence": [ { "id": "P57113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P57113" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P57113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P57113" } ] } ] }, { "uniprot_ac": "P62937", "gene_name": "PPIA", "activity": [ { "ec_number": "5.2.1.8", "activity": "[protein]-peptidylproline (omega=180) = [protein]-peptidylproline (omega=0).", "evidence": [ { "id": "P62937", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62937" } ] }, { "ec_number": "5.2.1.8", "activity": "", "evidence": [ { "id": "P62937", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62937" } ] } ] }, { "uniprot_ac": "P68104", "gene_name": "EEF1A1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P68104", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68104" } ] } ] }, { "uniprot_ac": "P68402", "gene_name": "PAFAH1B2", "activity": [ { "ec_number": "3.1.1.47", "activity": "a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + acetate + H(+).", "evidence": [ { "id": "P68402", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68402" } ] }, { "ec_number": "3.1.1.47", "activity": "", "evidence": [ { "id": "P68402", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68402" } ] } ] }, { "uniprot_ac": "P78417", "gene_name": "GSTO1", "activity": [ { "ec_number": "1.20.4.2", "activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] }, { "ec_number": "1.20.4.2", "activity": "", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] }, { "ec_number": "1.8.5.1", "activity": "", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] } ] }, { "uniprot_ac": "P98066", "gene_name": "TNFAIP6", "activity": [ { "ec_number": "3.1.1.-", "activity": "", "evidence": [ { "id": "P98066", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P98066" } ] } ] }, { "uniprot_ac": "Q01432", "gene_name": "AMPD3", "activity": [ { "ec_number": "3.5.4.6", "activity": "AMP + H(+) + H2O = IMP + NH4(+).", "evidence": [ { "id": "Q01432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01432" } ] }, { "ec_number": "3.5.4.6", "activity": "", "evidence": [ { "id": "Q01432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01432" } ] } ] }, { "uniprot_ac": "Q01579", "gene_name": "Gstt1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q01579", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01579" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q01579", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01579" } ] } ] }, { "uniprot_ac": "Q03013", "gene_name": "GSTM4", "activity": [ { "ec_number": "4.4.1.20", "activity": "leukotriene C4 = glutathione + leukotriene A4.", "evidence": [ { "id": "Q03013", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03013" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q03013", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03013" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q03013", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03013" } ] } ] }, { "uniprot_ac": "Q04806", "gene_name": "GTO3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q04806", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04806" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q04806", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04806" } ] } ] }, { "uniprot_ac": "Q12390", "gene_name": "GTT2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q12390", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12390" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q12390", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12390" } ] } ] }, { "uniprot_ac": "Q13162", "gene_name": "PRDX4", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "Q13162", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13162" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "Q13162", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13162" } ] } ] }, { "uniprot_ac": "Q13464", "gene_name": "ROCK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q13464", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13464" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q13464", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13464" } ] } ] }, { "uniprot_ac": "Q13510", "gene_name": "ASAH1", "activity": [ { "ec_number": "3.5.1.23", "activity": "an N-acylsphing-4-enine + H2O = a fatty acid + sphing-4-enine.", "evidence": [ { "id": "Q13510", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13510" } ] }, { "ec_number": "3.5.1.23", "activity": "", "evidence": [ { "id": "Q13510", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13510" } ] }, { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q13510", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13510" } ] } ] }, { "uniprot_ac": "Q14004", "gene_name": "CDK13", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q14004", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14004" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "Q14004", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14004" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q14004", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14004" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "Q14004", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14004" } ] } ] }, { "uniprot_ac": "Q16539", "gene_name": "MAPK14", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q16539", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16539" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "Q16539", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16539" } ] } ] }, { "uniprot_ac": "Q16769", "gene_name": "QPCT", "activity": [ { "ec_number": "2.3.2.5", "activity": "N-terminal L-glutaminyl-[peptide] = N-terminal 5-oxo-L-prolyl-[peptide] + NH4(+).", "evidence": [ { "id": "Q16769", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16769" } ] }, { "ec_number": "2.3.2.5", "activity": "", "evidence": [ { "id": "Q16769", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16769" } ] } ] }, { "uniprot_ac": "Q16772", "gene_name": "GSTA3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q16772", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16772" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q16772", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16772" } ] } ] }, { "uniprot_ac": "Q4V8E6", "gene_name": "Gstt4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q4V8E6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V8E6" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q4V8E6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V8E6" } ] } ] }, { "uniprot_ac": "Q54GA9", "gene_name": "mgst", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q54GA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54GA9" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q54GA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54GA9" } ] } ] }, { "uniprot_ac": "Q54QV7", "gene_name": "gsta5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q54QV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QV7" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q54QV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QV7" } ] } ] }, { "uniprot_ac": "Q54VI4", "gene_name": "gsta3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q54VI4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54VI4" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q54VI4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54VI4" } ] } ] }, { "uniprot_ac": "Q556G3", "gene_name": "gsta2-2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q556G3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q556G3" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q556G3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q556G3" } ] } ] }, { "uniprot_ac": "Q55FF3", "gene_name": "gsta1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q55FF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55FF3" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q55FF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55FF3" } ] } ] }, { "uniprot_ac": "Q5BK56", "gene_name": "Gstm4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q5BK56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BK56" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q5BK56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BK56" } ] }, { "ec_number": "4.4.1.20", "activity": "leukotriene C4 = glutathione + leukotriene A4.", "evidence": [ { "id": "Q5BK56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BK56" } ] } ] }, { "uniprot_ac": "Q61133", "gene_name": "Gstt2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q61133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61133" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q61133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61133" } ] } ] }, { "uniprot_ac": "Q64471", "gene_name": "Gstt1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q64471", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64471" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q64471", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64471" } ] } ] }, { "uniprot_ac": "Q6AXV9", "gene_name": "Gsto2", "activity": [ { "ec_number": "1.20.4.2", "activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] }, { "ec_number": "1.20.4.2", "activity": "", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] }, { "ec_number": "1.8.5.1", "activity": "", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] } ] }, { "uniprot_ac": "Q6AXY0", "gene_name": "Gsta6", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q6AXY0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXY0" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q6AXY0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXY0" } ] } ] }, { "uniprot_ac": "Q6P8Q0", "gene_name": "Gm3776", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q6P8Q0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P8Q0" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q6P8Q0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P8Q0" } ] } ] }, { "uniprot_ac": "Q7JYX0", "gene_name": "GstE14", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q7JYX0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7JYX0" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q7JYX0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7JYX0" } ] } ] }, { "uniprot_ac": "Q7RTV2", "gene_name": "GSTA5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q7RTV2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7RTV2" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q7RTV2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7RTV2" } ] } ] }, { "uniprot_ac": "Q7Z6Z7", "gene_name": "HUWE1", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q7Z6Z7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z6Z7" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q7Z6Z7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z6Z7" } ] } ] }, { "uniprot_ac": "Q80W21", "gene_name": "Gstm7", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q80W21", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80W21" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q80W21", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80W21" } ] } ] }, { "uniprot_ac": "Q86AU1", "gene_name": "gsta4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q86AU1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86AU1" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q86AU1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86AU1" } ] } ] }, { "uniprot_ac": "Q8K2Q2", "gene_name": "Gsto2", "activity": [ { "ec_number": "1.20.4.2", "activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] }, { "ec_number": "1.8.5.1", "activity": "", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] }, { "ec_number": "1.20.4.2", "activity": "", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] } ] }, { "uniprot_ac": "Q8R5I6", "gene_name": "Gstm4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q8R5I6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R5I6" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q8R5I6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R5I6" } ] }, { "ec_number": "4.4.1.20", "activity": "leukotriene C4 = glutathione + leukotriene A4.", "evidence": [ { "id": "Q8R5I6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R5I6" } ] } ] }, { "uniprot_ac": "Q8WVQ1", "gene_name": "CANT1", "activity": [ { "ec_number": "3.6.1.6", "activity": "ADP + H2O = AMP + H(+) + phosphate.", "evidence": [ { "id": "Q8WVQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WVQ1" } ] }, { "ec_number": "3.6.1.6", "activity": "", "evidence": [ { "id": "Q8WVQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WVQ1" } ] } ] }, { "uniprot_ac": "Q91VS7", "gene_name": "Mgst1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q91VS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91VS7" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q91VS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91VS7" } ] } ] }, { "uniprot_ac": "Q96G03", "gene_name": "PGM2", "activity": [ { "ec_number": "5.4.2.2", "activity": "alpha-D-glucose 1-phosphate = alpha-D-glucose 6-phosphate.", "evidence": [ { "id": "Q96G03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96G03" } ] }, { "ec_number": "5.4.2.7", "activity": "2-deoxy-alpha-D-ribose 1-phosphate = 2-deoxy-D-ribose 5-phosphate.", "evidence": [ { "id": "Q96G03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96G03" } ] }, { "ec_number": "5.4.2.7", "activity": "", "evidence": [ { "id": "Q96G03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96G03" } ] } ] }, { "uniprot_ac": "Q99436", "gene_name": "PSMB7", "activity": [ { "ec_number": "3.4.25.1", "activity": "Cleavage of peptide bonds with very broad specificity.", "evidence": [ { "id": "Q99436", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99436" } ] }, { "ec_number": "3.4.25.1", "activity": "", "evidence": [ { "id": "Q99436", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99436" } ] } ] }, { "uniprot_ac": "Q99735", "gene_name": "MGST2", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "Q99735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99735" } ] }, { "ec_number": "4.4.1.20", "activity": "leukotriene C4 = glutathione + leukotriene A4.", "evidence": [ { "id": "Q99735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99735" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q99735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99735" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q99735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99735" } ] } ] }, { "uniprot_ac": "Q99L20", "gene_name": "Gstt3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q99L20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99L20" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q99L20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99L20" } ] } ] }, { "uniprot_ac": "Q9D4P7", "gene_name": "Gstt4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9D4P7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D4P7" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9D4P7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D4P7" } ] } ] }, { "uniprot_ac": "Q9DCM2", "gene_name": "Gstk1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9DCM2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DCM2" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9DCM2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DCM2" } ] } ] }, { "uniprot_ac": "Q9H4Y5", "gene_name": "GSTO2", "activity": [ { "ec_number": "1.20.4.2", "activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.", "evidence": [ { "id": "Q9H4Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H4Y5" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "Q9H4Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H4Y5" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9H4Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H4Y5" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9H4Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H4Y5" } ] } ] }, { "uniprot_ac": "Q9JHF7", "gene_name": "Hpgds", "activity": [ { "ec_number": "5.3.99.2", "activity": "prostaglandin H2 = prostaglandin D2.", "evidence": [ { "id": "Q9JHF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHF7" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9JHF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHF7" } ] }, { "ec_number": "5.3.99.2", "activity": "", "evidence": [ { "id": "Q9JHF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHF7" } ] } ] }, { "uniprot_ac": "Q9P0J7", "gene_name": "KCMF1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9P0J7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9P0J7" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9P0J7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9P0J7" } ] } ] }, { "uniprot_ac": "Q9QX69", "gene_name": "Lancl1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9QX69", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QX69" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9QX69", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QX69" } ] } ] }, { "uniprot_ac": "Q9UBR2", "gene_name": "CTSZ", "activity": [ { "ec_number": "3.4.18.1", "activity": "Release of C-terminal amino acid residues with broad specificity, but lacks action on C-terminal proline. Shows weak endopeptidase activity.", "evidence": [ { "id": "Q9UBR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UBR2" } ] }, { "ec_number": "3.4.18.1", "activity": "", "evidence": [ { "id": "Q9UBR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UBR2" } ] } ] }, { "uniprot_ac": "Q9UNP9", "gene_name": "PPIE", "activity": [ { "ec_number": "5.2.1.8", "activity": "[protein]-peptidylproline (omega=180) = [protein]-peptidylproline (omega=0).", "evidence": [ { "id": "Q9UNP9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UNP9" } ] }, { "ec_number": "5.2.1.8", "activity": "", "evidence": [ { "id": "Q9UNP9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UNP9" } ] } ] }, { "uniprot_ac": "Q9VG93", "gene_name": "GstD7", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VG93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG93" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9VG93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG93" } ] } ] }, { "uniprot_ac": "Q9VG94", "gene_name": "GstD6", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VG94", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG94" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9VG94", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG94" } ] } ] }, { "uniprot_ac": "Q9VG95", "gene_name": "GstD5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VG95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG95" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9VG95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG95" } ] } ] }, { "uniprot_ac": "Q9VG96", "gene_name": "GstD4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VG96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG96" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9VG96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG96" } ] } ] }, { "uniprot_ac": "Q9VG98", "gene_name": "GstD2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VG98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG98" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9VG98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG98" } ] } ] }, { "uniprot_ac": "Q9VHD2", "gene_name": "GstZ2", "activity": [ { "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.", "evidence": [ { "id": "Q9VHD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD2" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VHD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD2" } ] }, { "ec_number": "5.2.1.2", "activity": "", "evidence": [ { "id": "Q9VHD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD2" } ] } ] }, { "uniprot_ac": "Q9VHD3", "gene_name": "GstZ1", "activity": [ { "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.", "evidence": [ { "id": "Q9VHD3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD3" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VHD3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD3" } ] }, { "ec_number": "5.2.1.2", "activity": "", "evidence": [ { "id": "Q9VHD3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD3" } ] } ] }, { "uniprot_ac": "Q9WVL0", "gene_name": "Gstz1", "activity": [ { "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.", "evidence": [ { "id": "Q9WVL0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVL0" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9WVL0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVL0" } ] }, { "ec_number": "5.2.1.2", "activity": "", "evidence": [ { "id": "Q9WVL0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVL0" } ] } ] }, { "uniprot_ac": "Q9Y2Q3", "gene_name": "GSTK1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9Y2Q3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2Q3" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9Y2Q3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2Q3" } ] } ] }, { "uniprot_ac": "Q9Y315", "gene_name": "DERA", "activity": [ { "ec_number": "4.1.2.4", "activity": "2-deoxy-D-ribose 5-phosphate = acetaldehyde + D-glyceraldehyde 3-phosphate.", "evidence": [ { "id": "Q9Y315", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y315" } ] }, { "ec_number": "4.1.2.4", "activity": "", "evidence": [ { "id": "Q9Y315", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y315" } ] } ] }, { "uniprot_ac": "Q9Z1B2", "gene_name": "Gstm5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9Z1B2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1B2" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9Z1B2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1B2" } ] } ] }, { "uniprot_ac": "Q9Z339", "gene_name": "Gsto1", "activity": [ { "ec_number": "1.20.4.2", "activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] }, { "ec_number": "1.20.4.2", "activity": "", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] }, { "ec_number": "1.8.5.1", "activity": "", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [ 105 ], "glycation_sites": [], "phosphorylation_sites": [ 4, 8, 43, 62, 185, 199 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 258 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }