{
"uniprot_canonical_ac": "P09210-1",
"uniprot_ac": "P09210",
"uniprot_id": "GSTA2_HUMAN",
"mass": {
"chemical_mass": 25664.0,
"monoisotopic_mass": 25664.0
},
"refseq": {
"ac": "NP_000837",
"name": "glutathione S-transferase A2",
"summary": "Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver. In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity thereby protecting the cells from reactive oxygen species and the products of peroxidation. [provided by RefSeq, Jul 2008].",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000837"
},
"gene_names": [
{
"name": "GSTA2",
"resource": "UniProtKB",
"type": "recommended",
"url": "https://www.uniprot.org/uniprot/P09210",
"id": "P09210"
},
{
"name": "GST2; GSTA2-2; GTA2; GTH2",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000837",
"id": "NP_000837"
},
{
"name": "GST2",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/P09210",
"id": "P09210"
},
{
"name": "GSTA2",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000837",
"id": "NP_000837"
}
],
"protein_names": [
{
"name": "Glutathione S-transferase A2",
"resource": "UniProtKB",
"type": "recommended",
"url": "",
"id": "P09210"
},
{
"name": "2.5.1.18",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P09210"
},
{
"name": "GST HA subunit 2",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P09210"
},
{
"name": "GST class-alpha member 2",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P09210"
},
{
"name": "GST-gamma",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P09210"
},
{
"name": "GSTA2-2",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P09210"
},
{
"name": "GTH2",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P09210"
},
{
"name": "glutathione S-transferase A2",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000837",
"id": "NP_000837"
},
{
"name": "liver GST2; glutathione S-alkyltransferase A2; glutathione S-aryltransferase A2; S-(hydroxyalkyl)glutathione lyase A2; glutathione S-aralkyltransferase A2; GST-gamma; GST HA subunit 2; GST class-alpha member 2; testis tissue sperm-binding protein Li 59n",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000837",
"id": "NP_000837"
}
],
"function": [
{
"annotation": "Catalyzes the conjugation of glutathione to a large variety of electrophilic compounds.",
"evidence": [
{
"database": "UniProtKB",
"id": "P09210",
"url": "https://www.uniprot.org/uniprot/P09210#function"
},
{
"database": "UniProtKB",
"id": "P10648",
"url": "https://www.uniprot.org/uniprot/P10648#function"
}
]
},
{
"annotation": "Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver. In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity thereby protecting the cells from reactive oxygen species and the products of peroxidation. [provided by RefSeq, Jul 2008].",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000837",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000837"
}
]
},
{
"annotation": "The GSTA2 S112T polymorphism is predictive of transplant outcome in patients receiving busulfan in the preparative regimen, at least in association with cyclophosphamide.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000837",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000837"
},
{
"database": "PubMed",
"id": "24056816",
"url": "https://glygen.org/publication/PubMed/24056816"
}
]
}
],
"disease": [],
"snv": [],
"mutagenesis": [],
"expression_tissue": [
{
"tissue": {
"name": "Adult mammalian kidney",
"namespace": "UBERON",
"id": "0000082",
"url": "http://purl.obolibrary.org/obo/UBERON_0000082"
},
"score": "90.6",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000244067",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000244067"
}
]
},
{
"tissue": {
"name": "Stomach",
"namespace": "UBERON",
"id": "0000945",
"url": "http://purl.obolibrary.org/obo/UBERON_0000945"
},
"score": "59.33",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000244067",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000244067"
}
]
},
{
"tissue": {
"name": "Esophagus",
"namespace": "UBERON",
"id": "0001043",
"url": "http://purl.obolibrary.org/obo/UBERON_0001043"
},
"score": "17.43",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000244067",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000244067"
}
]
},
{
"tissue": {
"name": "Rectum",
"namespace": "UBERON",
"id": "0001052",
"url": "http://purl.obolibrary.org/obo/UBERON_0001052"
},
"score": "53.3",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000244067",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000244067"
}
]
},
{
"tissue": {
"name": "Urinary bladder",
"namespace": "UBERON",
"id": "0001255",
"url": "http://purl.obolibrary.org/obo/UBERON_0001255"
},
"score": "31.8",
"present": "ABSENT",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000244067",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000244067"
}
]
},
{
"tissue": {
"name": "Thyroid gland",
"namespace": "UBERON",
"id": "0002046",
"url": "http://purl.obolibrary.org/obo/UBERON_0002046"
},
"score": "31.22",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000244067",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000244067"
}
]
},
{
"tissue": {
"name": "Liver",
"namespace": "UBERON",
"id": "0002107",
"url": "http://purl.obolibrary.org/obo/UBERON_0002107"
},
"score": "91.5",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000244067",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000244067"
}
]
},
{
"tissue": {
"name": "Prostate gland",
"namespace": "UBERON",
"id": "0002367",
"url": "http://purl.obolibrary.org/obo/UBERON_0002367"
},
"score": "57.9",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000244067",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000244067"
}
]
},
{
"tissue": {
"name": "Thoracic mammary gland",
"namespace": "UBERON",
"id": "0005200",
"url": "http://purl.obolibrary.org/obo/UBERON_0005200"
},
"score": "43.85",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000244067",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000244067"
}
]
}
],
"expression_disease": [
{
"significant": "Yes",
"trend": "down",
"name": "Prostate cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10283",
"evidence": [
{
"database": "BioXpress",
"id": "P09210",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09210"
}
],
"disease": [
{
"disease_id": "DOID:10283",
"recommended_name": {
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer",
"description": "A male reproductive organ cancer that is located_in the prostate."
},
"synonyms": [
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "NGP - new growth of prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "malignant tumor of the prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "tumor of the prostate",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, type 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "HPC9",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "EHBP1 familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "familial prostate cancer caused by mutation in EHBP1",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, type 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "HPC12",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, type 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "HPC5",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, type 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, susceptibility to, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "HPC3",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, type 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, susceptibility to, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "HPC4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, on chromosome 7",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "MSMB familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "familial prostate cancer caused by mutation in MSMB",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, type 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "HPC13",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, type 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "HPC8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "predisposing for prostate cancer",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, type 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "HPC6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "HPC10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate carcinoma",
"description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate carcinoma",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, somatic",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, hereditary",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "HPC7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer aggressiveness",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "RNASEL familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "familial prostate cancer caused by mutation in RNASEL",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, type 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "HPC1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "Prca1",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "HPC11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "HPC14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "HPC15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "HPCX1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer susceptibility, X-linked",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "HPCX2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MIM:611868",
"resource": "MIM",
"url": "https://www.omim.org/entry/611868",
"name": "Prostate cancer, hereditary, 12",
"description": "Prostate cancer, hereditary, 12"
},
{
"id": "MIM:611928",
"resource": "MIM",
"url": "https://www.omim.org/entry/611928",
"name": "Prostate cancer, hereditary, 13",
"description": "Prostate cancer, hereditary, 13"
},
{
"id": "MIM:176807",
"resource": "MIM",
"url": "https://www.omim.org/entry/176807",
"name": "Prostate cancer",
"description": "Prostate cancer"
},
{
"id": "MIM:601518",
"resource": "MIM",
"url": "https://www.omim.org/entry/601518",
"name": "Prostate cancer, hereditary, 1",
"description": "Prostate cancer, hereditary, 1"
},
{
"id": "MIM:611955",
"resource": "MIM",
"url": "https://www.omim.org/entry/611955",
"name": "Prostate cancer, hereditary, 11",
"description": "Prostate cancer, hereditary, 11"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Stomach cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10534",
"evidence": [
{
"database": "BioXpress",
"id": "P09210",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09210"
}
],
"disease": [
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Urinary bladder cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11054",
"evidence": [
{
"database": "BioXpress",
"id": "P09210",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09210"
}
],
"disease": [
{
"disease_id": "DOID:11054",
"recommended_name": {
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "urinary bladder cancer",
"description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
},
"synonyms": [
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "bladder cancer",
"description": ""
},
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": "A primary or metastatic malignant neoplasm involving the bladder."
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "bladder cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "cancer of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumour",
"description": ""
},
{
"id": "MIM:109800",
"resource": "MIM",
"url": "https://www.omim.org/entry/109800",
"name": "Bladder cancer",
"description": "Bladder cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Head and neck cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11934",
"evidence": [
{
"database": "BioXpress",
"id": "P09210",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09210"
}
],
"disease": [
{
"disease_id": "DOID:11934",
"recommended_name": {
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck cancer",
"description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx."
},
"synonyms": [
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck tumours",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head/neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "tumor of head and neck",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Lung cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1324",
"evidence": [
{
"database": "BioXpress",
"id": "P09210",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09210"
}
],
"disease": [
{
"disease_id": "DOID:1324",
"recommended_name": {
"id": "DOID:1324",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1324",
"name": "lung cancer",
"description": "A respiratory system cancer that is located_in the lung."
},
"synonyms": [
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "LNCR1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "LNCR3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "adenocarcinoma of lung, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "LNCR4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "LNCR5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": "A malignant neoplasm involving the lung."
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "cancer of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung neoplasm",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumor",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumour",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "Nonsmall cell lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "alveolar cell carcinoma",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung neoplasm",
"description": ""
},
{
"id": "MIM:211980",
"resource": "MIM",
"url": "https://www.omim.org/entry/211980",
"name": "Lung cancer",
"description": "Lung cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Breast cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1612",
"evidence": [
{
"database": "BioXpress",
"id": "P09210",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09210"
}
],
"disease": [
{
"disease_id": "DOID:1612",
"recommended_name": {
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast cancer",
"description": "A thoracic cancer that originates in the mammary gland."
},
"synonyms": [
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant neoplasm of breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant tumor of the breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary cancer",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "primary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, lobular, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of the breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial Male",
"description": ""
},
{
"id": "MIM:114480",
"resource": "MIM",
"url": "https://www.omim.org/entry/114480",
"name": "Breast cancer",
"description": "Breast cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Thyroid cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1781",
"evidence": [
{
"database": "BioXpress",
"id": "P09210",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09210"
}
],
"disease": [
{
"disease_id": "DOID:1781",
"recommended_name": {
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid cancer",
"description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage."
},
"synonyms": [
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid gland cancer",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "Thyroid gland neoplasm",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant tumour of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Kidney cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:263",
"evidence": [
{
"database": "BioXpress",
"id": "P09210",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09210"
}
],
"disease": [
{
"disease_id": "DOID:263",
"recommended_name": {
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "kidney cancer",
"description": "A urinary system cancer that is located_in the kidney."
},
"synonyms": [
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant neoplasm of kidney except pelvis",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant tumour of kidney",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "renal cancer",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Liver cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:3571",
"evidence": [
{
"database": "BioXpress",
"id": "P09210",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09210"
}
],
"disease": [
{
"disease_id": "DOID:3571",
"recommended_name": {
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "liver cancer",
"description": "A hepatobiliary system cancer that is located_in the liver."
},
"synonyms": [
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Ca liver - primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Resectable malignant neoplasm of Liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant hepato-biliary neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant tumor of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "non-resectable primary hepatic malignant neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary liver cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "resectable malignant neoplasm of the liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, not specified as primary or secondary",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "down",
"name": "Uterine cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:363",
"evidence": [
{
"database": "BioXpress",
"id": "P09210",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09210"
}
],
"disease": [
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "down",
"name": "Esophageal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:5041",
"evidence": [
{
"database": "BioXpress",
"id": "P09210",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09210"
}
],
"disease": [
{
"disease_id": "DOID:5041",
"recommended_name": {
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophageal cancer",
"description": "A gastrointestinal system cancer that is located_in the esophagus."
},
"synonyms": [
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophagus cancer",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Distal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Proximal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of the middle Third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": "A primary or metastatic malignant neoplasm involving the esophagus."
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "oesophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the middle third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of abdominal oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the middle third of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Aerodigestive tract cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Escc, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "gastric cardia adenocarcinoma, susceptibility to",
"description": ""
},
{
"id": "MIM:133239",
"resource": "MIM",
"url": "https://www.omim.org/entry/133239",
"name": "Esophageal cancer",
"description": "Esophageal cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Colorectal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:9256",
"evidence": [
{
"database": "BioXpress",
"id": "P09210",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09210"
}
],
"disease": [
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
}
]
}
],
"species": [
{
"name": "Homo sapiens",
"taxid": 9606,
"evidence": [
{
"database": "UniProtKB",
"id": "P09210",
"url": "https://www.uniprot.org/uniprot/P09210"
}
],
"common_name": "Human"
}
],
"gene": [
{
"name": "GSTA2",
"url": "https://www.uniprot.org/uniprot/P09210",
"locus": {
"chromosome": "6",
"start_pos": 52750087,
"end_pos": 52763475,
"strand": "+",
"evidence": [
{
"database": "Ensembl Gene",
"id": "ENSG00000244067",
"url": "https://www.ensembl.org/id/ENSG00000244067"
}
]
}
}
],
"crossref": [
{
"id": "ENSG00000244067",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000244067",
"database": "Bgee",
"categories": [
"Gene Expression"
]
},
{
"id": "2.5.1.18",
"url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.5.1.18&UniProtAcc=P09210",
"database": "BRENDA",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "cd03077",
"url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03077",
"database": "CDD",
"categories": [
"Protein Classification"
]
},
{
"id": "cd03208",
"url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03208",
"database": "CDD",
"categories": [
"Protein Classification"
]
},
{
"id": "CHEMBL2241",
"url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2241",
"database": "ChEMBL",
"categories": [
"Other"
]
},
{
"id": "GSTA2",
"url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=GSTA2",
"database": "GeneCards",
"categories": [
"Gene Annotation",
"Organism-specific"
]
},
{
"id": "2939",
"url": "https://www.ncbi.nlm.nih.gov/gene/2939",
"database": "GeneID",
"categories": [
"Genome Annotation"
]
},
{
"id": "4627",
"url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4627",
"database": "HGNC",
"categories": [
"Organism-specific"
]
},
{
"id": "P09210",
"url": "https://www.ebi.ac.uk/intact/interactors/id:P09210*",
"database": "IntAct",
"categories": [
"Other"
]
},
{
"id": "IPR003080",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR003080",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR004045",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR004045",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR004046",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR004046",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR010987",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR010987",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR036249",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR036249",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR036282",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR036282",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR040079",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR040079",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "hsa:2939",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2939",
"database": "KEGG Pathway",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "138360",
"url": "http://www.omim.org/entry/138360",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "NX_P09210",
"url": "https://www.nextprot.org/entry/NX_P09210",
"database": "neXtProt",
"categories": [
"Protein",
"Organism-specific"
]
},
{
"id": "P09210",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09210",
"database": "O-GlcNAc Database",
"categories": [
"Glycoproteomics"
]
},
{
"id": "EMIMQLP",
"url": "https://omabrowser.org/oma/group/EMIMQLP/",
"database": "OMA",
"categories": [
"Protein Classification"
]
},
{
"id": "3412208at2759",
"url": "http://www.orthodb.org/?query=3412208at2759",
"database": "OrthoDB",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR11571",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11571",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR11571:SF107",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11571:SF107",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "1AGS",
"url": "https://www.rcsb.org/structure/1AGS",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2VCT",
"url": "https://www.rcsb.org/structure/2VCT",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2WJU",
"url": "https://www.rcsb.org/structure/2WJU",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4ACS",
"url": "https://www.rcsb.org/structure/4ACS",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "PF00043",
"url": "http://pfam.xfam.org/family/PF00043",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "PF02798",
"url": "http://pfam.xfam.org/family/PF02798",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "P09210",
"url": "https://pharos.nih.gov/targets/P09210",
"database": "PHAROS",
"categories": [
"Organism-specific"
]
},
{
"id": "PR_P09210",
"url": "http://purl.obolibrary.org/obo/PR_P09210",
"database": "PRO",
"categories": [
"Protein"
]
},
{
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-8950505",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8950505",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "NP_000837",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000837",
"database": "RefSeq",
"categories": [
"Protein"
]
},
{
"id": "16437",
"url": "https://www.rhea-db.org/rhea/16437",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "P09210",
"url": "https://www.uniprot.org/uniprot/P09210",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P09210-1",
"url": "https://www.uniprot.org/uniprot/P09210-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
}
],
"sequence": {
"sequence": "MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFSQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF",
"length": 222,
"header": "sp|P09210-1|GSTA2_HUMAN Isoform 1 of Glutathione S-transferase A2 OS=Homo sapiens OX=9606 GN=GSTA2 PE=1 SV=4 CANONICAL=P09210-1"
},
"isoforms": [
{
"isoform_ac": "P09210-1",
"url": "",
"sequence": {
"sequence": "MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFSQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF",
"length": 222,
"header": "sp|P09210-1|GSTA2_HUMAN Isoform 1 of Glutathione S-transferase A2 OS=Homo sapiens OX=9606 GN=GSTA2 PE=1 SV=4 CANONICAL=P09210-1"
},
"locus": {
"chromosome": "6",
"start_pos": 52757947,
"end_pos": 52750580,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000493422.3",
"url": "https://www.ensembl.org/id/ENST00000493422.3"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000420168.1",
"url": "https://www.ensembl.org/id/ENSP00000420168.1"
}
]
}
}
],
"glycosylation": [
{
"glytoucan_ac": "G49108TO",
"type": "O-linked",
"subtype": "O-GlcNAcylation",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "O-GlcNAcylation",
"evidence": [
{
"id": "P09210",
"database": "O-GlcNAc Database",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09210"
},
{
"id": "26374642",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/26374642"
}
]
}
],
"phosphorylation": [],
"glycation": [],
"keywords": [
"enzyme",
"glycoprotein",
"glycoprotein_reported_with_glycan"
],
"publication": [
{
"title": "Human glutathione transferase A4-4 crystal structures and mutagenesis reveal the basis of high catalytic efficiency with toxic lipid peroxidation products.",
"journal": "Journal of molecular biology",
"date": "1999",
"authors": "Bruns CM, Hubatsch I, Ridderstrom M, Mannervik B, Tainer JA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "10329152",
"url": "https://glygen.org/publication/PubMed/10329152"
}
]
},
{
"title": "An asparagine-phenylalanine substitution accounts for catalytic differences between hGSTM3-3 and other human class mu glutathione S-transferases.",
"journal": "Biochemistry",
"date": "1999",
"authors": "Patskovsky YV, Patskovska LN, Listowsky I",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "10587441",
"url": "https://glygen.org/publication/PubMed/10587441"
}
]
},
{
"title": "Identification, characterization, and crystal structure of the Omega class glutathione transferases.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Board PG, Coggan M, Chelvanayagam G, Easteal S, Jermiin LS, Schulte GK, Danley DE, Hoth LR, Griffor MC, Kamath AV, Rosner MH, Chrunyk BA, Perregaux DE, Gabel CA, Geoghegan KF, Pandit J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "10783391",
"url": "https://glygen.org/publication/PubMed/10783391"
}
]
},
{
"title": "Multidrug-resistance protein 5 is a multispecific organic anion transporter able to transport nucleotide analogs.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2000",
"authors": "Wijnholds J, Mol CA, van Deemter L, de Haas M, Scheffer GL, Baas F, Beijnen JH, Scheper RJ, Hatse S, De Clercq E, Balzarini J, Borst P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "10840050",
"url": "https://glygen.org/publication/PubMed/10840050"
}
]
},
{
"title": "Crystal structure of maleylacetoacetate isomerase/glutathione transferase zeta reveals the molecular basis for its remarkable catalytic promiscuity.",
"journal": "Biochemistry",
"date": "2001",
"authors": "Polekhina G, Board PG, Blackburn AC, Parker MW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "11327815",
"url": "https://glygen.org/publication/PubMed/11327815"
}
]
},
{
"title": "Polymorphism of human alpha class glutathione transferases.",
"journal": "Pharmacogenetics",
"date": "2001",
"authors": "Tetlow N, Liu D, Board P",
"evidence": [
{
"database": "UniProtKB",
"id": "P09210",
"url": "https://www.uniprot.org/uniprot/P09210"
}
],
"reference": [
{
"type": "PubMed",
"id": "11668220",
"url": "https://glygen.org/publication/PubMed/11668220"
}
]
},
{
"title": "The 3-D structure of microsomal glutathione transferase 1 at 6 A resolution as determined by electron crystallography of p22(1)2(1) crystals.",
"journal": "Biochimica et biophysica acta",
"date": "2002",
"authors": "Holm PJ, Morgenstern R, Hebert H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "11904223",
"url": "https://glygen.org/publication/PubMed/11904223"
}
]
},
{
"title": "The human glutathione transferase alpha locus: genomic organization of the gene cluster and functional characterization of the genetic polymorphism in the hGSTA1 promoter.",
"journal": "Pharmacogenetics",
"date": "2002",
"authors": "Morel F, Rauch C, Coles B, Le Ferrec E, Guillouzo A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "12042665",
"url": "https://glygen.org/publication/PubMed/12042665"
}
]
},
{
"title": "1.3-A resolution structure of human glutathione S-transferase with S-hexyl glutathione bound reveals possible extended ligandin binding site.",
"journal": "Proteins",
"date": "2002",
"authors": "Le Trong I, Stenkamp RE, Ibarra C, Atkins WM, Adman ET",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "12211029",
"url": "https://glygen.org/publication/PubMed/12211029"
}
]
},
{
"title": "Thiopurine metabolism and identification of the thiopurine metabolites transported by MRP4 and MRP5 overexpressed in human embryonic kidney cells.",
"journal": "Molecular pharmacology",
"date": "2002",
"authors": "Wielinga PR, Reid G, Challa EE, van der Heijden I, van Deemter L, de Haas M, Mol C, Kuil AJ, Groeneveld E, Schuetz JD, Brouwer C, De Abreu RA, Wijnholds J, Beijnen JH, Borst P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "12435799",
"url": "https://glygen.org/publication/PubMed/12435799"
}
]
},
{
"title": "Mechanism of metal activation of human hematopoietic prostaglandin D synthase.",
"journal": "Nature structural biology",
"date": "2003",
"authors": "Inoue T, Irikura D, Okazaki N, Kinugasa S, Matsumura H, Uodome N, Yamamoto M, Kumasaka T, Miyano M, Kai Y, Urade Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "12627223",
"url": "https://glygen.org/publication/PubMed/12627223"
}
]
},
{
"title": "CD28-dependent Rac1 activation is the molecular target of azathioprine in primary human CD4+ T lymphocytes.",
"journal": "The Journal of clinical investigation",
"date": "2003",
"authors": "Tiede I, Fritz G, Strand S, Poppe D, Dvorsky R, Strand D, Lehr HA, Wirtz S, Becker C, Atreya R, Mudter J, Hildner K, Bartsch B, Holtmann M, Blumberg R, Walczak H, Iven H, Galle PR, Ahmadian MR, Neurath MF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "12697733",
"url": "https://glygen.org/publication/PubMed/12697733"
}
]
},
{
"title": "Isolation and characterization of the human glutathione S-transferase A2 subunit gene.",
"journal": "Arch. Biochem. Biophys.",
"date": "1992",
"authors": "R\u00f6hrdanz E, Nguyen T, Pickett C B",
"evidence": [
{
"database": "UniProtKB",
"id": "P09210",
"url": "https://www.uniprot.org/uniprot/P09210"
}
],
"reference": [
{
"type": "PubMed",
"id": "1329668",
"url": "https://glygen.org/publication/PubMed/1329668"
}
]
},
{
"title": "Gene and protein characterization of the human glutathione S-transferase kappa and evidence for a peroxisomal localization.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Morel F, Rauch C, Petit E, Piton A, Theret N, Coles B, Guillouzo A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "14742434",
"url": "https://glygen.org/publication/PubMed/14742434"
}
]
},
{
"title": "Cloning, sequencing and characterization of the human alpha glutathione S-transferase gene corresponding to the cDNA clone pGTH2.",
"journal": "Biochem. J.",
"date": "1992",
"authors": "Klone A, Hussnatter R, Sies H",
"evidence": [
{
"database": "UniProtKB",
"id": "P09210",
"url": "https://www.uniprot.org/uniprot/P09210"
}
],
"reference": [
{
"type": "PubMed",
"id": "1497629",
"url": "https://glygen.org/publication/PubMed/1497629"
}
]
},
{
"title": "Cellular export of drugs and signaling molecules by the ATP-binding cassette transporters MRP4 (ABCC4) and MRP5 (ABCC5).",
"journal": "Drug metabolism reviews",
"date": "2005",
"authors": "Ritter CA, Jedlitschky G, Meyer zu Schwabedissen H, Grube M, Kock K, Kroemer HK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "15747503",
"url": "https://glygen.org/publication/PubMed/15747503"
}
]
},
{
"title": "Recognition and activation of Rho GTPases by Vav1 and Vav2 guanine nucleotide exchange factors.",
"journal": "Biochemistry",
"date": "2005",
"authors": "Heo J, Thapar R, Campbell SL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "15850391",
"url": "https://glygen.org/publication/PubMed/15850391"
}
]
},
{
"title": "Proteome profiling of interleukin-12 treated human T helper cells.",
"journal": "Proteomics",
"date": "2005",
"authors": "Rosengren AT, Nyman TA, Lahesmaa R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8950505",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8950505"
}
],
"reference": [
{
"type": "PubMed",
"id": "16038020",
"url": "https://glygen.org/publication/PubMed/16038020"
}
]
},
{
"title": "Thioredoxin-like domain of human kappa class glutathione transferase reveals sequence homology and structure similarity to the theta class enzyme.",
"journal": "Protein science : a publication of the Protein Society",
"date": "2005",
"authors": "Li J, Xia Z, Ding J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "16081649",
"url": "https://glygen.org/publication/PubMed/16081649"
}
]
},
{
"title": "Structural basis of the suppressed catalytic activity of wild-type human glutathione transferase T1-1 compared to its W234R mutant.",
"journal": "Journal of molecular biology",
"date": "2006",
"authors": "Tars K, Larsson AK, Shokeer A, Olin B, Mannervik B, Kleywegt GJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "16298388",
"url": "https://glygen.org/publication/PubMed/16298388"
}
]
},
{
"title": "Involvement of the concentrative nucleoside transporter 3 and equilibrative nucleoside transporter 2 in the resistance of T-lymphoblastic cell lines to thiopurines.",
"journal": "Biochemical and biophysical research communications",
"date": "2006",
"authors": "Fotoohi AK, Lindqvist M, Peterson C, Albertioni F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "16530731",
"url": "https://glygen.org/publication/PubMed/16530731"
}
]
},
{
"title": "Transition state model and mechanism of nucleophilic aromatic substitution reactions catalyzed by human glutathione S-transferase M1a-1a.",
"journal": "Biochemistry",
"date": "2006",
"authors": "Patskovsky Y, Patskovska L, Almo SC, Listowsky I",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "16548513",
"url": "https://glygen.org/publication/PubMed/16548513"
}
]
},
{
"title": "Divergent activities of human glutathione transferases in the bioactivation of azathioprine.",
"journal": "Molecular pharmacology",
"date": "2006",
"authors": "Eklund BI, Moberg M, Bergquist J, Mannervik B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "16717136",
"url": "https://glygen.org/publication/PubMed/16717136"
}
]
},
{
"title": "Human xanthine oxidase changes its substrate specificity to aldehyde oxidase type upon mutation of amino acid residues in the active site: roles of active site residues in binding and activation of purine substrate.",
"journal": "Journal of biochemistry",
"date": "2007",
"authors": "Yamaguchi Y, Matsumura T, Ichida K, Okamoto K, Nishino T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "17301077",
"url": "https://glygen.org/publication/PubMed/17301077"
}
]
},
{
"title": "Foxp3 controls regulatory T-cell function by interacting with AML1/Runx1.",
"journal": "Nature",
"date": "2007",
"authors": "Ono M, Yaguchi H, Ohkura N, Kitabayashi I, Nagamura Y, Nomura T, Miyachi Y, Tsukada T, Sakaguchi S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-8950505",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8950505"
}
],
"reference": [
{
"type": "PubMed",
"id": "17377532",
"url": "https://glygen.org/publication/PubMed/17377532"
}
]
},
{
"title": "Up-regulation of MRP4 and down-regulation of influx transporters in human leukemic cells with acquired resistance to 6-mercaptopurine.",
"journal": "Leukemia research",
"date": "2008",
"authors": "Peng XX, Shi Z, Damaraju VL, Huang XC, Kruh GD, Wu HC, Zhou Y, Tiwari A, Fu L, Cass CE, Chen ZS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "17996297",
"url": "https://glygen.org/publication/PubMed/17996297"
}
]
},
{
"title": "Reassessment of the interactions of guanylate kinase and 6-thioguanosine 5'-phosphate.",
"journal": "Biochemical pharmacology",
"date": "1977",
"authors": "Miller RL, Adamczyk DL, Spector T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "197968",
"url": "https://glygen.org/publication/PubMed/197968"
}
]
},
{
"title": "Structural basis for featuring of steroid isomerase activity in alpha class glutathione transferases.",
"journal": "J. Mol. Biol.",
"date": "2010",
"authors": "Tars K, Olin B, Mannervik B",
"evidence": [
{
"database": "UniProtKB",
"id": "P09210",
"url": "https://www.uniprot.org/uniprot/P09210"
},
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "20083122",
"url": "https://glygen.org/publication/PubMed/20083122"
}
]
},
{
"title": "Substrate specificity combined with stereopromiscuity in glutathione transferase A4-4-dependent metabolism of 4-hydroxynonenal.",
"journal": "Biochemistry",
"date": "2010",
"authors": "Balogh LM, Le Trong I, Kripps KA, Shireman LM, Stenkamp RE, Zhang W, Mannervik B, Atkins WM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "20085333",
"url": "https://glygen.org/publication/PubMed/20085333"
}
]
},
{
"title": "Determination of 6-thioguanosine diphosphate and triphosphate and nucleoside diphosphate kinase activity in erythrocytes: novel targets for thiopurine therapy?",
"journal": "Therapeutic drug monitoring",
"date": "2010",
"authors": "Karner S, Shi S, Fischer C, Schaeffeler E, Neurath MF, Herrlinger KR, Hofmann U, Schwab M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "20216118",
"url": "https://glygen.org/publication/PubMed/20216118"
}
]
},
{
"title": "Novel folding and stability defects cause a deficiency of human glutathione transferase omega 1.",
"journal": "The Journal of biological chemistry",
"date": "2011",
"authors": "Zhou H, Brock J, Casarotto MG, Oakley AJ, Board PG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "21106529",
"url": "https://glygen.org/publication/PubMed/21106529"
}
]
},
{
"title": "Guanylate kinases from human erythrocytes, hog brain, and rat liver.",
"journal": "Methods in enzymology",
"date": "1978",
"authors": "Agarwal KC, Miech RP, Parks RE Jr",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "211390",
"url": "https://glygen.org/publication/PubMed/211390"
}
]
},
{
"title": "Glutathione-S-transferase P1 is a critical regulator of Cdk5 kinase activity.",
"journal": "Journal of neurochemistry",
"date": "2011",
"authors": "Sun KH, Chang KH, Clawson S, Ghosh S, Mirzaei H, Regnier F, Shah K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "21668448",
"url": "https://glygen.org/publication/PubMed/21668448"
}
]
},
{
"title": "The pattern of gene expression and gene dose profiles of 6-Mercaptopurine- and 6-Thioguanine-resistant human leukemia cells.",
"journal": "Biochemical and biophysical research communications",
"date": "2011",
"authors": "Karim H, Hashemi J, Larsson C, Moshfegh A, Fotoohi AK, Albertioni F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "21723252",
"url": "https://glygen.org/publication/PubMed/21723252"
}
]
},
{
"title": "Structure-based redesign of GST A2-2 for enhanced catalytic efficiency with azathioprine.",
"journal": "Chemistry & biology",
"date": "2012",
"authors": "Zhang W, Moden O, Tars K, Mannervik B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "22444596",
"url": "https://glygen.org/publication/PubMed/22444596"
}
]
},
{
"title": "Structural insights into the dehydroascorbate reductase activity of human omega-class glutathione transferases.",
"journal": "Journal of molecular biology",
"date": "2012",
"authors": "Zhou H, Brock J, Liu D, Board PG, Oakley AJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "22522127",
"url": "https://glygen.org/publication/PubMed/22522127"
}
]
},
{
"title": "New insight into the molecular switch mechanism of human Rho family proteins: shifting a paradigm.",
"journal": "Biological chemistry",
"date": "2013",
"authors": "Jaiswal M, Fansa EK, Dvorsky R, Ahmadian MR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "23096567",
"url": "https://glygen.org/publication/PubMed/23096567"
}
]
},
{
"title": "The Role of Human Aldo-Keto Reductases in the Metabolic Activation and Detoxication of Polycyclic Aromatic Hydrocarbons: Interconversion of PAH Catechols and PAH o-Quinones.",
"journal": "Frontiers in pharmacology",
"date": "2012",
"authors": "Zhang L, Jin Y, Huang M, Penning TM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "23162467",
"url": "https://glygen.org/publication/PubMed/23162467"
}
]
},
{
"title": "Substrate specificity and oligomerization of human GMP synthetase.",
"journal": "Journal of molecular biology",
"date": "2013",
"authors": "Welin M, Lehtio L, Johansson A, Flodin S, Nyman T, Tresaugues L, Hammarstrom M, Graslund S, Nordlund P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "23816837",
"url": "https://glygen.org/publication/PubMed/23816837"
}
]
},
{
"title": "Glutathione transferase-A2 S112T polymorphism predicts survival, transplant-related mortality, busulfan and bilirubin blood levels after allogeneic stem cell transplantation.",
"journal": "Haematologica",
"date": "2014",
"authors": "Bonifazi F, Storci G, Bandini G, Marasco E, Dan E, Zani E, Albani F, Bertoni S, Bontadini A, De Carolis S, Sapienza MR, Rizzi S, Motta MR, Ferioli M, Garagnani P, Cavo M, Mantovani V, Bonafe M",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000837",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000837"
}
],
"reference": [
{
"type": "PubMed",
"id": "24056816",
"url": "https://glygen.org/publication/PubMed/24056816"
}
]
},
{
"title": "In vitro oxidative metabolism of 6-mercaptopurine in human liver: insights into the role of the molybdoflavoenzymes aldehyde oxidase, xanthine oxidase, and xanthine dehydrogenase.",
"journal": "Drug metabolism and disposition: the biological fate of chemicals",
"date": "2014",
"authors": "Choughule KV, Barnaba C, Joswig-Jones CA, Jones JP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "24824603",
"url": "https://glygen.org/publication/PubMed/24824603"
}
]
},
{
"title": "Glutathione transferases in the bioactivation of azathioprine.",
"journal": "Advances in cancer research",
"date": "2014",
"authors": "Moden O, Mannervik B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "24974183",
"url": "https://glygen.org/publication/PubMed/24974183"
}
]
},
{
"title": "Evidence that glutathione S-transferases B1B1 and B2B2 are the products of separate genes and that their expression in human liver is subject to inter-individual variation. Molecular relationships between the B1 and B2 subunits and other alpha class glutathione S-transferases.",
"journal": "Biochem. J.",
"date": "1989",
"authors": "Hayes JD, Kerr LA, Cronshaw AD",
"evidence": [
{
"database": "UniProtKB",
"id": "P09210",
"url": "https://www.uniprot.org/uniprot/P09210"
}
],
"reference": [
{
"type": "PubMed",
"id": "2604726",
"url": "https://glygen.org/publication/PubMed/2604726"
}
]
},
{
"title": "Crystal structure, biochemical and cellular activities demonstrate separate functions of MTH1 and MTH2.",
"journal": "Nature communications",
"date": "2015",
"authors": "Carter M, Jemth AS, Hagenkort A, Page BD, Gustafsson R, Griese JJ, Gad H, Valerie NC, Desroses M, Bostrom J, Warpman Berglund U, Helleday T, Stenmark P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "26238318",
"url": "https://glygen.org/publication/PubMed/26238318"
}
]
},
{
"title": "Proteomic analysis of O-GlcNAcylated proteins in invasive ductal breast carcinomas with and without lymph node metastasis.",
"journal": "Amino acids",
"date": "2016",
"authors": "Jiang K, Gao Y, Hou W, Tian F, Ying W, Li L, Bai B, Hou G, Wang PG, Zhang L",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P09210",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P09210"
}
],
"reference": [
{
"type": "PubMed",
"id": "26374642",
"url": "https://glygen.org/publication/PubMed/26374642"
}
]
},
{
"title": "The roles of human MTH1, MTH2 and MTH3 proteins in maintaining genome stability under oxidative stress.",
"journal": "Mutation research",
"date": "2018",
"authors": "Hashiguchi K, Hayashi M, Sekiguchi M, Umezu K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "29482072",
"url": "https://glygen.org/publication/PubMed/29482072"
}
]
},
{
"title": "The basic glutathione S-transferases from human livers are products of separate genes.",
"journal": "Biochem. Biophys. Res. Commun.",
"date": "1987",
"authors": "Rhoads D M, Zarlengo R P, Tu C P",
"evidence": [
{
"database": "UniProtKB",
"id": "P09210",
"url": "https://www.uniprot.org/uniprot/P09210"
}
],
"reference": [
{
"type": "PubMed",
"id": "3036131",
"url": "https://glygen.org/publication/PubMed/3036131"
}
]
},
{
"title": "Azathioprine Biotransformation in Young Patients with Inflammatory Bowel Disease: Contribution of Glutathione-S Transferase M1 and A1 Variants.",
"journal": "Genes",
"date": "2019",
"authors": "Lucafo M, Stocco G, Martelossi S, Favretto D, Franca R, Malusa N, Lora A, Bramuzzo M, Naviglio S, Cecchin E, Toffoli G, Ventura A, Decorti G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "30987408",
"url": "https://glygen.org/publication/PubMed/30987408"
}
]
},
{
"title": "Gene expression of rat and human microsomal glutathione S-transferases.",
"journal": "The Journal of biological chemistry",
"date": "1988",
"authors": "DeJong JL, Morgenstern R, Jornvall H, DePierre JW, Tu CP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "3372534",
"url": "https://glygen.org/publication/PubMed/3372534"
}
]
},
{
"title": "Identity of the polymorphisms for esterase D and S-formylglutathione hydrolase in red blood cells.",
"journal": "Human genetics",
"date": "1986",
"authors": "Eiberg H, Mohr J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "3770744",
"url": "https://glygen.org/publication/PubMed/3770744"
}
]
},
{
"title": "Esterase D: a new human polymorphism.",
"journal": "Annals of human genetics",
"date": "1973",
"authors": "Hopkinson DA, Mestriner MA, Cortner J, Harris H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "4768551",
"url": "https://glygen.org/publication/PubMed/4768551"
}
]
},
{
"title": "Human hypoxanthine phosphoribosyltransferase. I. Purification, properties, and specificity.",
"journal": "The Journal of biological chemistry",
"date": "1969",
"authors": "Krenitsky TA, Papaioannou R, Elion GB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "5767308",
"url": "https://glygen.org/publication/PubMed/5767308"
}
]
},
{
"title": "Human erythrocyte thiopurine methyltransferase: radiochemical microassay and biochemical properties.",
"journal": "Clinica chimica acta; international journal of clinical chemistry",
"date": "1978",
"authors": "Weinshilboum RM, Raymond FA, Pazmino PA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "657528",
"url": "https://glygen.org/publication/PubMed/657528"
}
]
},
{
"title": "Quantitation of plasma azathioprine and 6-mercaptopurine levels in renal transplant patients.",
"journal": "Transplantation",
"date": "1980",
"authors": "Lin SN, Jessup K, Floyd M, Wang TP, van Buren CT, Caprioli RM, Kahan BD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "6989049",
"url": "https://glygen.org/publication/PubMed/6989049"
}
]
},
{
"title": "A surface mutant (G82R) of a human alpha-glutathione S-transferase shows decreased thermal stability and a new mode of molecular association in the crystal.",
"journal": "Proteins",
"date": "1994",
"authors": "Zeng K, Rose J P, Chen H C, Strickland C L, Tu C P, Wang B C",
"evidence": [
{
"database": "UniProtKB",
"id": "P09210",
"url": "https://www.uniprot.org/uniprot/P09210"
}
],
"reference": [
{
"type": "PubMed",
"id": "7892174",
"url": "https://glygen.org/publication/PubMed/7892174"
}
]
},
{
"title": "Crystal structure of human class mu glutathione transferase GSTM2-2. Effects of lattice packing on conformational heterogeneity.",
"journal": "Journal of molecular biology",
"date": "1994",
"authors": "Raghunathan S, Chandross RJ, Kretsinger RH, Allison TJ, Penington CJ, Rule GS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "8182750",
"url": "https://glygen.org/publication/PubMed/8182750"
}
]
},
{
"title": "A comparison of the enzymatic and physicochemical properties of human glutathione transferase M4-4 and three other human Mu class enzymes.",
"journal": "Archives of biochemistry and biophysics",
"date": "1994",
"authors": "Comstock KE, Widersten M, Hao XY, Henner WD, Mannervik B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "8203914",
"url": "https://glygen.org/publication/PubMed/8203914"
}
]
},
{
"title": "Cloning and expression of cDNA for a human enzyme that hydrolyzes 8-oxo-dGTP, a mutagenic substrate for DNA synthesis.",
"journal": "The Journal of biological chemistry",
"date": "1993",
"authors": "Sakumi K, Furuichi M, Tsuzuki T, Kakuma T, Kawabata S, Maki H, Sekiguchi M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "8226881",
"url": "https://glygen.org/publication/PubMed/8226881"
}
]
},
{
"title": "Structure determination and refinement of human alpha class glutathione transferase A1-1, and a comparison with the Mu and Pi class enzymes.",
"journal": "Journal of molecular biology",
"date": "1993",
"authors": "Sinning I, Kleywegt GJ, Cowan SW, Reinemer P, Dirr HW, Huber R, Gilliland GL, Armstrong RN, Ji X, Board PG, et al.",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "8331657",
"url": "https://glygen.org/publication/PubMed/8331657"
}
]
},
{
"title": "Characterization of two novel subunits of the alpha-class glutathione S-transferases of human liver.",
"journal": "Biochim. Biophys. Acta",
"date": "1993",
"authors": "Ahmad H, Singhal SS, Saxena M, Awasthi YC",
"evidence": [
{
"database": "UniProtKB",
"id": "P09210",
"url": "https://www.uniprot.org/uniprot/P09210"
},
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "8431482",
"url": "https://glygen.org/publication/PubMed/8431482"
}
]
},
{
"title": "Cloning and expression in vitro of human xanthine dehydrogenase/oxidase.",
"journal": "The Biochemical journal",
"date": "1996",
"authors": "Saksela M, Raivio KO",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "8670112",
"url": "https://glygen.org/publication/PubMed/8670112"
}
]
},
{
"title": "Identification and characterization of a novel human microsomal glutathione S-transferase with leukotriene C4 synthase activity and significant sequence identity to 5-lipoxygenase-activating protein and leukotriene C4 synthase.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Jakobsson PJ, Mancini JA, Ford-Hutchinson AW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "8703034",
"url": "https://glygen.org/publication/PubMed/8703034"
}
]
},
{
"title": "Structural organization of the human microsomal glutathione S-transferase gene (GST12).",
"journal": "Genomics",
"date": "1996",
"authors": "Kelner MJ, Stokely MN, Stovall NE, Montoya MA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "8812420",
"url": "https://glygen.org/publication/PubMed/8812420"
}
]
},
{
"title": "Tyrosine phosphorylation of the vav proto-oncogene product links FcepsilonRI to the Rac1-JNK pathway.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Teramoto H, Salem P, Robbins KC, Bustelo XR, Gutkind JS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "9099726",
"url": "https://glygen.org/publication/PubMed/9099726"
}
]
},
{
"title": "Kinetic mechanism of human hypoxanthine-guanine phosphoribosyltransferase: rapid phosphoribosyl transfer chemistry.",
"journal": "Biochemistry",
"date": "1997",
"authors": "Xu Y, Eads J, Sacchettini JC, Grubmeyer C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "9132023",
"url": "https://glygen.org/publication/PubMed/9132023"
}
]
},
{
"title": "Identification and characterization of a novel microsomal enzyme with glutathione-dependent transferase and peroxidase activities.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Jakobsson PJ, Mancini JA, Riendeau D, Ford-Hutchinson AW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "9278457",
"url": "https://glygen.org/publication/PubMed/9278457"
}
]
},
{
"title": "Effect of 6-mercaptopurine on inosinic acid dehydrogenase in cultured human fibroblasts.",
"journal": "Biochemical pharmacology",
"date": "1976",
"authors": "Leyva A, Holmes EW Jr, kelley WN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "942489",
"url": "https://glygen.org/publication/PubMed/942489"
}
]
},
{
"title": "Human theta class glutathione transferase: the crystal structure reveals a sulfate-binding pocket within a buried active site.",
"journal": "Structure (London, England : 1993)",
"date": "1998",
"authors": "Rossjohn J, McKinstry WJ, Oakley AJ, Verger D, Flanagan J, Chelvanayagam G, Tan KL, Board PG, Parker MW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "9551553",
"url": "https://glygen.org/publication/PubMed/9551553"
}
]
},
{
"title": "Purification and characterization of a novel alpha-class glutathione transferase from human liver.",
"journal": "The international journal of biochemistry & cell biology",
"date": "1998",
"authors": "Pastore A, Lo Bello M, Aureli G, Federici G, Ricci G, Di Ilio C, Petruzzelli R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "9839448",
"url": "https://glygen.org/publication/PubMed/9839448"
}
]
}
],
"pathway": [
{
"id": "hsa:2939",
"name": "",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2939",
"resource": "KEGG Pathway"
},
{
"id": "R-HSA-156590",
"name": "Glutathione conjugation",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590",
"resource": "Reactome",
"description": "Glutathione conjugation"
},
{
"id": "R-HSA-8950505",
"name": "Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8950505",
"resource": "Reactome",
"description": "Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation"
},
{
"id": "R-HSA-9748787",
"name": "Azathioprine ADME",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787",
"resource": "Reactome",
"description": "Azathioprine ADME"
}
],
"orthologs": [
{
"uniprot_canonical_ac": "E9Q6L7-1",
"protein_name": "Glutathione S-transferase",
"gene_name": "Gsta5",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MAGKPVLHHFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLVQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLLICPPDQKEAKTALAKDRTKNRYLPAFEKVLKGHGQDYLVGNRLTRVDVHLLELLLYVEEFDASLLTPFPLLKAFKSRISSLPNVKKFLHPGSQRKPPLDAKQIEEARKIFKF",
"length": 222
},
"evidence": [
{
"id": "45930117",
"url": "http://www.informatics.jax.org/homology/45930117",
"database": "MGI"
}
],
"common_name": "Mouse"
},
{
"uniprot_canonical_ac": "P00502-1",
"protein_name": "Glutathione S-transferase alpha-1",
"gene_name": "Gsta1",
"tax_id": 10116,
"organism": "Rattus norvegicus",
"sequence": {
"sequence": "MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF",
"length": 222
},
"evidence": [
{
"id": "45930117",
"url": "http://www.informatics.jax.org/homology/45930117",
"database": "MGI"
},
{
"id": "45930119",
"url": "http://www.informatics.jax.org/homology/45930119",
"database": "MGI"
},
{
"id": "45930118",
"url": "http://www.informatics.jax.org/homology/45930118",
"database": "MGI"
},
{
"id": "45930121",
"url": "http://www.informatics.jax.org/homology/45930121",
"database": "MGI"
}
],
"common_name": "Rat"
},
{
"uniprot_canonical_ac": "P04903-1",
"protein_name": "Glutathione S-transferase alpha-2",
"gene_name": "Gsta2",
"tax_id": 10116,
"organism": "Rattus norvegicus",
"sequence": {
"sequence": "MSGKPVLHYFNARGRMECIRWLLAAAGVEFEEKLIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIIQLVICPPDQREAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKPAMDAKQIEEARKVFKF",
"length": 222
},
"evidence": [
{
"id": "45930117",
"url": "http://www.informatics.jax.org/homology/45930117",
"database": "MGI"
},
{
"id": "45930119",
"url": "http://www.informatics.jax.org/homology/45930119",
"database": "MGI"
},
{
"id": "45930118",
"url": "http://www.informatics.jax.org/homology/45930118",
"database": "MGI"
},
{
"id": "45930121",
"url": "http://www.informatics.jax.org/homology/45930121",
"database": "MGI"
}
],
"common_name": "Rat"
},
{
"uniprot_canonical_ac": "P04904-1",
"protein_name": "Glutathione S-transferase alpha-3",
"gene_name": "Gsta3",
"tax_id": 10116,
"organism": "Rattus norvegicus",
"sequence": {
"sequence": "MPGKPVLHYFDGRGRMEPIRWLLAAAGVEFEEQFLKTRDDLARLRNDGSLMFQQVPMVEIDGMKLVQTRAILNYIATKYNLYGKDMKERALIDMYAEGVADLDEIVLHYPYIPPGEKEASLAKIKDKARNRYFPAFEKVLKSHGQDYLVGNRLSRADVYLVQVLYHVEELDPSALANFPLLKALRTRVSNLPTVKKFLQPGSQRKPLEDEKCVESAVKIFS",
"length": 221
},
"evidence": [
{
"id": "45930117",
"url": "http://www.informatics.jax.org/homology/45930117",
"database": "MGI"
},
{
"id": "45930119",
"url": "http://www.informatics.jax.org/homology/45930119",
"database": "MGI"
},
{
"id": "45930118",
"url": "http://www.informatics.jax.org/homology/45930118",
"database": "MGI"
},
{
"id": "45930121",
"url": "http://www.informatics.jax.org/homology/45930121",
"database": "MGI"
}
],
"common_name": "Rat"
},
{
"uniprot_canonical_ac": "P08263-1",
"protein_name": "Glutathione S-transferase A1",
"gene_name": "GSTA1",
"tax_id": 9606,
"organism": "Homo sapiens",
"sequence": {
"sequence": "MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAKLALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEEARKIFRF",
"length": 222
},
"evidence": [
{
"id": "45930117",
"url": "http://www.informatics.jax.org/homology/45930117",
"database": "MGI"
},
{
"id": "45930119",
"url": "http://www.informatics.jax.org/homology/45930119",
"database": "MGI"
},
{
"id": "45930118",
"url": "http://www.informatics.jax.org/homology/45930118",
"database": "MGI"
},
{
"id": "45930121",
"url": "http://www.informatics.jax.org/homology/45930121",
"database": "MGI"
}
],
"common_name": "Human"
},
{
"uniprot_canonical_ac": "P10648-1",
"protein_name": "Glutathione S-transferase A2",
"gene_name": "Gsta2",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MAGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLVQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIGQLVLCPPDQREAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDVHLLELLLYVEELDASLLTPFPLLKAFKSRISSLPNVKKFLHPGSQRKPPLDAKQIEEARKVFKF",
"length": 222
},
"evidence": [
{
"id": "45930119",
"url": "http://www.informatics.jax.org/homology/45930119",
"database": "MGI"
},
{
"id": "P09210",
"url": "https://omabrowser.org/oma/group/P09210/",
"database": "OMA"
}
],
"common_name": "Mouse"
},
{
"uniprot_canonical_ac": "P13745-1",
"protein_name": "Glutathione S-transferase A1",
"gene_name": "Gsta1",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MAGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLVLCPPDQREAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLEVLLYVEEFDASLLTPFPLLKAFKSRISSLPNVKKFLQPGSQRKPPMDAKQIQEARKAFKIQ",
"length": 223
},
"evidence": [
{
"id": "45930121",
"url": "http://www.informatics.jax.org/homology/45930121",
"database": "MGI"
}
],
"common_name": "Mouse"
},
{
"uniprot_canonical_ac": "Q16772-1",
"protein_name": "Glutathione S-transferase A3",
"gene_name": "GSTA3",
"tax_id": 9606,
"organism": "Homo sapiens",
"sequence": {
"sequence": "MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF",
"length": 222
},
"evidence": [
{
"id": "45930117",
"url": "http://www.informatics.jax.org/homology/45930117",
"database": "MGI"
},
{
"id": "45930119",
"url": "http://www.informatics.jax.org/homology/45930119",
"database": "MGI"
},
{
"id": "45930118",
"url": "http://www.informatics.jax.org/homology/45930118",
"database": "MGI"
},
{
"id": "45930121",
"url": "http://www.informatics.jax.org/homology/45930121",
"database": "MGI"
}
],
"common_name": "Human"
},
{
"uniprot_canonical_ac": "Q6P8Q0-1",
"protein_name": "Glutathione S-transferase",
"gene_name": "Gm3776",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MAGKPVLHHFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLVLCPPDQREAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLEVLLYVEEFDASLLTPFPLLKAFKSRISSLPNVKKFLQPGSQRKPPMDAKQIQEARKAFKIQ",
"length": 223
},
"evidence": [
{
"id": "45930118",
"url": "http://www.informatics.jax.org/homology/45930118",
"database": "MGI"
}
],
"common_name": "Mouse"
},
{
"uniprot_canonical_ac": "Q7RTV2-1",
"protein_name": "Glutathione S-transferase A5",
"gene_name": "GSTA5",
"tax_id": 9606,
"organism": "Homo sapiens",
"sequence": {
"sequence": "MAEKPKLHYSNARGSMESIRWLLAAAGVELEEKFLESAEDLDKLRNDGSLLFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDMKERALIDMYTEGIVDLTEMILLLLICQPEERDAKTALVKEKIKNRYFPAFEKVLKSHRQDYLVGNKLSWADIHLVELFYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSQRKPPMDEKSLEEARKIFRF",
"length": 222
},
"evidence": [
{
"id": "45930117",
"url": "http://www.informatics.jax.org/homology/45930117",
"database": "MGI"
},
{
"id": "45930119",
"url": "http://www.informatics.jax.org/homology/45930119",
"database": "MGI"
},
{
"id": "45930118",
"url": "http://www.informatics.jax.org/homology/45930118",
"database": "MGI"
},
{
"id": "45930121",
"url": "http://www.informatics.jax.org/homology/45930121",
"database": "MGI"
}
],
"common_name": "Human"
}
],
"go_annotation": {
"categories": [
{
"name": "Molecular Function",
"total": 1,
"go_terms": [
{
"name": "glutathione transferase activity",
"id": "GO:0004364",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004364",
"evidence": [
{
"database": "UniProtKB",
"id": "P09210",
"url": "https://www.uniprot.org/uniprot/P09210"
}
],
"pmid": ""
}
]
},
{
"name": "Cellular Component",
"total": 2,
"go_terms": [
{
"name": "cytosol",
"id": "GO:0005829",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829",
"evidence": [
{
"database": "UniProtKB",
"id": "P09210",
"url": "https://www.uniprot.org/uniprot/P09210"
}
],
"pmid": ""
},
{
"name": "extracellular exosome",
"id": "GO:0070062",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062",
"evidence": [
{
"database": "UniProtKB",
"id": "P09210",
"url": "https://www.uniprot.org/uniprot/P09210"
}
],
"pmid": ""
}
]
},
{
"name": "Biological Process",
"total": 3,
"go_terms": [
{
"name": "epithelial cell differentiation",
"id": "GO:0030855",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030855",
"evidence": [
{
"database": "UniProtKB",
"id": "P09210",
"url": "https://www.uniprot.org/uniprot/P09210"
}
],
"pmid": ""
},
{
"name": "xenobiotic metabolic process",
"id": "GO:0006805",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006805",
"evidence": [
{
"database": "UniProtKB",
"id": "P09210",
"url": "https://www.uniprot.org/uniprot/P09210"
}
],
"pmid": ""
},
{
"name": "glutathione metabolic process",
"id": "GO:0006749",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006749",
"evidence": [
{
"database": "UniProtKB",
"id": "P09210",
"url": "https://www.uniprot.org/uniprot/P09210"
}
],
"pmid": ""
}
]
}
]
},
"pro_annotation": [],
"site_annotation": [],
"ptm_annotation": [],
"interactions": [],
"reactions": [
{
"id": "16437",
"name": "",
"equation": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+)",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P04904-1",
"P46418-1",
"P24473-1",
"P30713-1",
"Q6AXY0-1",
"Q9QX69-1",
"O35543-1",
"Q9Z339-1",
"P08009-1",
"P14942-1",
"Q9Z1B2-1",
"Q6AXV9-1",
"Q5BK56-1",
"P00502-1",
"P04903-1",
"P04905-1",
"P04906-1",
"P57113-1",
"Q01579-1",
"P08010-1",
"P08011-1",
"Q4V8E6-1",
"A0A0G2K4Q5-1",
"F1LXL7-1",
"Q9Y2Q3-1",
"Q9H4Y5-1",
"P46439-1",
"Q03013-1",
"P78417-1",
"P08263-1",
"P0CG30-1",
"P09488-1",
"Q7RTV2-1",
"Q16772-1",
"P28161-1",
"P0CG29-1",
"O60760-1",
"P09211-1",
"P30711-1",
"P09210-1",
"O15217-1",
"O43813-1",
"P21266-1",
"P10620-1",
"O43708-1",
"Q99735-1",
"A0A1W2PR19-1",
"F6RWR5-1",
"Q9JHF7-1",
"E9Q6L7-1",
"Q9WVL0-1",
"O35660-1",
"P46425-1",
"P19639-1",
"P48774-1",
"Q9DCM2-1",
"Q99L20-1",
"O09131-1",
"P24472-1",
"P19157-1",
"Q61133-1",
"Q8K2Q2-1",
"Q80W21-1",
"O89112-1",
"P10648-1",
"P13745-1",
"P15626-1",
"P30115-1",
"P10649-1",
"Q64471-1",
"Q9D4P7-1",
"Q91VS7-1",
"Q6P8Q0-1",
"A2RST1-1",
"Q8R5I6-1",
"P17695-1",
"P25373-1",
"P36156-1",
"P40582-1",
"P48239-1",
"Q04806-1",
"Q12390-1",
"Q54GA9-1",
"Q54QV7-1",
"Q54VI4-1",
"Q55FF3-1",
"Q86AU1-1",
"Q556G3-1",
"Q9VG94-1",
"Q9VG96-1",
"Q7JYX0-1",
"P41043-1",
"P20432-1",
"Q9VG95-1",
"Q9VG98-1",
"Q9VG93-1",
"Q9VHD3-1",
"Q9VHD2-1"
],
"evidence": [
{
"id": "16437",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/16437"
}
]
},
{
"id": "R-HSA-176054",
"name": "GST dimers conjugate GSH with cytosolic substrates",
"equation": "",
"summary": "The glutathione S-transferases (GSTs) catalyze the nucleophilic attack by reduced glutathione (GSH) on nonpolar compounds that contain an electrophilic carbon, nitrogen, or sulphur atom. Their substrates include halogenonitrobenzenes, arene oxides, quinones, and alpha, beta-unsaturated carbonyls. Three major families of proteins are widely distributed in nature. Two of these, the cytosolic and mitochondrial GST, comprise soluble enzymes that are only distantly related whilst the third family comprises microsomal GST, referred to as membrane-associated proteins in eicosanoid and glutathione (MAPEG) metabolism.
At least 16 cytosolic GST subunits exist in human which are all in a dimeric form. Based on amino acid sequence similarities, seven classes of cytosolic GST are recognized in mammalian species; Alpha, Mu, Pi, Sigma, Theta, Omega, and Zeta (2\u20135). As well as being homodimers, the Alpha and Mu classes are also able to form heterodimers so a large number of isozymes are possible from all cytosolic GST subunits (Sinning et al. 1993, LeTrong et al. 2002, Ahmad et al. 1993, Pastore et al. 1998, Tars et al. 2010, Bruns et al. 1999, Balogh et al. 2010, Morel et al. 2002, Li et al. 2005, Patskovsky et al. 2006, Raghunathan et al. 1994, Patskovsky et al. 1999, Comstock et al. 1994, Board et al. 2000, Zhou et al. 2011, Zhou et al. 2012, Sun et al. 2011, Tars et al. 2006, Rossjohn et al. 1998, Polekhina et al. 2001, Inoue et al. 2003). Typical electrophilic substrates are chosen as examples for which the majority of the cytosolic GST isozymes act on.",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09210-1",
"Q16772-1",
"P0CG29-1",
"P78417-1",
"Q7RTV2-1",
"O60760-1",
"P46439-1",
"Q9H4Y5-1",
"P30711-1",
"P09211-1",
"O15217-1",
"P08263-1",
"P0CG30-1",
"P21266-1",
"O43708-1",
"P09488-1",
"P28161-1",
"Q03013-1"
],
"evidence": [
{
"id": "R-HSA-176054",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-176054"
}
]
},
{
"id": "R-HSA-8950586",
"name": "Expression of glutathione S-transferase alpha 2",
"equation": "",
"summary": "Experiments using human cord blood CD4(+) T cells show 22 protein spots and 20 protein spots, upregulated and downregulated proteins respectively, following Interleukin-12 stimulation (Rosengren et.al, 2005). Among the up-regulated proteins is :Glutathione S-transferase A2(GSTA2).",
"cellular_location": "extracellular exosome, nucleoplasm",
"input_participant_list": [
"R-HSA-8950534"
],
"output_participant_list": [
"R-HSA-8950276"
],
"enzyme_list": [
"P09210-1"
],
"evidence": [
{
"id": "R-HSA-8950586",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8950586"
}
]
},
{
"id": "R-HSA-9748996",
"name": "GST dimers cleave AZA to 6MP",
"equation": "",
"summary": "Azathioprine (AZA) was developed as a prodrug to 6-mercaptopurine (6MP) in order to counter the high first-pass metabolism of 6MP in the intestine. A nitroimidazol group was added to 6MP to create AZA. Human glutathione transferases (GSTs) A1-1, A2-2, and M1-1, all highly expressed in human liver, display high enzymatic activity towards AZA, cleaving it to release the antimetabolite 6-mercaptopurine (6MP) (Eklund et al. 2006, Moden & Mannervik 2014). After oral administration AZA is undetectable in blood, while 6MP appears after either oral or iv AZA administration (Lin et al. 1980). This is because, after ingestion, around 88% of AZA is converted to 6MP. The uncatalyzed reaction of AZA with glutathione is estimated to be <1% of the GST-catalyzed reaction. 6MP is released via a tetrahedral intermediate formed by nucleophilic attack of the glutathione thiolate (GS\u2212). The reaction is thought to be promoted by H-bonding or other polar interactions (Zhang et al. 2012). GSTs variants may be associated with AZA efficacy and pharmacokinetics (Lufaco et al. 2019).
",
"cellular_location": "cytosol",
"input_participant_list": [
"R-ALL-9748994"
],
"output_participant_list": [
"R-ALL-9748975"
],
"enzyme_list": [
"P09210-1",
"P08263-1",
"P09488-1"
],
"evidence": [
{
"id": "R-HSA-9748996",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748996"
}
]
}
],
"reaction_participants": [
{
"participant_id": "R-ALL-9748975",
"participant_name": "GS-nitroimidazole [cytosol]",
"crossref": [
{
"id": "180931",
"database": "ChEBI",
"url": ""
},
{
"id": "180931",
"database": "ChEBI",
"url": ""
},
{
"id": "180931",
"database": "ChEBI",
"url": ""
},
{
"id": "180931",
"database": "ChEBI",
"url": ""
},
{
"id": "180931",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9748994",
"participant_name": "AZA [cytosol]",
"crossref": [
{
"id": "7120",
"database": "Guide to Pharmacology",
"url": ""
},
{
"id": "PDBC00620",
"database": "PharmacoDB",
"url": ""
},
{
"id": "7120",
"database": "Guide to Pharmacology",
"url": ""
},
{
"id": "PDBC00620",
"database": "PharmacoDB",
"url": ""
},
{
"id": "7120",
"database": "Guide to Pharmacology",
"url": ""
},
{
"id": "PDBC00620",
"database": "PharmacoDB",
"url": ""
},
{
"id": "7120",
"database": "Guide to Pharmacology",
"url": ""
},
{
"id": "PDBC00620",
"database": "PharmacoDB",
"url": ""
},
{
"id": "PDBC00620",
"database": "PharmacoDB",
"url": ""
},
{
"id": "7120",
"database": "Guide to Pharmacology",
"url": ""
}
]
},
{
"participant_id": "R-HSA-8950276",
"participant_name": "GSTA2 [extracellular exosome]",
"crossref": [
{
"id": "2WJU",
"database": "PDB",
"url": ""
},
{
"id": "2VCT",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000493422",
"database": "Ensembl",
"url": ""
},
{
"id": "1AGS",
"database": "PDB",
"url": ""
},
{
"id": "XP_011512834.1",
"database": "RefSeq",
"url": ""
},
{
"id": "ENSP00000420168",
"database": "Ensembl",
"url": ""
},
{
"id": "GSTA2_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "P09210",
"database": "GeneCards",
"url": ""
},
{
"id": "ENSG00000244067-GSTA2",
"database": "HPA",
"url": ""
},
{
"id": "P09210",
"database": "UniProt",
"url": ""
},
{
"id": "4ACS",
"database": "PDB",
"url": ""
},
{
"id": "P09210",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "HMDBP00824",
"database": "HMDB Protein",
"url": ""
},
{
"id": "ENSG00000244067",
"database": "OpenTargets",
"url": ""
},
{
"id": "NP_000837.3",
"database": "RefSeq",
"url": ""
},
{
"id": "GSTA2_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "P09210",
"database": "PRO",
"url": ""
},
{
"id": "ENSG00000244067",
"database": "Ensembl",
"url": ""
},
{
"id": "P09210",
"database": "ZINC target",
"url": ""
}
]
},
{
"participant_id": "R-HSA-8950534",
"participant_name": "GSTA2 gene [nucleoplasm]",
"crossref": [
{
"id": "ENSG00000244067",
"database": "ENSEMBL",
"url": ""
}
]
}
],
"reaction_enzymes": [
{
"uniprot_ac": "A0A0G2K4Q5",
"gene_name": "Gstp3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "A0A0G2K4Q5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A0G2K4Q5"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "A0A0G2K4Q5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A0G2K4Q5"
}
]
}
]
},
{
"uniprot_ac": "A0A1W2PR19",
"gene_name": "GSTT4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "A0A1W2PR19",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A1W2PR19"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "A0A1W2PR19",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A1W2PR19"
}
]
}
]
},
{
"uniprot_ac": "A2RST1",
"gene_name": "Mgst2",
"activity": [
{
"ec_number": "1.11.1.-",
"activity": "",
"evidence": [
{
"id": "A2RST1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A2RST1"
}
]
},
{
"ec_number": "4.4.1.20",
"activity": "leukotriene C4 = glutathione + leukotriene A4.",
"evidence": [
{
"id": "A2RST1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A2RST1"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "A2RST1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A2RST1"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "A2RST1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A2RST1"
}
]
}
]
},
{
"uniprot_ac": "E9Q6L7",
"gene_name": "Gsta5",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "E9Q6L7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/E9Q6L7"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "E9Q6L7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/E9Q6L7"
}
]
}
]
},
{
"uniprot_ac": "F1LXL7",
"gene_name": "AC097845.1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "F1LXL7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1LXL7"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "F1LXL7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1LXL7"
}
]
}
]
},
{
"uniprot_ac": "F6RWR5",
"gene_name": "Gstp3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "F6RWR5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F6RWR5"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "F6RWR5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F6RWR5"
}
]
}
]
},
{
"uniprot_ac": "O09131",
"gene_name": "Gsto1",
"activity": [
{
"ec_number": "1.20.4.2",
"activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.",
"evidence": [
{
"id": "O09131",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O09131"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.",
"evidence": [
{
"id": "O09131",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O09131"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "O09131",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O09131"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "O09131",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O09131"
}
]
},
{
"ec_number": "1.20.4.2",
"activity": "",
"evidence": [
{
"id": "O09131",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O09131"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "",
"evidence": [
{
"id": "O09131",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O09131"
}
]
}
]
},
{
"uniprot_ac": "O15217",
"gene_name": "GSTA4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "O15217",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O15217"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "O15217",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O15217"
}
]
}
]
},
{
"uniprot_ac": "O35543",
"gene_name": "Hpgds",
"activity": [
{
"ec_number": "5.3.99.2",
"activity": "prostaglandin H2 = prostaglandin D2.",
"evidence": [
{
"id": "O35543",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O35543"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "O35543",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O35543"
}
]
},
{
"ec_number": "5.3.99.2",
"activity": "",
"evidence": [
{
"id": "O35543",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O35543"
}
]
}
]
},
{
"uniprot_ac": "O35660",
"gene_name": "Gstm6",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "O35660",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O35660"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "O35660",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O35660"
}
]
}
]
},
{
"uniprot_ac": "O43708",
"gene_name": "GSTZ1",
"activity": [
{
"ec_number": "5.2.1.2",
"activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.",
"evidence": [
{
"id": "O43708",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43708"
}
]
},
{
"ec_number": "5.2.1.2",
"activity": "",
"evidence": [
{
"id": "O43708",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43708"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "O43708",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43708"
}
]
}
]
},
{
"uniprot_ac": "O43813",
"gene_name": "LANCL1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "O43813",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43813"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "O43813",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43813"
}
]
}
]
},
{
"uniprot_ac": "O60760",
"gene_name": "HPGDS",
"activity": [
{
"ec_number": "5.3.99.2",
"activity": "prostaglandin H2 = prostaglandin D2.",
"evidence": [
{
"id": "O60760",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O60760"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "O60760",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O60760"
}
]
},
{
"ec_number": "5.3.99.2",
"activity": "",
"evidence": [
{
"id": "O60760",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O60760"
}
]
}
]
},
{
"uniprot_ac": "O89112",
"gene_name": "Lancl1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "O89112",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O89112"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "O89112",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O89112"
}
]
}
]
},
{
"uniprot_ac": "P00502",
"gene_name": "Gsta1",
"activity": [
{
"ec_number": "1.11.1.-",
"activity": "",
"evidence": [
{
"id": "P00502",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00502"
}
]
},
{
"ec_number": "5.3.3.-",
"activity": "",
"evidence": [
{
"id": "P00502",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00502"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P00502",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00502"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P00502",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00502"
}
]
}
]
},
{
"uniprot_ac": "P04903",
"gene_name": "Gsta2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P04903",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04903"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P04903",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04903"
}
]
}
]
},
{
"uniprot_ac": "P04904",
"gene_name": "Gsta3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P04904",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04904"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P04904",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04904"
}
]
}
]
},
{
"uniprot_ac": "P04905",
"gene_name": "Gstm1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P04905",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04905"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P04905",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04905"
}
]
}
]
},
{
"uniprot_ac": "P04906",
"gene_name": "Gstp1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P04906",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04906"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P04906",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04906"
}
]
}
]
},
{
"uniprot_ac": "P08009",
"gene_name": "Gstm7",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P08009",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08009"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P08009",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08009"
}
]
}
]
},
{
"uniprot_ac": "P08010",
"gene_name": "Gstm2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P08010",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08010"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P08010",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08010"
}
]
}
]
},
{
"uniprot_ac": "P08011",
"gene_name": "Mgst1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P08011",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08011"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P08011",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08011"
}
]
}
]
},
{
"uniprot_ac": "P08263",
"gene_name": "GSTA1",
"activity": [
{
"ec_number": "1.11.1.-",
"activity": "",
"evidence": [
{
"id": "P08263",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08263"
}
]
},
{
"ec_number": "5.3.3.-",
"activity": "",
"evidence": [
{
"id": "P08263",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08263"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P08263",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08263"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P08263",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08263"
}
]
}
]
},
{
"uniprot_ac": "P09210",
"gene_name": "GSTA2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P09210",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09210"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P09210",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09210"
}
]
}
]
},
{
"uniprot_ac": "P09211",
"gene_name": "GSTP1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P09211",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09211"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P09211",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09211"
}
]
}
]
},
{
"uniprot_ac": "P09488",
"gene_name": "GSTM1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P09488",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09488"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P09488",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09488"
}
]
}
]
},
{
"uniprot_ac": "P0CG29",
"gene_name": "GSTT2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P0CG29",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0CG29"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P0CG29",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0CG29"
}
]
}
]
},
{
"uniprot_ac": "P0CG30",
"gene_name": "GSTT2B",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P0CG30",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0CG30"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P0CG30",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0CG30"
}
]
}
]
},
{
"uniprot_ac": "P10620",
"gene_name": "MGST1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P10620",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10620"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P10620",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10620"
}
]
}
]
},
{
"uniprot_ac": "P10648",
"gene_name": "Gsta2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P10648",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10648"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P10648",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10648"
}
]
}
]
},
{
"uniprot_ac": "P10649",
"gene_name": "Gstm1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P10649",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10649"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P10649",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10649"
}
]
}
]
},
{
"uniprot_ac": "P13745",
"gene_name": "Gsta1",
"activity": [
{
"ec_number": "1.11.1.-",
"activity": "",
"evidence": [
{
"id": "P13745",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13745"
}
]
},
{
"ec_number": "5.3.3.-",
"activity": "",
"evidence": [
{
"id": "P13745",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13745"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P13745",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13745"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P13745",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13745"
}
]
}
]
},
{
"uniprot_ac": "P14942",
"gene_name": "Gsta4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P14942",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14942"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P14942",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14942"
}
]
}
]
},
{
"uniprot_ac": "P15626",
"gene_name": "Gstm2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P15626",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P15626"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P15626",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P15626"
}
]
}
]
},
{
"uniprot_ac": "P17695",
"gene_name": "GRX2",
"activity": [
{
"ec_number": "1.11.1.9",
"activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.",
"evidence": [
{
"id": "P17695",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17695"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P17695",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17695"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P17695",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17695"
}
]
},
{
"ec_number": "1.11.1.9",
"activity": "",
"evidence": [
{
"id": "P17695",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17695"
}
]
}
]
},
{
"uniprot_ac": "P19157",
"gene_name": "Gstp1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P19157",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P19157"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P19157",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P19157"
}
]
}
]
},
{
"uniprot_ac": "P19639",
"gene_name": "Gstm3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P19639",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P19639"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P19639",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P19639"
}
]
}
]
},
{
"uniprot_ac": "P20432",
"gene_name": "GstD1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P20432",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20432"
}
]
},
{
"ec_number": "4.5.1.1",
"activity": "1,1,1-trichloro-2,2-bis(4-chlorophenyl)ethane = 1,1-dichloro-2,2-bis(4-chlorophenyl)ethylene + chloride + H(+).",
"evidence": [
{
"id": "P20432",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20432"
}
]
},
{
"ec_number": "4.5.1.1",
"activity": "",
"evidence": [
{
"id": "P20432",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20432"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P20432",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20432"
}
]
}
]
},
{
"uniprot_ac": "P21266",
"gene_name": "GSTM3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P21266",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P21266"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P21266",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P21266"
}
]
}
]
},
{
"uniprot_ac": "P24472",
"gene_name": "Gsta4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P24472",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24472"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P24472",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24472"
}
]
}
]
},
{
"uniprot_ac": "P24473",
"gene_name": "Gstk1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P24473",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24473"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P24473",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24473"
}
]
}
]
},
{
"uniprot_ac": "P25373",
"gene_name": "GRX1",
"activity": [
{
"ec_number": "1.11.1.9",
"activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.",
"evidence": [
{
"id": "P25373",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P25373"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P25373",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P25373"
}
]
},
{
"ec_number": "1.11.1.9",
"activity": "",
"evidence": [
{
"id": "P25373",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P25373"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P25373",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P25373"
}
]
}
]
},
{
"uniprot_ac": "P28161",
"gene_name": "GSTM2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P28161",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P28161"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P28161",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P28161"
}
]
}
]
},
{
"uniprot_ac": "P30115",
"gene_name": "Gsta3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P30115",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30115"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P30115",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30115"
}
]
}
]
},
{
"uniprot_ac": "P30711",
"gene_name": "GSTT1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P30711",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30711"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P30711",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30711"
}
]
}
]
},
{
"uniprot_ac": "P30713",
"gene_name": "Gstt2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P30713",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30713"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P30713",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30713"
}
]
}
]
},
{
"uniprot_ac": "P36156",
"gene_name": "ECM4",
"activity": [
{
"ec_number": "1.8.5.1",
"activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.",
"evidence": [
{
"id": "P36156",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P36156"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P36156",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P36156"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P36156",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P36156"
}
]
}
]
},
{
"uniprot_ac": "P40582",
"gene_name": "GTT1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P40582",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P40582"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P40582",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P40582"
}
]
}
]
},
{
"uniprot_ac": "P41043",
"gene_name": "GstS1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P41043",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P41043"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P41043",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P41043"
}
]
}
]
},
{
"uniprot_ac": "P46418",
"gene_name": "Gsta5",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P46418",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P46418"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P46418",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P46418"
}
]
}
]
},
{
"uniprot_ac": "P46425",
"gene_name": "Gstp2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P46425",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P46425"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P46425",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P46425"
}
]
}
]
},
{
"uniprot_ac": "P46439",
"gene_name": "GSTM5",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P46439",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P46439"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P46439",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P46439"
}
]
}
]
},
{
"uniprot_ac": "P48239",
"gene_name": "GTO1",
"activity": [
{
"ec_number": "1.8.5.1",
"activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.",
"evidence": [
{
"id": "P48239",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P48239"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P48239",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P48239"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P48239",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P48239"
}
]
}
]
},
{
"uniprot_ac": "P48774",
"gene_name": "Gstm5",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P48774",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P48774"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P48774",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P48774"
}
]
}
]
},
{
"uniprot_ac": "P57113",
"gene_name": "Gstz1",
"activity": [
{
"ec_number": "5.2.1.2",
"activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.",
"evidence": [
{
"id": "P57113",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P57113"
}
]
},
{
"ec_number": "5.2.1.2",
"activity": "",
"evidence": [
{
"id": "P57113",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P57113"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P57113",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P57113"
}
]
}
]
},
{
"uniprot_ac": "P78417",
"gene_name": "GSTO1",
"activity": [
{
"ec_number": "1.20.4.2",
"activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.",
"evidence": [
{
"id": "P78417",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P78417"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.",
"evidence": [
{
"id": "P78417",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P78417"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P78417",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P78417"
}
]
},
{
"ec_number": "1.20.4.2",
"activity": "",
"evidence": [
{
"id": "P78417",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P78417"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "",
"evidence": [
{
"id": "P78417",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P78417"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P78417",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P78417"
}
]
}
]
},
{
"uniprot_ac": "Q01579",
"gene_name": "Gstt1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q01579",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q01579"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q01579",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q01579"
}
]
}
]
},
{
"uniprot_ac": "Q03013",
"gene_name": "GSTM4",
"activity": [
{
"ec_number": "4.4.1.20",
"activity": "leukotriene C4 = glutathione + leukotriene A4.",
"evidence": [
{
"id": "Q03013",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03013"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q03013",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03013"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q03013",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03013"
}
]
}
]
},
{
"uniprot_ac": "Q04806",
"gene_name": "GTO3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q04806",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04806"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q04806",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04806"
}
]
}
]
},
{
"uniprot_ac": "Q12390",
"gene_name": "GTT2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q12390",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12390"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q12390",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12390"
}
]
}
]
},
{
"uniprot_ac": "Q16772",
"gene_name": "GSTA3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q16772",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16772"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q16772",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16772"
}
]
}
]
},
{
"uniprot_ac": "Q4V8E6",
"gene_name": "Gstt4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q4V8E6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q4V8E6"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q4V8E6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q4V8E6"
}
]
}
]
},
{
"uniprot_ac": "Q54GA9",
"gene_name": "mgst",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q54GA9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54GA9"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q54GA9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54GA9"
}
]
}
]
},
{
"uniprot_ac": "Q54QV7",
"gene_name": "gsta5",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q54QV7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54QV7"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q54QV7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54QV7"
}
]
}
]
},
{
"uniprot_ac": "Q54VI4",
"gene_name": "gsta3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q54VI4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54VI4"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q54VI4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54VI4"
}
]
}
]
},
{
"uniprot_ac": "Q556G3",
"gene_name": "gsta2-2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q556G3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q556G3"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q556G3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q556G3"
}
]
}
]
},
{
"uniprot_ac": "Q55FF3",
"gene_name": "gsta1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q55FF3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q55FF3"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q55FF3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q55FF3"
}
]
}
]
},
{
"uniprot_ac": "Q5BK56",
"gene_name": "Gstm4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q5BK56",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5BK56"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q5BK56",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5BK56"
}
]
},
{
"ec_number": "4.4.1.20",
"activity": "leukotriene C4 = glutathione + leukotriene A4.",
"evidence": [
{
"id": "Q5BK56",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5BK56"
}
]
}
]
},
{
"uniprot_ac": "Q61133",
"gene_name": "Gstt2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q61133",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q61133"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q61133",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q61133"
}
]
}
]
},
{
"uniprot_ac": "Q64471",
"gene_name": "Gstt1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q64471",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64471"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q64471",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64471"
}
]
}
]
},
{
"uniprot_ac": "Q6AXV9",
"gene_name": "Gsto2",
"activity": [
{
"ec_number": "1.20.4.2",
"activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.",
"evidence": [
{
"id": "Q6AXV9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6AXV9"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.",
"evidence": [
{
"id": "Q6AXV9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6AXV9"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q6AXV9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6AXV9"
}
]
},
{
"ec_number": "1.20.4.2",
"activity": "",
"evidence": [
{
"id": "Q6AXV9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6AXV9"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q6AXV9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6AXV9"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "",
"evidence": [
{
"id": "Q6AXV9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6AXV9"
}
]
}
]
},
{
"uniprot_ac": "Q6AXY0",
"gene_name": "Gsta6",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q6AXY0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6AXY0"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q6AXY0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6AXY0"
}
]
}
]
},
{
"uniprot_ac": "Q6P8Q0",
"gene_name": "Gm3776",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q6P8Q0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6P8Q0"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q6P8Q0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6P8Q0"
}
]
}
]
},
{
"uniprot_ac": "Q7JYX0",
"gene_name": "GstE14",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q7JYX0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7JYX0"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q7JYX0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7JYX0"
}
]
}
]
},
{
"uniprot_ac": "Q7RTV2",
"gene_name": "GSTA5",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q7RTV2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7RTV2"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q7RTV2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7RTV2"
}
]
}
]
},
{
"uniprot_ac": "Q80W21",
"gene_name": "Gstm7",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q80W21",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q80W21"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q80W21",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q80W21"
}
]
}
]
},
{
"uniprot_ac": "Q86AU1",
"gene_name": "gsta4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q86AU1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q86AU1"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q86AU1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q86AU1"
}
]
}
]
},
{
"uniprot_ac": "Q8K2Q2",
"gene_name": "Gsto2",
"activity": [
{
"ec_number": "1.20.4.2",
"activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.",
"evidence": [
{
"id": "Q8K2Q2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8K2Q2"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.",
"evidence": [
{
"id": "Q8K2Q2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8K2Q2"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q8K2Q2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8K2Q2"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "",
"evidence": [
{
"id": "Q8K2Q2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8K2Q2"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q8K2Q2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8K2Q2"
}
]
},
{
"ec_number": "1.20.4.2",
"activity": "",
"evidence": [
{
"id": "Q8K2Q2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8K2Q2"
}
]
}
]
},
{
"uniprot_ac": "Q8R5I6",
"gene_name": "Gstm4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q8R5I6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8R5I6"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q8R5I6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8R5I6"
}
]
},
{
"ec_number": "4.4.1.20",
"activity": "leukotriene C4 = glutathione + leukotriene A4.",
"evidence": [
{
"id": "Q8R5I6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8R5I6"
}
]
}
]
},
{
"uniprot_ac": "Q91VS7",
"gene_name": "Mgst1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q91VS7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q91VS7"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q91VS7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q91VS7"
}
]
}
]
},
{
"uniprot_ac": "Q99735",
"gene_name": "MGST2",
"activity": [
{
"ec_number": "1.11.1.-",
"activity": "",
"evidence": [
{
"id": "Q99735",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99735"
}
]
},
{
"ec_number": "4.4.1.20",
"activity": "leukotriene C4 = glutathione + leukotriene A4.",
"evidence": [
{
"id": "Q99735",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99735"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q99735",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99735"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q99735",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99735"
}
]
}
]
},
{
"uniprot_ac": "Q99L20",
"gene_name": "Gstt3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q99L20",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99L20"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q99L20",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99L20"
}
]
}
]
},
{
"uniprot_ac": "Q9D4P7",
"gene_name": "Gstt4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9D4P7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9D4P7"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9D4P7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9D4P7"
}
]
}
]
},
{
"uniprot_ac": "Q9DCM2",
"gene_name": "Gstk1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9DCM2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9DCM2"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9DCM2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9DCM2"
}
]
}
]
},
{
"uniprot_ac": "Q9H4Y5",
"gene_name": "GSTO2",
"activity": [
{
"ec_number": "1.20.4.2",
"activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.",
"evidence": [
{
"id": "Q9H4Y5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H4Y5"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.",
"evidence": [
{
"id": "Q9H4Y5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H4Y5"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9H4Y5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H4Y5"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9H4Y5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H4Y5"
}
]
}
]
},
{
"uniprot_ac": "Q9JHF7",
"gene_name": "Hpgds",
"activity": [
{
"ec_number": "5.3.99.2",
"activity": "prostaglandin H2 = prostaglandin D2.",
"evidence": [
{
"id": "Q9JHF7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9JHF7"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9JHF7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9JHF7"
}
]
},
{
"ec_number": "5.3.99.2",
"activity": "",
"evidence": [
{
"id": "Q9JHF7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9JHF7"
}
]
}
]
},
{
"uniprot_ac": "Q9QX69",
"gene_name": "Lancl1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9QX69",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9QX69"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9QX69",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9QX69"
}
]
}
]
},
{
"uniprot_ac": "Q9VG93",
"gene_name": "GstD7",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9VG93",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG93"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9VG93",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG93"
}
]
}
]
},
{
"uniprot_ac": "Q9VG94",
"gene_name": "GstD6",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9VG94",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG94"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9VG94",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG94"
}
]
}
]
},
{
"uniprot_ac": "Q9VG95",
"gene_name": "GstD5",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9VG95",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG95"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9VG95",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG95"
}
]
}
]
},
{
"uniprot_ac": "Q9VG96",
"gene_name": "GstD4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9VG96",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG96"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9VG96",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG96"
}
]
}
]
},
{
"uniprot_ac": "Q9VG98",
"gene_name": "GstD2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9VG98",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG98"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9VG98",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG98"
}
]
}
]
},
{
"uniprot_ac": "Q9VHD2",
"gene_name": "GstZ2",
"activity": [
{
"ec_number": "5.2.1.2",
"activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.",
"evidence": [
{
"id": "Q9VHD2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VHD2"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9VHD2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VHD2"
}
]
},
{
"ec_number": "5.2.1.2",
"activity": "",
"evidence": [
{
"id": "Q9VHD2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VHD2"
}
]
}
]
},
{
"uniprot_ac": "Q9VHD3",
"gene_name": "GstZ1",
"activity": [
{
"ec_number": "5.2.1.2",
"activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.",
"evidence": [
{
"id": "Q9VHD3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VHD3"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9VHD3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VHD3"
}
]
},
{
"ec_number": "5.2.1.2",
"activity": "",
"evidence": [
{
"id": "Q9VHD3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VHD3"
}
]
}
]
},
{
"uniprot_ac": "Q9WVL0",
"gene_name": "Gstz1",
"activity": [
{
"ec_number": "5.2.1.2",
"activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.",
"evidence": [
{
"id": "Q9WVL0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WVL0"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9WVL0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WVL0"
}
]
},
{
"ec_number": "5.2.1.2",
"activity": "",
"evidence": [
{
"id": "Q9WVL0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WVL0"
}
]
}
]
},
{
"uniprot_ac": "Q9Y2Q3",
"gene_name": "GSTK1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9Y2Q3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y2Q3"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9Y2Q3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y2Q3"
}
]
}
]
},
{
"uniprot_ac": "Q9Z1B2",
"gene_name": "Gstm5",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9Z1B2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z1B2"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9Z1B2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z1B2"
}
]
}
]
},
{
"uniprot_ac": "Q9Z339",
"gene_name": "Gsto1",
"activity": [
{
"ec_number": "1.20.4.2",
"activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.",
"evidence": [
{
"id": "Q9Z339",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z339"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.",
"evidence": [
{
"id": "Q9Z339",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z339"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9Z339",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z339"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9Z339",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z339"
}
]
},
{
"ec_number": "1.20.4.2",
"activity": "",
"evidence": [
{
"id": "Q9Z339",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z339"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "",
"evidence": [
{
"id": "Q9Z339",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z339"
}
]
}
]
}
],
"biomarkers": [],
"synthesized_glycans": [],
"cluster_types": [
{
"name": "homologset.mgi",
"label": "MGI Homologs"
},
{
"name": "homologset.oma",
"label": "OMA Homologs"
}
],
"sequence_features": {
"n_linked_sites": [],
"o_linked_sites": [],
"snv_sites": [],
"glycation_sites": [],
"phosphorylation_sites": [],
"sequon_annotation_sites": []
},
"section_stats": [
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 1
},
{
"field": "total_sites",
"count": 1
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 1
},
{
"field": "o_linked_glycan_sites",
"count": 1
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment"
]
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 1
},
{
"field": "total_sites",
"count": 1
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 1
},
{
"field": "o_linked_glycan_sites",
"count": 1
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment"
]
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv_non_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "publication",
"table_stats": [
{
"field": "total",
"count": 69
}
],
"sort_fields": [
"title",
"journal",
"date",
"authors"
]
}
]
}