{ "uniprot_canonical_ac": "P09110-1", "uniprot_ac": "P09110", "uniprot_id": "THIK_HUMAN", "mass": { "chemical_mass": 44292.0, "monoisotopic_mass": 44292.0 }, "refseq": { "ac": "NP_001123882", "name": "3-ketoacyl-CoA thiolase, peroxisomal isoform b", "summary": "This gene encodes an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123882" }, "gene_names": [ { "name": "ACAA1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P09110", "id": "P09110" }, { "name": "ACAA1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123882", "id": "NP_001123882" }, { "name": "ACAA; Lnc-Myd88; PTHIO; THIO", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123882", "id": "NP_001123882" }, { "name": "ACAA", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P09110", "id": "P09110" }, { "name": "PTHIO", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P09110", "id": "P09110" } ], "protein_names": [ { "name": "3-ketoacyl-CoA thiolase, peroxisomal", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P09110" }, { "name": "2.3.1.155", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P09110" }, { "name": "2.3.1.16", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P09110" }, { "name": "2.3.1.9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P09110" }, { "name": "3-ketoacyl-CoA thiolase, peroxisomal isoform b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123882", "id": "NP_001123882" }, { "name": "Acetyl-CoA C-myristoyltransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P09110" }, { "name": "Acetyl-CoA acyltransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P09110" }, { "name": "Beta-ketothiolase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P09110" }, { "name": "Peroxisomal 3-oxoacyl-CoA thiolase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P09110" }, { "name": "peroxisomal 3-oxoacyl-Coenzyme A thiolase; acetyl-Coenzyme A acyltransferase 1; epididymis secretory sperm binding protein; 3-ketoacyl-CoA thiolase, peroxisomal; beta-ketothiolase; peroxisomal 3-oxoacyl-CoA thiolase; testicular tissue protein Li 197; acetyl-CoA C-myristoyltransferase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123882", "id": "NP_001123882" } ], "function": [ { "annotation": "A novel missense variant in ACAA1 contributes to early-onset Alzheimer's disease, impairs lysosomal function, and facilitates amyloid-beta pathology and cognitive decline. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001123882", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123882" }, { "database": "PubMed", "id": "34465723", "url": "https://glygen.org/publication/PubMed/34465723" } ] }, { "annotation": "Findings suggest that protective effects of endotoxin exposure on asthma may vary depending upon the presence or absence of a polymorphism in ACAA1. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001123882", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123882" }, { "database": "PubMed", "id": "22151743", "url": "https://glygen.org/publication/PubMed/22151743" } ] }, { "annotation": "Inhibition of ACAA1 Restrains Proliferation and Potentiates the Response to CDK4/6 Inhibitors in Triple-Negative Breast Cancer.", "evidence": [ { "database": "RefSeq", "id": "NP_001123882", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123882" }, { "database": "PubMed", "id": "37129951", "url": "https://glygen.org/publication/PubMed/37129951" } ] }, { "annotation": "Responsible for the thiolytic cleavage of straight chain 3-keto fatty acyl-CoAs (3-oxoacyl-CoAs) (PubMed:2882519, PubMed:11734571). Plays an important role in fatty acid peroxisomal beta-oxidation (PubMed:2882519, PubMed:11734571). Catalyzes the cleavage of short, medium, long, and very long straight chain 3-oxoacyl-CoAs (PubMed:2882519, PubMed:11734571).", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110#function" }, { "database": "PubMed", "id": "11734571", "url": "https://glygen.org/publication/PubMed/11734571" }, { "database": "PubMed", "id": "2882519", "url": "https://glygen.org/publication/PubMed/2882519" } ] }, { "annotation": "This gene encodes an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001123882", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123882" } ] }, { "annotation": "[Clinical phenotypic and genotypic analysis of 5 pediatric patients with beta-ketothiolase deficiency].", "evidence": [ { "database": "RefSeq", "id": "NP_001123882", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123882" }, { "database": "PubMed", "id": "38154980", "url": "https://glygen.org/publication/PubMed/38154980" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "P09110", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P09110" } ], "glycoeffect": [], "start_pos": 172, "end_pos": 172, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "E", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "3", "chr_pos": "38129319", "ref_nt": "C", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "E172", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] }, { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] }, { "disease_id": "DOID:2531", "recommended_name": { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes." }, "synonyms": [ { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematologic malignancy", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematologic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematological tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "blood cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic and lymphoid system tumor", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "malignant hematopoietic neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [ { "start_pos": 10, "end_pos": 10, "sequence_org": "H", "sequence_mut": "E", "comment": "In S3E mutant; Abolished localization to peroxisomes.", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" }, { "database": "PubMed", "id": "22057399", "url": "https://glygen.org/publication/PubMed/22057399" } ] }, { "start_pos": 5, "end_pos": 5, "sequence_org": "Q", "sequence_mut": "D", "comment": "Does not affect localization to peroxisomes.", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" }, { "database": "PubMed", "id": "22057399", "url": "https://glygen.org/publication/PubMed/22057399" } ] }, { "start_pos": 5, "end_pos": 5, "sequence_org": "Q", "sequence_mut": "K", "comment": "Does not affect localization to peroxisomes.", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" }, { "database": "PubMed", "id": "22057399", "url": "https://glygen.org/publication/PubMed/22057399" } ] }, { "start_pos": 5, "end_pos": 5, "sequence_org": "Q", "sequence_mut": "L", "comment": "Does not affect localization to peroxisomes.", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" }, { "database": "PubMed", "id": "22057399", "url": "https://glygen.org/publication/PubMed/22057399" } ] }, { "start_pos": 6, "end_pos": 6, "sequence_org": "V", "sequence_mut": "D", "comment": "Abolished localization to peroxisomes.", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" }, { "database": "PubMed", "id": "22057399", "url": "https://glygen.org/publication/PubMed/22057399" } ] }, { "start_pos": 6, "end_pos": 6, "sequence_org": "V", "sequence_mut": "K", "comment": "Does not affect localization to peroxisomes.", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" }, { "database": "PubMed", "id": "22057399", "url": "https://glygen.org/publication/PubMed/22057399" } ] }, { "start_pos": 7, "end_pos": 7, "sequence_org": "V", "sequence_mut": "D", "comment": "Abolished localization to peroxisomes.", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" }, { "database": "PubMed", "id": "22057399", "url": "https://glygen.org/publication/PubMed/22057399" } ] }, { "start_pos": 7, "end_pos": 7, "sequence_org": "V", "sequence_mut": "K", "comment": "Abolished localization to peroxisomes.", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" }, { "database": "PubMed", "id": "22057399", "url": "https://glygen.org/publication/PubMed/22057399" } ] }, { "start_pos": 8, "end_pos": 8, "sequence_org": "L", "sequence_mut": "D", "comment": "Does not affect localization to peroxisomes.", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" }, { "database": "PubMed", "id": "22057399", "url": "https://glygen.org/publication/PubMed/22057399" } ] }, { "start_pos": 8, "end_pos": 8, "sequence_org": "L", "sequence_mut": "K", "comment": "Does not affect localization to peroxisomes.", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" }, { "database": "PubMed", "id": "22057399", "url": "https://glygen.org/publication/PubMed/22057399" } ] }, { "start_pos": 9, "end_pos": 9, "sequence_org": "G", "sequence_mut": "D", "comment": "Does not affect localization to peroxisomes.", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" }, { "database": "PubMed", "id": "22057399", "url": "https://glygen.org/publication/PubMed/22057399" } ] }, { "start_pos": 9, "end_pos": 9, "sequence_org": "G", "sequence_mut": "L", "comment": "Does not affect localization to peroxisomes.", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" }, { "database": "PubMed", "id": "22057399", "url": "https://glygen.org/publication/PubMed/22057399" } ] }, { "start_pos": 9, "end_pos": 9, "sequence_org": "G", "sequence_mut": "R", "comment": "Does not affect localization to peroxisomes.", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" }, { "database": "PubMed", "id": "22057399", "url": "https://glygen.org/publication/PubMed/22057399" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "98.29", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000060971", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000060971" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "94.8", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000060971", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000060971" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "90.87", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000060971", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000060971" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "86.46", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000060971", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000060971" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "94.77", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000060971", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000060971" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "96.97", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000060971", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000060971" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "91.25", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000060971", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000060971" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "95.24", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000060971", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000060971" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "95.58", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000060971", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000060971" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "82.01", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000060971", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000060971" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "98.6", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000060971", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000060971" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "97.84", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000060971", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000060971" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "95.09", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000060971", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000060971" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P09110", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09110" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P09110", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09110" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P09110", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09110" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P09110", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09110" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P09110", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09110" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P09110", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09110" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P09110", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09110" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P09110", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09110" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P09110", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09110" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P09110", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09110" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P09110", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09110" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P09110", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P09110" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" } ], "common_name": "Human" } ], "gene": [ { "name": "ACAA1", "url": "https://www.uniprot.org/uniprot/P09110", "locus": { "chromosome": "3", "start_pos": 38103129, "end_pos": 38137242, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000060971", "url": "https://www.ensembl.org/id/ENSG00000060971" } ] } } ], "crossref": [ { "id": "ENSG00000060971", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000060971", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P09110", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P09110", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd00751", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00751", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "ACAA1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ACAA1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "30", "url": "https://www.ncbi.nlm.nih.gov/gene/30", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "82", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=82", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "C9JDE9", "url": "https://www.ebi.ac.uk/intact/interactors/id:C9JDE9*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "P09110", "url": "https://www.ebi.ac.uk/intact/interactors/id:P09110*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002155", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002155", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016039", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016039", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020610", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020610", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020613", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020613", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020615", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020615", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020616", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020616", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020617", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020617", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:30", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:30", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "604054", "url": "http://www.omim.org/entry/604054", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P09110", "url": "https://www.nextprot.org/entry/NX_P09110", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "MDHLPGC", "url": "https://omabrowser.org/oma/group/MDHLPGC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5481312at2759", "url": "http://www.orthodb.org/?query=5481312at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR43853", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43853", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR43853:SF8", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43853:SF8", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2IIK", "url": "https://www.rcsb.org/structure/2IIK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00108", "url": "http://pfam.xfam.org/family/PF00108", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02803", "url": "http://pfam.xfam.org/family/PF02803", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P09110", "url": "https://pharos.nih.gov/targets/P09110", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P09110", "url": "http://purl.obolibrary.org/obo/PR_P09110", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-2046106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2046106", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-390247", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390247", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9033500", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033500", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001123882", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123882", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "18161", "url": "https://www.rhea-db.org/rhea/18161", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "21036", "url": "https://www.rhea-db.org/rhea/21036", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "21564", "url": "https://www.rhea-db.org/rhea/21564", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "31203", "url": "https://www.rhea-db.org/rhea/31203", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "39131", "url": "https://www.rhea-db.org/rhea/39131", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "40343", "url": "https://www.rhea-db.org/rhea/40343", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "B4DVF4", "url": "https://www.uniprot.org/uniprot/B4DVF4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B4DVF4-1", "url": "https://www.uniprot.org/uniprot/B4DVF4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JDE9", "url": "https://www.uniprot.org/uniprot/C9JDE9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JDE9-1", "url": "https://www.uniprot.org/uniprot/C9JDE9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F2Z2Q6", "url": "https://www.uniprot.org/uniprot/F2Z2Q6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F2Z2Q6-1", "url": "https://www.uniprot.org/uniprot/F2Z2Q6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F2Z3P7", "url": "https://www.uniprot.org/uniprot/F2Z3P7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F2Z3P7-1", "url": "https://www.uniprot.org/uniprot/F2Z3P7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y4D4", "url": "https://www.uniprot.org/uniprot/H0Y4D4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y4D4-1", "url": "https://www.uniprot.org/uniprot/H0Y4D4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C131", "url": "https://www.uniprot.org/uniprot/H7C131", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C131-1", "url": "https://www.uniprot.org/uniprot/H7C131-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P09110-1", "url": "https://www.uniprot.org/uniprot/P09110-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P09110-2", "url": "https://www.uniprot.org/uniprot/P09110-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN", "length": 424, "header": "sp|P09110-1|THIK_HUMAN Isoform 1 of 3-ketoacyl-CoA thiolase, peroxisomal OS=Homo sapiens OX=9606 GN=ACAA1 PE=1 SV=2 CANONICAL=P09110-1" }, "isoforms": [ { "isoform_ac": "B4DVF4-1", "url": "", "sequence": { "sequence": "MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGWSPCPWLTEGTLEILLRA", "length": 153, "header": "tr|B4DVF4-1|THIK_HUMAN Computationally mapped isoform of 3-ketoacyl-CoA thiolase, peroxisomal OS=Homo sapiens OX=9606 GN=ACAA1 PE=1 SV=1 CANONICAL=P09110-1" }, "locus": { "chromosome": "3", "start_pos": 38137035, "end_pos": 38129333, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000411549.5", "url": "https://www.ensembl.org/id/ENST00000411549.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000414021.1", "url": "https://www.ensembl.org/id/ENSP00000414021.1" } ] } }, { "isoform_ac": "C9JDE9-1", "url": "", "sequence": { "sequence": "MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLRVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN", "length": 383, "header": "tr|C9JDE9-1|C9JDE9_HUMAN Computationally mapped isoform of Acetyl-CoA acyltransferase 1 OS=Homo sapiens OX=9606 GN=ACAA1 PE=1 SV=1 CANONICAL=P09110-1" }, "locus": { "chromosome": "3", "start_pos": 38137035, "end_pos": 38123050, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000450296.5", "url": "https://www.ensembl.org/id/ENST00000450296.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000395183.1", "url": "https://www.ensembl.org/id/ENSP00000395183.1" } ] } }, { "isoform_ac": "F2Z2Q6-1", "url": "", "sequence": { "sequence": "MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVVTSRRLCLCPLSIDSVRRGYRQWPA", "length": 113, "header": "tr|F2Z2Q6-1|THIK_HUMAN Computationally mapped isoform of 3-ketoacyl-CoA thiolase, peroxisomal OS=Homo sapiens OX=9606 GN=ACAA1 PE=1 SV=1 CANONICAL=P09110-1" }, "locus": { "chromosome": "3", "start_pos": 38137035, "end_pos": 38131932, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000418880.1", "url": "https://www.ensembl.org/id/ENST00000418880.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000403124.1", "url": "https://www.ensembl.org/id/ENSP00000403124.1" } ] } }, { "isoform_ac": "F2Z3P7-1", "url": "", "sequence": { "sequence": "MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVDQHGVSYVFLFYIHTEMCCSLGPGQSWPESPSF", "length": 121, "header": "tr|F2Z3P7-1|F2Z3P7_HUMAN Computationally mapped isoform of acetyl-CoA C-acetyltransferase OS=Homo sapiens OX=9606 GN=ACAA1 PE=1 SV=1 CANONICAL=P09110-1" }, "locus": { "chromosome": "3", "start_pos": 38137035, "end_pos": 38133956, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000440176.5", "url": "https://www.ensembl.org/id/ENST00000440176.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000389226.1", "url": "https://www.ensembl.org/id/ENSP00000389226.1" } ] } }, { "isoform_ac": "H0Y4D4-1", "url": "", "sequence": { "sequence": "XAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN", "length": 237, "header": "tr|H0Y4D4-1|H0Y4D4_HUMAN Computationally mapped isoform of Acetyl-CoA acyltransferase 1 OS=Homo sapiens OX=9606 GN=ACAA1 PE=1 SV=1 CANONICAL=P09110-1" }, "locus": { "chromosome": "3", "start_pos": 38131946, "end_pos": 38123049, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000452171.5", "url": "https://www.ensembl.org/id/ENST00000452171.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000391078.1", "url": "https://www.ensembl.org/id/ENSP00000391078.1" } ] } }, { "isoform_ac": "H7C131-1", "url": "", "sequence": { "sequence": "XRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKR", "length": 290, "header": "tr|H7C131-1|H7C131_HUMAN Computationally mapped isoform of acetyl-CoA C-acetyltransferase OS=Homo sapiens OX=9606 GN=ACAA1 PE=1 SV=1 CANONICAL=P09110-1" }, "locus": { "chromosome": "3", "start_pos": 38136624, "end_pos": 38125564, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000421218.1", "url": "https://www.ensembl.org/id/ENST00000421218.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000398172.1", "url": "https://www.ensembl.org/id/ENSP00000398172.1" } ] } }, { "isoform_ac": "P09110-1", "url": "", "sequence": { "sequence": "MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN", "length": 424, "header": "sp|P09110-1|THIK_HUMAN Isoform 1 of 3-ketoacyl-CoA thiolase, peroxisomal OS=Homo sapiens OX=9606 GN=ACAA1 PE=1 SV=2 CANONICAL=P09110-1" }, "locus": { "chromosome": "3", "start_pos": 38137035, "end_pos": 38123050, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000333167.13", "url": "https://www.ensembl.org/id/ENST00000333167.13" }, { "database": "Ensembl Peptide", "id": "ENSP00000333664.8", "url": "https://www.ensembl.org/id/ENSP00000333664.8" } ] } }, { "isoform_ac": "P09110-2", "url": "", "sequence": { "sequence": "MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN", "length": 331, "header": "sp|P09110-2|THIK_HUMAN Isoform 2 of 3-ketoacyl-CoA thiolase, peroxisomal OS=Homo sapiens OX=9606 GN=ACAA1 PE=1 SV=2 CANONICAL=P09110-1" }, "locus": { "chromosome": "3", "start_pos": 38137035, "end_pos": 38123050, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000301810.11", "url": "https://www.ensembl.org/id/ENST00000301810.11" }, { "database": "Ensembl Peptide", "id": "ENSP00000301810.7", "url": "https://www.ensembl.org/id/ENSP00000301810.7" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 59, "end_pos": 59, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "P09110", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09110" } ], "site_lbl": "Thr59" }, { "start_pos": 60, "end_pos": 60, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "P09110", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09110" } ], "site_lbl": "Thr60" } ], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Identification and characterization of the human orthologue of yeast Pex14p.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Will GK, Soukupova M, Hong X, Erdmann KS, Kiel JA, Dodt G, Kunau WH, Erdmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "10022913", "url": "https://glygen.org/publication/PubMed/10022913" } ] }, { "title": "PEX12 interacts with PEX5 and PEX10 and acts downstream of receptor docking in peroxisomal matrix protein import.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Chang CC, Warren DS, Sacksteder KA, Gould SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "10562279", "url": "https://glygen.org/publication/PubMed/10562279" } ] }, { "title": "Cloning, expression, and fatty acid regulation of the human delta-5 desaturase.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Cho HP, Nakamura M, Clarke SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2046106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2046106" } ], "reference": [ { "type": "PubMed", "id": "10601301", "url": "https://glygen.org/publication/PubMed/10601301" } ] }, { "title": "PEX7 gene structure, alternative transcripts, and evidence for a founder haplotype for the frequent RCDP allele, L292ter.", "journal": "Genomics", "date": "2000", "authors": "Braverman N, Steel G, Lin P, Moser A, Moser H, Valle D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "10673331", "url": "https://glygen.org/publication/PubMed/10673331" } ] }, { "title": "Identification and characterization of an enzyme involved in the elongation of n-6 and n-3 polyunsaturated fatty acids.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Parker-Barnes JM, Das T, Bobik E, Leonard AE, Thurmond JM, Chaung LT, Huang YS, Mukerji P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2046106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2046106" } ], "reference": [ { "type": "PubMed", "id": "10899997", "url": "https://glygen.org/publication/PubMed/10899997" } ] }, { "title": "Peroxisomal targeting signal-1 recognition by the TPR domains of human PEX5.", "journal": "Nature structural biology", "date": "2000", "authors": "Gatto GJ Jr, Geisbrecht BV, Gould SJ, Berg JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "11101887", "url": "https://glygen.org/publication/PubMed/11101887" } ] }, { "title": "Peroxisomal straight-chain Acyl-CoA oxidase and D-bifunctional protein are essential for the retroconversion step in docosahexaenoic acid synthesis.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Su HM, Moser AB, Moser HW, Watkins PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2046106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2046106" } ], "reference": [ { "type": "PubMed", "id": "11500517", "url": "https://glygen.org/publication/PubMed/11500517" } ] }, { "title": "Characterisation of human peroxisomal 2,4-dienoyl-CoA reductase.", "journal": "Biochimica et biophysica acta", "date": "2001", "authors": "De Nys K, Meyhi E, Mannaerts GP, Fransen M, Van Veldhoven PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-390247", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390247" } ], "reference": [ { "type": "PubMed", "id": "11514237", "url": "https://glygen.org/publication/PubMed/11514237" } ] }, { "title": "Domain mapping of human PEX5 reveals functional and structural similarities to Saccharomyces cerevisiae Pex18p and Pex21p.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Dodt G, Warren D, Becker E, Rehling P, Gould SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "11546814", "url": "https://glygen.org/publication/PubMed/11546814" } ] }, { "title": "Characterization of an acyl-coA thioesterase that functions as a major regulator of peroxisomal lipid metabolism.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Hunt MC, Solaas K, Kase BF, Alexson SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-390247", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390247" } ], "reference": [ { "type": "PubMed", "id": "11673457", "url": "https://glygen.org/publication/PubMed/11673457" } ] }, { "title": "Identification of the peroxisomal beta-oxidation enzymes involved in the biosynthesis of docosahexaenoic acid.", "journal": "Journal of lipid research", "date": "2001", "authors": "Ferdinandusse S, Denis S, Mooijer PA, Zhang Z, Reddy JK, Spector AA, Wanders RJ", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" }, { "database": "Reactome", "id": "R-HSA-2046106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2046106" } ], "reference": [ { "type": "PubMed", "id": "11734571", "url": "https://glygen.org/publication/PubMed/11734571" } ] }, { "title": "Mutational spectrum in the PEX7 gene and functional analysis of mutant alleles in 78 patients with rhizomelic chondrodysplasia punctata type 1.", "journal": "American journal of human genetics", "date": "2002", "authors": "Motley AM, Brites P, Gerez L, Hogenhout E, Haasjes J, Benne R, Tabak HF, Wanders RJ, Waterham HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "11781871", "url": "https://glygen.org/publication/PubMed/11781871" } ] }, { "title": "Functional studies on human Pex7p: subcellular localization and interaction with proteins containing a peroxisome-targeting signal type 2 and other peroxins.", "journal": "The Biochemical journal", "date": "2002", "authors": "Ghys K, Fransen M, Mannaerts GP, Van Veldhoven PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "11931631", "url": "https://glygen.org/publication/PubMed/11931631" } ] }, { "title": "The same rat Delta6-desaturase not only acts on 18- but also on 24-carbon fatty acids in very-long-chain polyunsaturated fatty acid biosynthesis.", "journal": "The Biochemical journal", "date": "2002", "authors": "D'andrea S, Guillou H, Jan S, Catheline D, Thibault JN, Bouriel M, Rioux V, Legrand P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2046106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2046106" } ], "reference": [ { "type": "PubMed", "id": "11988075", "url": "https://glygen.org/publication/PubMed/11988075" } ] }, { "title": "Eicosapentaenoic and docosapentaenoic acids are the principal products of alpha-linolenic acid metabolism in young men*.", "journal": "The British journal of nutrition", "date": "2002", "authors": "Burdge GC, Jones AE, Wootton SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2046106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2046106" } ], "reference": [ { "type": "PubMed", "id": "12323085", "url": "https://glygen.org/publication/PubMed/12323085" } ] }, { "title": "Conversion of alpha-linolenic acid to eicosapentaenoic, docosapentaenoic and docosahexaenoic acids in young women.", "journal": "The British journal of nutrition", "date": "2002", "authors": "Burdge GC, Wootton SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2046106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2046106" } ], "reference": [ { "type": "PubMed", "id": "12323090", "url": "https://glygen.org/publication/PubMed/12323090" } ] }, { "title": "PEX5 binds the PTS1 independently of Hsp70 and the peroxin PEX12.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Harper CC, Berg JM, Gould SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "12456682", "url": "https://glygen.org/publication/PubMed/12456682" } ] }, { "title": "Protein structure and import into the peroxisomal matrix.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2003", "authors": "Brocard CB, Jedeszko C, Song HC, Terlecky SR, Walton PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "12559034", "url": "https://glygen.org/publication/PubMed/12559034" } ] }, { "title": "Regulation of human delta-6 desaturase gene transcription: identification of a functional direct repeat-1 element.", "journal": "Journal of lipid research", "date": "2003", "authors": "Tang C, Cho HP, Nakamura MT, Clarke SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2046106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2046106" } ], "reference": [ { "type": "PubMed", "id": "12562861", "url": "https://glygen.org/publication/PubMed/12562861" } ] }, { "title": "Correlating structure and affinity for PEX5:PTS1 complexes.", "journal": "Biochemistry", "date": "2003", "authors": "Gatto GJ Jr, Maynard EL, Guerrerio AL, Geisbrecht BV, Gould SJ, Berg JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "12578380", "url": "https://glygen.org/publication/PubMed/12578380" } ] }, { "title": "Identification of the delta-6 desaturase of human sebaceous glands: expression and enzyme activity.", "journal": "The Journal of investigative dermatology", "date": "2003", "authors": "Ge L, Gordon JS, Hsuan C, Stenn K, Prouty SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2046106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2046106" } ], "reference": [ { "type": "PubMed", "id": "12713571", "url": "https://glygen.org/publication/PubMed/12713571" } ] }, { "title": "Metabolism of stearidonic acid in human subjects: comparison with the metabolism of other n-3 fatty acids.", "journal": "The American journal of clinical nutrition", "date": "2003", "authors": "James MJ, Ursin VM, Cleland LG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2046106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2046106" } ], "reference": [ { "type": "PubMed", "id": "12716664", "url": "https://glygen.org/publication/PubMed/12716664" } ] }, { "title": "The pathogenic peroxin Pex26p recruits the Pex1p-Pex6p AAA ATPase complexes to peroxisomes.", "journal": "Nature cell biology", "date": "2003", "authors": "Matsumoto N, Tamura S, Fujiki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "12717447", "url": "https://glygen.org/publication/PubMed/12717447" } ] }, { "title": "The energetics of Pex5p-mediated peroxisomal protein import.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Oliveira ME, Gouveia AM, Pinto RA, Sa-Miranda C, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "12885776", "url": "https://glygen.org/publication/PubMed/12885776" } ] }, { "title": "Studies on the metabolic fate of n-3 polyunsaturated fatty acids.", "journal": "Journal of lipid research", "date": "2003", "authors": "Ferdinandusse S, Denis S, Dacremont G, Wanders RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2046106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2046106" } ], "reference": [ { "type": "PubMed", "id": "12897190", "url": "https://glygen.org/publication/PubMed/12897190" } ] }, { "title": "Comparison of the conversion rates of alpha-linolenic acid (18:3(n - 3)) and stearidonic acid (18:4(n - 3)) to longer polyunsaturated fatty acids in rats.", "journal": "Biochimica et biophysica acta", "date": "1992", "authors": "Yamazaki K, Fujikawa M, Hamazaki T, Yano S, Shono T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2046106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2046106" } ], "reference": [ { "type": "PubMed", "id": "1346092", "url": "https://glygen.org/publication/PubMed/1346092" } ] }, { "title": "Elongation of long-chain fatty acids.", "journal": "Progress in lipid research", "date": "2004", "authors": "Leonard AE, Pereira SL, Sprecher H, Huang YS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2046106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2046106" } ], "reference": [ { "type": "PubMed", "id": "14636670", "url": "https://glygen.org/publication/PubMed/14636670" } ] }, { "title": "Identification of the peroxisomal beta-oxidation enzymes involved in the degradation of long-chain dicarboxylic acids.", "journal": "Journal of lipid research", "date": "2004", "authors": "Ferdinandusse S, Denis S, Van Roermund CW, Wanders RJ, Dacremont G", "evidence": [ { "database": "Reactome", "id": "R-HSA-390247", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390247" } ], "reference": [ { "type": "PubMed", "id": "15060085", "url": "https://glygen.org/publication/PubMed/15060085" } ] }, { "title": "Pex7p translocates in and out of peroxisomes in Saccharomyces cerevisiae.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Nair DM, Purdue PE, Lazarow PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "15545321", "url": "https://glygen.org/publication/PubMed/15545321" } ] }, { "title": "Alternative splicing suggests extended function of PEX26 in peroxisome biogenesis.", "journal": "American journal of human genetics", "date": "2005", "authors": "Weller S, Cajigas I, Morrell J, Obie C, Steel G, Gould SJ, Valle D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "15858711", "url": "https://glygen.org/publication/PubMed/15858711" } ] }, { "title": "Mutational spectrum of D-bifunctional protein deficiency and structure-based genotype-phenotype analysis.", "journal": "American journal of human genetics", "date": "2006", "authors": "Ferdinandusse S, Ylianttila MS, Gloerich J, Koski MK, Oostheim W, Waterham HR, Hiltunen JK, Wanders RJ, Glumoff T", "evidence": [ { "database": "Reactome", "id": "R-HSA-390247", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390247" } ], "reference": [ { "type": "PubMed", "id": "16385454", "url": "https://glygen.org/publication/PubMed/16385454" } ] }, { "title": "Import of human bifunctional enzyme into peroxisomes of human hepatoma cells in vitro.", "journal": "Biochemical and biophysical research communications", "date": "1991", "authors": "Chen GL, Balfe A, Erwa W, Hoefler G, Gaertner J, Aikawa J, Chen WW", "evidence": [ { "database": "Reactome", "id": "R-HSA-390247", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390247" } ], "reference": [ { "type": "PubMed", "id": "1651711", "url": "https://glygen.org/publication/PubMed/1651711" } ] }, { "title": "Peroxisomal multifunctional protein-2: the enzyme, the patients and the knockout mouse model.", "journal": "Biochimica et biophysica acta", "date": "2006", "authors": "Huyghe S, Mannaerts GP, Baes M, Van Veldhoven PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033500", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033500" } ], "reference": [ { "type": "PubMed", "id": "16766224", "url": "https://glygen.org/publication/PubMed/16766224" } ] }, { "title": "Characterization of the gene encoding human peroxisomal 3-oxoacyl-CoA thiolase (ACAA). No large DNA rearrangement in a thiolase-deficient patient.", "journal": "Biochim. Biophys. Acta", "date": "1991", "authors": "Bout A, Franse MM, Collins J, Blonden L, Tager JM, Benne R", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" }, { "database": "Reactome", "id": "R-HSA-390247", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390247" } ], "reference": [ { "type": "PubMed", "id": "1679347", "url": "https://glygen.org/publication/PubMed/1679347" } ] }, { "title": "Dynamic and functional assembly of the AAA peroxins, Pex1p and Pex6p, and their membrane receptor Pex26p.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Tamura S, Yasutake S, Matsumoto N, Fujiki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "16854980", "url": "https://glygen.org/publication/PubMed/16854980" } ] }, { "title": "Analysis of the mouse and human acyl-CoA thioesterase (ACOT) gene clusters shows that convergent, functional evolution results in a reduced number of human peroxisomal ACOTs.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2006", "authors": "Hunt MC, Rautanen A, Westin MA, Svensson LT, Alexson SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-390247", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390247" } ], "reference": [ { "type": "PubMed", "id": "16940157", "url": "https://glygen.org/publication/PubMed/16940157" } ] }, { "title": "Peroxisome targeting signal 1: is it really a simple tripeptide?", "journal": "Biochimica et biophysica acta", "date": "2006", "authors": "Brocard C, Hartig A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "17007944", "url": "https://glygen.org/publication/PubMed/17007944" } ] }, { "title": "Ubiquitination of mammalian Pex5p, the peroxisomal import receptor.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Carvalho AF, Pinto MP, Grou CP, Alencastre IS, Fransen M, Sa-Miranda C, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "17726030", "url": "https://glygen.org/publication/PubMed/17726030" } ] }, { "title": "The metabolism of 7,10,13,16,19-docosapentaenoic acid to 4,7,10,13,16,19-docosahexaenoic acid in rat liver is independent of a 4-desaturase.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Voss A, Reinhart M, Sankarappa S, Sprecher H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2046106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2046106" } ], "reference": [ { "type": "PubMed", "id": "1834642", "url": "https://glygen.org/publication/PubMed/1834642" } ] }, { "title": "Members of the E2D (UbcH5) family mediate the ubiquitination of the conserved cysteine of Pex5p, the peroxisomal import receptor.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Grou CP, Carvalho AF, Pinto MP, Wiese S, Piechura H, Meyer HE, Warscheid B, Sa-Miranda C, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "18359941", "url": "https://glygen.org/publication/PubMed/18359941" } ] }, { "title": "Novel functions of acyl-CoA thioesterases and acyltransferases as auxiliary enzymes in peroxisomal lipid metabolism.", "journal": "Progress in lipid research", "date": "2008", "authors": "Hunt MC, Alexson SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-2046106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2046106" } ], "reference": [ { "type": "PubMed", "id": "18538142", "url": "https://glygen.org/publication/PubMed/18538142" } ] }, { "title": "Genotype-phenotype correlation in PEX5-deficient peroxisome biogenesis defective cell lines.", "journal": "Human mutation", "date": "2009", "authors": "Ebberink MS, Mooyer PA, Koster J, Dekker CJ, Eyskens FJ, Dionisi-Vici C, Clayton PT, Barth PG, Wanders RJ, Waterham HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "18712838", "url": "https://glygen.org/publication/PubMed/18712838" } ] }, { "title": "The human peroxisomal ABC half transporter ALDP functions as a homodimer and accepts acyl-CoA esters.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2008", "authors": "van Roermund CW, Visser WF, Ijlst L, van Cruchten A, Boek M, Kulik W, Waterham HR, Wanders RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-390247", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390247" } ], "reference": [ { "type": "PubMed", "id": "18757502", "url": "https://glygen.org/publication/PubMed/18757502" } ] }, { "title": "Dietary stearidonic acid is a long chain (n-3) polyunsaturated fatty acid with potential health benefits.", "journal": "The Journal of nutrition", "date": "2009", "authors": "Whelan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2046106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2046106" } ], "reference": [ { "type": "PubMed", "id": "19056654", "url": "https://glygen.org/publication/PubMed/19056654" } ] }, { "title": "Structural basis for competitive interactions of Pex14 with the import receptors Pex5 and Pex19.", "journal": "The EMBO journal", "date": "2009", "authors": "Neufeld C, Filipp FV, Simon B, Neuhaus A, Schuller N, David C, Kooshapur H, Madl T, Erdmann R, Schliebs W, Wilmanns M, Sattler M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "19197237", "url": "https://glygen.org/publication/PubMed/19197237" } ] }, { "title": "Properties of the ubiquitin-pex5p thiol ester conjugate.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Grou CP, Carvalho AF, Pinto MP, Huybrechts SJ, Sa-Miranda C, Fransen M, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "19208625", "url": "https://glygen.org/publication/PubMed/19208625" } ] }, { "title": "Solution structure of human Pex5.Pex14.PTS1 protein complexes obtained by small angle X-ray scattering.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Shiozawa K, Konarev PV, Neufeld C, Wilmanns M, Svergun DI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "19584060", "url": "https://glygen.org/publication/PubMed/19584060" } ] }, { "title": "Mapping the cargo protein membrane translocation step into the PEX5 cycling pathway.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Alencastre IS, Rodrigues TA, Grou CP, Fransen M, Sa-Miranda C, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "19632994", "url": "https://glygen.org/publication/PubMed/19632994" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" }, { "database": "iPTMnet", "id": "P09110", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09110" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.", "journal": "Journal of the American Chemical Society", "date": "2010", "authors": "Ghosh D, Berg JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "20178365", "url": "https://glygen.org/publication/PubMed/20178365" } ] }, { "title": "Cysteine ubiquitination of PTS1 receptor Pex5p regulates Pex5p recycling.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2011", "authors": "Okumoto K, Misono S, Miyata N, Matsumoto Y, Mukai S, Fujiki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "21554508", "url": "https://glygen.org/publication/PubMed/21554508" } ] }, { "title": "PEX5 protein binds monomeric catalase blocking its tetramerization and releases it upon binding the N-terminal domain of PEX14.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Freitas MO, Francisco T, Rodrigues TA, Alencastre IS, Pinto MP, Grou CP, Carvalho AF, Fransen M, Sa-Miranda C, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "21976670", "url": "https://glygen.org/publication/PubMed/21976670" } ] }, { "title": "AWP1/ZFAND6 functions in Pex5 export by interacting with cys-monoubiquitinated Pex5 and Pex6 AAA ATPase.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2012", "authors": "Miyata N, Okumoto K, Mukai S, Noguchi M, Fujiki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "21980954", "url": "https://glygen.org/publication/PubMed/21980954" } ] }, { "title": "Two proteases, trypsin domain-containing 1 (Tysnd1) and peroxisomal lon protease (PsLon), cooperatively regulate fatty acid beta-oxidation in peroxisomal matrix.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Okumoto K, Kametani Y, Fujiki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "22002062", "url": "https://glygen.org/publication/PubMed/22002062" } ] }, { "title": "Structural requirements for interaction of peroxisomal targeting signal 2 and its receptor PEX7.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Kunze M, Neuberger G, Maurer-Stroh S, Ma J, Eck T, Braverman N, Schmid JA, Eisenhaber F, Berger J", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" }, { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "22057399", "url": "https://glygen.org/publication/PubMed/22057399" } ] }, { "title": "Effects of endotoxin exposure on childhood asthma risk are modified by a genetic polymorphism in ACAA1.", "journal": "BMC medical genetics", "date": "2011", "authors": "Sordillo JE, Sharma S, Poon A, Lasky-Su J, Belanger K, Milton DK, Bracken MB, Triche EW, Leaderer BP, Gold DR, Litonjua AA", "evidence": [ { "database": "RefSeq", "id": "NP_001123882", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123882" } ], "reference": [ { "type": "PubMed", "id": "22151743", "url": "https://glygen.org/publication/PubMed/22151743" } ] }, { "title": "Identification of ubiquitin-specific protease 9X (USP9X) as a deubiquitinase acting on ubiquitin-peroxin 5 (PEX5) thioester conjugate.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Grou CP, Francisco T, Rodrigues TA, Freitas MO, Pinto MP, Carvalho AF, Domingues P, Wood SA, Rodriguez-Borges JE, Sa-Miranda C, Fransen M, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "22371489", "url": "https://glygen.org/publication/PubMed/22371489" } ] }, { "title": "Peroxisomal L-bifunctional enzyme (Ehhadh) is essential for the production of medium-chain dicarboxylic acids.", "journal": "Journal of lipid research", "date": "2012", "authors": "Houten SM, Denis S, Argmann CA, Jia Y, Ferdinandusse S, Reddy JK, Wanders RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-390247", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390247" } ], "reference": [ { "type": "PubMed", "id": "22534643", "url": "https://glygen.org/publication/PubMed/22534643" } ] }, { "title": "Studies of human 2,4-dienoyl CoA reductase shed new light on peroxisomal beta-oxidation of unsaturated fatty acids.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Hua T, Wu D, Ding W, Wang J, Shaw N, Liu ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-390247", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390247" } ], "reference": [ { "type": "PubMed", "id": "22745130", "url": "https://glygen.org/publication/PubMed/22745130" } ] }, { "title": "Pex5p imports folded tetrameric catalase by interaction with Pex13p.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2012", "authors": "Otera H, Fujiki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "22747494", "url": "https://glygen.org/publication/PubMed/22747494" } ] }, { "title": "Proteome profiling of human neutrophil granule subsets, secretory vesicles, and cell membrane: correlation with transcriptome profiling of neutrophil precursors.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Rorvig S, Ostergaard O, Heegaard NH, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "23650620", "url": "https://glygen.org/publication/PubMed/23650620" } ] }, { "title": "A cargo-centered perspective on the PEX5 receptor-mediated peroxisomal protein import pathway.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Francisco T, Rodrigues TA, Freitas MO, Grou CP, Carvalho AF, Sa-Miranda C, Pinto MP, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "23963456", "url": "https://glygen.org/publication/PubMed/23963456" } ] }, { "title": "A novel Pex14 protein-interacting site of human Pex5 is critical for matrix protein import into peroxisomes.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Neuhaus A, Kooshapur H, Wolf J, Meyer NH, Madl T, Saidowsky J, Hambruch E, Lazam A, Jung M, Sattler M, Schliebs W, Erdmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "24235149", "url": "https://glygen.org/publication/PubMed/24235149" } ] }, { "title": "A PEX7-centered perspective on the peroxisomal targeting signal type 2-mediated protein import pathway.", "journal": "Molecular and cellular biology", "date": "2014", "authors": "Rodrigues TA, Alencastre IS, Francisco T, Brites P, Fransen M, Grou CP, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "24865970", "url": "https://glygen.org/publication/PubMed/24865970" } ] }, { "title": "AAA peroxins and their recruiter Pex26p modulate the interactions of peroxins involved in peroxisomal protein import.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Tamura S, Matsumoto N, Takeba R, Fujiki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "25016021", "url": "https://glygen.org/publication/PubMed/25016021" } ] }, { "title": "Mechanistic insights into PTS2-mediated peroxisomal protein import: the co-receptor PEX5L drastically increases the interaction strength between the cargo protein and the receptor PEX7.", "journal": "J. Biol. Chem.", "date": "2015", "authors": "Kunze M, Malkani N, Maurer-Stroh S, Wiesinger C, Schmid JA, Berger J", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" }, { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "25538232", "url": "https://glygen.org/publication/PubMed/25538232" } ] }, { "title": "The peroxisomal protein import machinery displays a preference for monomeric substrates.", "journal": "Open biology", "date": "2015", "authors": "Freitas MO, Francisco T, Rodrigues TA, Lismont C, Domingues P, Pinto MP, Grou CP, Fransen M, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "25854684", "url": "https://glygen.org/publication/PubMed/25854684" } ] }, { "title": "Export-deficient monoubiquitinated PEX5 triggers peroxisome removal in SV40 large T antigen-transformed mouse embryonic fibroblasts.", "journal": "Autophagy", "date": "2015", "authors": "Nordgren M, Francisco T, Lismont C, Hennebel L, Brees C, Wang B, Van Veldhoven PP, Azevedo JE, Fransen M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "26086376", "url": "https://glygen.org/publication/PubMed/26086376" } ] }, { "title": "Revisiting the intraperoxisomal pathway of mammalian PEX7.", "journal": "Scientific reports", "date": "2015", "authors": "Rodrigues TA, Grou CP, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "26138649", "url": "https://glygen.org/publication/PubMed/26138649" } ] }, { "title": "A novel type of rhizomelic chondrodysplasia punctata, RCDP5, is caused by loss of the PEX5 long isoform.", "journal": "Human molecular genetics", "date": "2015", "authors": "Baroy T, Koster J, Stromme P, Ebberink MS, Misceo D, Ferdinandusse S, Holmgren A, Hughes T, Merckoll E, Westvik J, Woldseth B, Walter J, Wood N, Tvedt B, Stadskleiv K, Wanders RJ, Waterham HR, Frengen E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "26220973", "url": "https://glygen.org/publication/PubMed/26220973" } ] }, { "title": "ATM functions at the peroxisome to induce pexophagy in response to ROS.", "journal": "Nature cell biology", "date": "2015", "authors": "Zhang J, Tripathi DN, Jing J, Alexander A, Kim J, Powell RT, Dere R, Tait-Mulder J, Lee JH, Paull TT, Pandita RK, Charaka VK, Pandita TK, Kastan MB, Walker CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "26344566", "url": "https://glygen.org/publication/PubMed/26344566" } ] }, { "title": "Complete cDNA sequence of human foetal liver peroxisomal 3-oxoacyl-CoA thiolase.", "journal": "Nucleic Acids Res.", "date": "1989", "authors": "Fairbairn L J, Tanner M J", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" } ], "reference": [ { "type": "PubMed", "id": "2726492", "url": "https://glygen.org/publication/PubMed/2726492" } ] }, { "title": "PEX2 is the E3 ubiquitin ligase required for pexophagy during starvation.", "journal": "The Journal of cell biology", "date": "2016", "authors": "Sargent G, van Zutphen T, Shatseva T, Zhang L, Di Giovanni V, Bandsma R, Kim PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "27597759", "url": "https://glygen.org/publication/PubMed/27597759" } ] }, { "title": "The peroxisomal AAA ATPase complex prevents pexophagy and development of peroxisome biogenesis disorders.", "journal": "Autophagy", "date": "2017", "authors": "Law KB, Bronte-Tinkew D, Di Pietro E, Snowden A, Jones RO, Moser A, Brumell JH, Braverman N, Kim PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "28521612", "url": "https://glygen.org/publication/PubMed/28521612" } ] }, { "title": "Structure and Function of p97 and Pex1/6 Type II AAA+ Complexes.", "journal": "Frontiers in molecular biosciences", "date": "2017", "authors": "Saffert P, Enenkel C, Wendler P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "28611990", "url": "https://glygen.org/publication/PubMed/28611990" } ] }, { "title": "The peroxisomal matrix protein translocon is a large cavity-forming protein assembly into which PEX5 protein enters to release its cargo.", "journal": "The Journal of biological chemistry", "date": "2017", "authors": "Dias AF, Rodrigues TA, Pedrosa AG, Barros-Barbosa A, Francisco T, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "28765278", "url": "https://glygen.org/publication/PubMed/28765278" } ] }, { "title": "Protein transport into peroxisomes: Knowns and unknowns.", "journal": "BioEssays : news and reviews in molecular, cellular and developmental biology", "date": "2017", "authors": "Francisco T, Rodrigues TA, Dias AF, Barros-Barbosa A, Bicho D, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "28787099", "url": "https://glygen.org/publication/PubMed/28787099" } ] }, { "title": "Human peroxisomal 3-oxoacyl-coenzyme A thiolase deficiency.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1987-04", "authors": "Schram A W, Goldfischer S, van Roermund C W, Brouwer-Kelder E M, Collins J, Hashimoto T, Heymans H S, van den Bosch H, Schutgens R B, Tager J M", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" } ], "reference": [ { "type": "PubMed", "id": "2882519", "url": "https://glygen.org/publication/PubMed/2882519" } ] }, { "title": "Nucleotide sequence of human peroxisomal 3-oxoacyl-CoA thiolase.", "journal": "Nucleic Acids Res.", "date": "1988", "authors": "Bout A, Teunissen Y, Hashimoto T, Benne R, Tager J M", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" } ], "reference": [ { "type": "PubMed", "id": "3194209", "url": "https://glygen.org/publication/PubMed/3194209" } ] }, { "title": "A novel missense variant in ACAA1 contributes to early-onset Alzheimer's disease, impairs lysosomal function, and facilitates amyloid-beta pathology and cognitive decline.", "journal": "Signal transduction and targeted therapy", "date": "2021", "authors": "Luo R, Fan Y, Yang J, Ye M, Zhang DF, Guo K, Li X, Bi R, Xu M, Yang LX, Li Y, Ran X, Jiang HY, Zhang C, Tan L, Sheng N, Yao YG", "evidence": [ { "database": "RefSeq", "id": "NP_001123882", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123882" } ], "reference": [ { "type": "PubMed", "id": "34465723", "url": "https://glygen.org/publication/PubMed/34465723" } ] }, { "title": "Inhibition of ACAA1 Restrains Proliferation and Potentiates the Response to CDK4/6 Inhibitors in Triple-Negative Breast Cancer.", "journal": "Cancer research", "date": "2023-05-02", "authors": "Peng Wen-Ting, Jin Xi, Xu Xiao-En, Yang Yun-Song, Ma Ding, Shao Zhi-Ming, Jiang Yi-Zhou", "evidence": [ { "database": "RefSeq", "id": "NP_001123882", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123882" } ], "reference": [ { "type": "PubMed", "id": "37129951", "url": "https://glygen.org/publication/PubMed/37129951" } ] }, { "title": "[Clinical phenotypic and genotypic analysis of 5 pediatric patients with \u03b2-ketothiolase deficiency].", "journal": "Zhonghua er ke za zhi = Chinese journal of pediatrics", "date": "2024-01-02", "authors": "Zhang J, Yu C W, Wang M, Wan K X, Yang J, Yuan Z J, Liao Z H, Wang D J", "evidence": [ { "database": "RefSeq", "id": "NP_001123882", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123882" } ], "reference": [ { "type": "PubMed", "id": "38154980", "url": "https://glygen.org/publication/PubMed/38154980" } ] }, { "title": "Peroxisomal beta oxidation system of rat liver. Copurification of enoyl-CoA hydratase and 3-hydroxyacyl-CoA dehydrogenase.", "journal": "Biochemical and biophysical research communications", "date": "1979", "authors": "Osumi T, Hashimoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-390247", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390247" } ], "reference": [ { "type": "PubMed", "id": "486181", "url": "https://glygen.org/publication/PubMed/486181" } ] }, { "title": "Induction, immunochemical identity and immunofluorescence localization of an 80 000-molecular-weight peroxisome-proliferation-associated polypeptide (polypeptide PPA-80) and peroxisomal enoyl-CoA hydratase of mouse liver and renal cortex.", "journal": "The Biochemical journal", "date": "1981", "authors": "Lalwani ND, Reddy MK, Mangkornkanok-Mark M, Reddy JK", "evidence": [ { "database": "Reactome", "id": "R-HSA-390247", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390247" } ], "reference": [ { "type": "PubMed", "id": "6798973", "url": "https://glygen.org/publication/PubMed/6798973" } ] }, { "title": "Discovery of an arachidonoyl coenzyme A synthetase in human platelets.", "journal": "The Journal of biological chemistry", "date": "1982", "authors": "Wilson DB, Prescott SM, Majerus PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2046106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2046106" } ], "reference": [ { "type": "PubMed", "id": "7061494", "url": "https://glygen.org/publication/PubMed/7061494" } ] }, { "title": "Mutations in the PTS1 receptor gene, PXR1, define complementation group 2 of the peroxisome biogenesis disorders.", "journal": "Nature genetics", "date": "1995", "authors": "Dodt G, Braverman N, Wong C, Moser A, Moser HW, Watkins P, Valle D, Gould SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "7719337", "url": "https://glygen.org/publication/PubMed/7719337" } ] }, { "title": "Human peroxisomal targeting signal-1 receptor restores peroxisomal protein import in cells from patients with fatal peroxisomal disorders.", "journal": "The Journal of cell biology", "date": "1995", "authors": "Wiemer EA, Nuttley WM, Bertolaet BL, Li X, Francke U, Wheelock MJ, Anne UK, Johnson KR, Subramani S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "7790377", "url": "https://glygen.org/publication/PubMed/7790377" } ] }, { "title": "Comparison of the metabolism of alpha-linolenic acid and its delta 6 desaturation product, stearidonic acid, in cultured NIH-3T3 cells.", "journal": "Lipids", "date": "1993", "authors": "Cantrill RC, Huang YS, Ells GW, Horrobin DF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2046106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2046106" } ], "reference": [ { "type": "PubMed", "id": "8096621", "url": "https://glygen.org/publication/PubMed/8096621" } ] }, { "title": "Docosahexaenoic acid synthesis in human skin fibroblasts involves peroxisomal retroconversion of tetracosahexaenoic acid.", "journal": "Journal of lipid research", "date": "1995", "authors": "Moore SA, Hurt E, Yoder E, Sprecher H, Spector AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2046106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2046106" } ], "reference": [ { "type": "PubMed", "id": "8656081", "url": "https://glygen.org/publication/PubMed/8656081" } ] }, { "title": "Targeting of proteins to granule subsets is determined by timing and not by sorting: The specific granule protein NGAL is localized to azurophil granules when expressed in HL-60 cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Le Cabec V, Cowland JB, Calafat J, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "8692836", "url": "https://glygen.org/publication/PubMed/8692836" } ] }, { "title": "Characterization of the yeast and human receptors for the carboxy-terminal tripeptide peroxisomal targeting signal.", "journal": "Cold Spring Harbor symposia on quantitative biology", "date": "1995", "authors": "Wiemer EA, Terlecky SR, Nuttley WM, Subramani S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "8824437", "url": "https://glygen.org/publication/PubMed/8824437" } ] }, { "title": "Docosapentaenoic acid (22:5, n-3), an elongation metabolite of eicosapentaenoic acid (20:5, n-3), is a potent stimulator of endothelial cell migration on pretreatment in vitro.", "journal": "Prostaglandins, leukotrienes, and essential fatty acids", "date": "1996", "authors": "Kanayasu-Toyoda T, Morita I, Murota S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2046106", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2046106" } ], "reference": [ { "type": "PubMed", "id": "8832760", "url": "https://glygen.org/publication/PubMed/8832760" } ] }, { "title": "Pex13p is an SH3 protein of the peroxisome membrane and a docking factor for the predominantly cytoplasmic PTs1 receptor.", "journal": "The Journal of cell biology", "date": "1996", "authors": "Gould SJ, Kalish JE, Morrell JC, Bjorkman J, Urquhart AJ, Crane DI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "8858165", "url": "https://glygen.org/publication/PubMed/8858165" } ] }, { "title": "Purification and properties of human D-3-hydroxyacyl-CoA dehydratase: medium-chain enoyl-CoA hydratase is D-3-hydroxyacyl-CoA dehydratase.", "journal": "Journal of biochemistry", "date": "1996", "authors": "Jiang LL, Kobayashi A, Matsuura H, Fukushima H, Hashimoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-390247", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390247" } ], "reference": [ { "type": "PubMed", "id": "8902629", "url": "https://glygen.org/publication/PubMed/8902629" } ] }, { "title": "Multiple PEX genes are required for proper subcellular distribution and stability of Pex5p, the PTS1 receptor: evidence that PTS1 protein import is mediated by a cycling receptor.", "journal": "The Journal of cell biology", "date": "1996", "authors": "Dodt G, Gould SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "8991089", "url": "https://glygen.org/publication/PubMed/8991089" } ] }, { "title": "Structure of D-3-hydroxyacyl-CoA dehydratase/D-3-hydroxyacyl-CoA dehydrogenase bifunctional protein.", "journal": "Journal of biochemistry", "date": "1997", "authors": "Jiang LL, Miyazawa S, Souri M, Hashimoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033500", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033500" } ], "reference": [ { "type": "PubMed", "id": "9089413", "url": "https://glygen.org/publication/PubMed/9089413" } ] }, { "title": "Human PEX7 encodes the peroxisomal PTS2 receptor and is responsible for rhizomelic chondrodysplasia punctata.", "journal": "Nature genetics", "date": "1997", "authors": "Braverman N, Steel G, Obie C, Moser A, Moser H, Gould SJ, Valle D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "9090381", "url": "https://glygen.org/publication/PubMed/9090381" } ] }, { "title": "Rhizomelic chondrodysplasia punctata is a peroxisomal protein targeting disease caused by a non-functional PTS2 receptor.", "journal": "Nature genetics", "date": "1997", "authors": "Motley AM, Hettema EH, Hogenhout EM, Brites P, ten Asbroek AL, Wijburg FA, Baas F, Heijmans HS, Tabak HF, Wanders RJ, Distel B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "9090382", "url": "https://glygen.org/publication/PubMed/9090382" } ] }, { "title": "Rhizomelic chondrodysplasia punctata is caused by deficiency of human PEX7, a homologue of the yeast PTS2 receptor.", "journal": "Nature genetics", "date": "1997", "authors": "Purdue PE, Zhang JW, Skoneczny M, Lazarow PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "9090383", "url": "https://glygen.org/publication/PubMed/9090383" } ] }, { "title": "Human PEX1 cloned by functional complementation on a CHO cell mutant is responsible for peroxisome-deficient Zellweger syndrome of complementation group I.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Tamura S, Okumoto K, Toyama R, Shimozawa N, Tsukamoto T, Suzuki Y, Osumi T, Kondo N, Fujiki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "9539740", "url": "https://glygen.org/publication/PubMed/9539740" } ] }, { "title": "Identification of a human PTS1 receptor docking protein directly required for peroxisomal protein import.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Fransen M, Terlecky SR, Subramani S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "9653144", "url": "https://glygen.org/publication/PubMed/9653144" } ] }, { "title": "An isoform of pex5p, the human PTS1 receptor, is required for the import of PTS2 proteins into peroxisomes.", "journal": "Human molecular genetics", "date": "1998", "authors": "Braverman N, Dodt G, Gould SJ, Valle D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "9668159", "url": "https://glygen.org/publication/PubMed/9668159" } ] }, { "title": "The difference in recognition of terminal tripeptides as peroxisomal targeting signal 1 between yeast and human is due to different affinities of their receptor Pex5p to the cognate signal and to residues adjacent to it.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Lametschwandtner G, Brocard C, Fransen M, Van Veldhoven P, Berger J, Hartig A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9033241", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241" } ], "reference": [ { "type": "PubMed", "id": "9837948", "url": "https://glygen.org/publication/PubMed/9837948" } ] } ], "pathway": [ { "id": "hsa:30", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:30", "resource": "KEGG Pathway" }, { "id": "R-HSA-2046106", "name": "alpha-linolenic acid (ALA) metabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2046106", "resource": "Reactome", "description": "alpha-linolenic acid (ALA) metabolism" }, { "id": "R-HSA-390247", "name": "Beta-oxidation of very long chain fatty acids", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390247", "resource": "Reactome", "description": "Beta-oxidation of very long chain fatty acids" }, { "id": "R-HSA-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-HSA-9033241", "name": "Peroxisomal protein import", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033241", "resource": "Reactome", "description": "Peroxisomal protein import" }, { "id": "R-HSA-9033500", "name": "TYSND1 cleaves peroxisomal proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033500", "resource": "Reactome", "description": "TYSND1 cleaves peroxisomal proteins" } ], "orthologs": [ { "uniprot_canonical_ac": "P07871-1", "protein_name": "3-ketoacyl-CoA thiolase B, peroxisomal", "gene_name": "Acaa1b", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MHRLQVVLGHLAGRSESSSALQAAPCSAGFPQASASDVVVVHGRRTPIGRAGRGGFKDTTPDELLSAVLTAVLQDVKLKPECLGDISVGNVLQPGAGAAMARIAQFLSGIPETVPLSAVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMTLSERGNPGNISSRLLENEKARDCLIPMGITSENVAERFGISRQKQDAFALASQQKAASAQSKGCFRAEIVPVTTTVLDDKGDRKTITVSQDEGVRPSTTMEGLAKLKPAFKDGGSTTAGNSSQVSDGAAAVLLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPAALQKAGLTVNDIDIFEINEAFASQALYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGRRAYGVVSMCIGTGMGAAAVFEYPGN", "length": 424 }, "evidence": [ { "id": "45920749", "url": "http://www.informatics.jax.org/homology/45920749", "database": "MGI" }, { "id": "P09110", "url": "https://omabrowser.org/oma/group/P09110/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P21775-1", "protein_name": "3-ketoacyl-CoA thiolase A, peroxisomal", "gene_name": "Acaa1a", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSESVGRTSAMHRLQVVLGHLAGRPESSSALQAAPCSATFPQASASDVVVVHGRRTPIGRAGRGGFKDTTPDELLSAVLTAVLQDVKLKPECLGDISVGNVLEPGAGAVMARIAQFLSGIPETVPLSAVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMSLSNRGNPGNISSRLLESDKARDCLIPMGITSENVAERFGISRQKQDAFALASQQKAASAQSKGCFRAEIVPVTTTVLDDKGDRKTITVSQDEGVRPSTTMEGLAKLKPAFKDGGSTTAGNSSQVSDGAAAVLLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPAALQKAGLTVNDIDIFEINEAFASQALYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGRRAYGVVSMCIGTGMGAAAVFEYPGN", "length": 434 }, "evidence": [ { "id": "45920748", "url": "http://www.informatics.jax.org/homology/45920748", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8VCH0-1", "protein_name": "3-ketoacyl-CoA thiolase B, peroxisomal", "gene_name": "Acaa1b", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MHRLQVVLGHLAGRPESSSALQAAPCSAGFLQASASDVVVVHGRRTPIGRASRGCFKDTTPDELLSAVLTAVLQDVKLKPEQLGDISVGNVLQPGAGAIMARIAQFLSGIPETVPLSTVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMTLSQRGNHGNISSRLLENEKARDCLIPMGITSENVAERFGVSRQKQDAFALASQQKAASAQSRGCFHAEIVPVTTTVLNDKGDKKTITVSQDEGVRPSTTMQGLAKLKPAFKDGGSTTAGNSSQVSDGAAAVLLARRSKAEELGLPILGVLRSYAVVGVPPDVMGIGPAYAIPAALQKAGLTVNDIDIFEINEAFASQAVYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGRRAYGVVSMCIGTGMGAAAVFEYPGN", "length": 424 }, "evidence": [ { "id": "45920749", "url": "http://www.informatics.jax.org/homology/45920749", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q921H8-1", "protein_name": "3-ketoacyl-CoA thiolase A, peroxisomal", "gene_name": "Acaa1a", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MHRLQVVLGHLAGRPESSSALQAAPCSARFPQASASDVVVVHGRRTPIGRASRGGFKNTTPDELLSAVLTAVLQDVRLKPEQLGDISVGNVLEPGAGAVMARIAQFLSGIPETVPLSTVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMSLSGMGNPGNISSRLLESEKARDCLTPMGMTSENVAERFGISRQKQDDFALASQQKAASAQSRGCFRAEIVPVTTTVLDDKGDKKTITVSQDEGVRPSTTMQGLAKLKPAFKDGGSTTAGNSSQVSDGAAAVLLARRSKAEELGLPILGVLRSYAVVGVPPDVMGIGPAYAIPAALQKAGLTVNDIDIFEINEAFASQAVYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGRRAYGVVSMCIGTGMGAAAVFEYPGN", "length": 424 }, "evidence": [ { "id": "45920748", "url": "http://www.informatics.jax.org/homology/45920748", "database": "MGI" }, { "id": "P09110", "url": "https://omabrowser.org/oma/group/P09110/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "acyltransferase activity, transferring groups other than amino-acyl groups", "id": "GO:0016747", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016747", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" } ], "pmid": "" }, { "name": "palmitoyl-CoA oxidase activity", "id": "GO:0016401", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016401", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" } ], "pmid": "" }, { "name": "acetyl-CoA C-acyltransferase activity", "id": "GO:0003988", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003988", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" } ], "pmid": "" }, { "name": "acetyl-CoA C-acetyltransferase activity", "id": "GO:0003985", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003985", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" } ], "pmid": "" }, { "name": "acetate CoA-transferase activity", "id": "GO:0008775", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008775", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" } ], "pmid": "" }, { "name": "acetyl-CoA C-myristoyltransferase activity", "id": "GO:0050633", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050633", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "phenylacetate catabolic process", "id": "GO:0010124", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010124", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" } ], "pmid": "" }, { "name": "very long-chain fatty acid metabolic process", "id": "GO:0000038", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000038", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" } ], "pmid": "" }, { "name": "fatty acid beta-oxidation", "id": "GO:0006635", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006635", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" } ], "pmid": "" }, { "name": "fatty acid beta-oxidation using acyl-CoA oxidase", "id": "GO:0033540", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033540", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" } ], "pmid": "" }, { "name": "alpha-linolenic acid metabolic process", "id": "GO:0036109", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036109", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" } ], "pmid": "" }, { "name": "bile acid metabolic process", "id": "GO:0008206", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008206", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" } ], "pmid": "" }, { "name": "peroxisome", "id": "GO:0005777", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005777", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" } ], "pmid": "" }, { "name": "peroxisomal matrix", "id": "GO:0005782", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005782", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" } ], "pmid": "" }, { "name": "specific granule lumen", "id": "GO:0035580", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035580", "evidence": [ { "database": "UniProtKB", "id": "P09110", "url": "https://www.uniprot.org/uniprot/P09110" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 139, "end_pos": 141, "annotation": "n_glycosylation_sequon" }, { "start_pos": 163, "end_pos": 165, "annotation": "n_glycosylation_sequon" }, { "start_pos": 274, "end_pos": 276, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "18161", "name": "", "equation": "acetyl-CoA + tetradecanoyl-CoA = 3-oxohexadecanoyl-CoA + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q60587-1", "P07871-1", "P11915-1", "P21775-1", "P55084-1", "P22307-1", "P09110-1", "Q99JY0-1", "Q8VCH0-1", "Q921H8-1", "P32020-1", "Q9VJ43-1" ], "evidence": [ { "id": "18161", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/18161" } ] }, { "id": "21036", "name": "", "equation": "2 acetyl-CoA = acetoacetyl-CoA + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q5XI22-1", "P07871-1", "P13437-1", "P17764-1", "P21775-1", "P24752-1", "P42765-1", "Q9BWD1-1", "P09110-1", "Q8VCH0-1", "Q8QZT1-1", "Q8CAY6-1", "Q8BWT1-1", "Q921H8-1", "P41338-1", "Q86AD9-1" ], "evidence": [ { "id": "21036", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/21036" } ] }, { "id": "21564", "name": "", "equation": "acetyl-CoA + an acyl-CoA = a 3-oxoacyl-CoA + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q60587-1", "P07871-1", "P13437-1", "P21775-1", "P11915-1", "P55084-1", "P09110-1", "P42765-1", "P22307-1", "Q99JY0-1", "Q8VCH0-1", "Q921H8-1", "Q8BWT1-1", "P32020-1", "P27796-1", "Q9VJ43-1" ], "evidence": [ { "id": "21564", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/21564" } ] }, { "id": "31203", "name": "", "equation": "acetyl-CoA + hexanoyl-CoA = 3-oxooctanoyl-CoA + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q60587-1", "P07871-1", "P11915-1", "P21775-1", "P55084-1", "P22307-1", "P09110-1", "Q99JY0-1", "Q8VCH0-1", "Q921H8-1", "P32020-1", "Q9VJ43-1" ], "evidence": [ { "id": "31203", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/31203" } ] }, { "id": "39131", "name": "", "equation": "3-oxo-(6Z,9Z,12Z,15Z,18Z,21Z)-tetracosahexaenoyl-CoA + CoA = (4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoyl-CoA + acetyl-CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P07871-1", "P21775-1", "P09110-1", "Q8VCH0-1", "Q921H8-1" ], "evidence": [ { "id": "39131", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/39131" } ] }, { "id": "40343", "name": "", "equation": "3-oxohexadecanedioyl-CoA + CoA = acetyl-CoA + tetradecanedioyl-CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P07871-1", "P11915-1", "P21775-1", "P22307-1", "P09110-1", "Q8VCH0-1", "Q921H8-1", "P32020-1", "Q9VJ43-1" ], "evidence": [ { "id": "40343", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/40343" } ] }, { "id": "R-HSA-2066788", "name": "Formation of DHA-CoA catalysed by 3-ketoacyl-CoA thiolase", "equation": "", "summary": "The final step in the beta-oxidation process is the thiolytic cleavage of 1-(3-oxo-6Z,9Z,12Z,15Z,18Z,21Z-tetracosahexaenoyl)-CoA to form docosahexaenoyl-CoA (DHA-CoA). This step is catalysed by both sterol carrier protein X (SCPx) and the classic 3-ketoacyl-CoA thiolase (this reaction) (Ferdinandusse et al. 2001).", "cellular_location": "peroxisomal matrix", "input_participant_list": [], "output_participant_list": [ "R-ALL-353123" ], "enzyme_list": [ "P09110-1" ], "evidence": [ { "id": "R-HSA-2066788", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2066788" } ] }, { "id": "R-HSA-390250", "name": "3-ketohexacosanoyl-CoA + CoASH => tetracosanoyl-CoA + acetyl-CoA", "equation": "", "summary": "Peroxisomal ACAA1 catalyzes the reaction of 3-ketohexacosanoyl-CoA and CoASH to form tetracosanoyl-CoA + acetyl-CoA (Bout et al. 1991).", "cellular_location": "peroxisomal matrix", "input_participant_list": [ "R-ALL-390241" ], "output_participant_list": [ "R-ALL-390246" ], "enzyme_list": [ "P09110-1" ], "evidence": [ { "id": "R-HSA-390250", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-390250" } ] }, { "id": "R-HSA-6798749", "name": "Exocytosis of specific granule lumen proteins", "equation": "", "summary": "Secondary (specific) granules are peroxidase-negative and rich in antimicrobial substances (Joiner et al. 1989, Rorvig et al. 2012). They are more irregular and elongated in form than azurophil granules (Bainton et al. 1971). This might reflect volume adjustment in azurophil granules, which are known to proteolytically process a significant fraction of the proteins that are targeted to them, while little or no processing and therefore no increase in osmotic activity due to proteolysis has been observed in secondary granules (Borregaard & Cowland 1997). Secondary and tertiary granules have overlapping contents but can be discriminated by their intrinsic buoyant densities when centrifuged on gradient media (Kjeldsen et al. 1994).", "cellular_location": "extracellular region, specific granule lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9UBR2-1", "P09110-1", "P49184-1", "Q92820-1", "Q99519-1", "P08246-1", "P51159-1", "Q9NQR4-1", "P07339-1", "P19801-1", "P05089-1", "Q8WVQ1-1", "P29350-1", "Q13231-1", "Q16769-1", "P61626-1", "P02788-1", "P42685-1", "P22894-1", "Q9Y251-1", "O00764-1", "O00391-1" ], "evidence": [ { "id": "R-HSA-6798749", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798749" } ] }, { "id": "R-HSA-9033232", "name": "PEX7 binds cargo proteins containing PTS2", "equation": "", "summary": "Cytosolic PEX7 binds peroxisome targeting signal 2 (PTS2), a sequence of nine amino acid residues functionally identified in 3 human peroxisomal matrix proteins (Braverman et al. 1997, Motley et al. 1997, Purdue et al. 1997, Braverman et al. 2000, Ghys et al. 2002, Motley et al. 2002, Kunze et al. 2011, Kunze et al. 2015). According to molecular modeling, the PTS2 consensus sequence binds a groove in PEX7 (Kunze et al. 2011). Mutations in PEX7 cause rhizomelic chondrodysplasia punctata type 1 (Braverman et al. 1997, Motley et al. 1997, Purdue et al. 1997).", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P09110-1", "O14832-1", "O00116-1" ], "evidence": [ { "id": "R-HSA-9033232", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033232" } ] }, { "id": "R-HSA-9033238", "name": "PEX5L:PEX7:Cargo binds PEX13:PEX14:PEX2:PEX10:PEX12 (Docking and Translocation Module)", "equation": "", "summary": "PEX5L bound to PEX7:Cargo interacts with the peroxisomal membrane complex PEX13:PEX14:PEX2:PEX10:PEX12 (the Docking-Translocation Complex) thus bringing PEX7 and its cargo to dock at the peroxisomal membrane (Gould et al. 1996, Fransen et al. 1998, Will et al. 1999, Dodt et al. 2001, Rodrigues et al. 2014, Rodrigues et al. 2015, also inferred from hamster and rat homologues).", "cellular_location": "peroxisomal membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P28328-1", "P09110-1", "O14832-1", "O00116-1", "O60683-1" ], "evidence": [ { "id": "R-HSA-9033238", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033238" } ] }, { "id": "R-HSA-9033240", "name": "PEX5L binds PEX7:Cargo protein", "equation": "", "summary": "The long isoform of PEX5, PEX5L, binds PEX7 that is already bound to a PTS2-containing cargo protein (Braverman et al. 1998, Dodt et al. 2001, Kunze et al. 2015, Rodrigues et al. 2015). The binding of PEX5L to PEX7 increases the affinity of PEX7 for cargo protein (Kunze et al. 2015). Mutations affecting the additional sequence present only in the long isoform of PEX5 cause rhizomelic chondrodysplasia punctata type 5 (Baroy et al. 2015).", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P09110-1", "O14832-1", "O00116-1" ], "evidence": [ { "id": "R-HSA-9033240", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033240" } ] }, { "id": "R-HSA-9033514", "name": "Cargo of PEX5L:PEX7 translocates from the cytosol to the peroxisomal matrix", "equation": "", "summary": "The cargo protein bound to PEX7 is released from PEX7 into the peroxisomal matrix in a reaction that does not require ATP (Purdue et al. 1997, Dodt et al. 2001, Rodrigues et al. 2014, Rodrigues et al. 2015). PEX7 may also be released into the matrix (inferred from yeast in Nair et al. 2004), however later research indicates that PEX7 remains with PEX5L in the peroxisomal membrane (Rodrigues et al. 2015) apparently in a proteinaceous cavity (Dias et al. 2017). Mutations in PEX5 cause defects in import of PTS1-containing proteins or PTS2-containing proteins or both (Eberrink et al. 2009, Bar\u00f8y et al. 2015).", "cellular_location": "peroxisomal membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P28328-1", "P09110-1", "O14832-1", "O00116-1", "O60683-1" ], "evidence": [ { "id": "R-HSA-9033514", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033514" } ] }, { "id": "R-HSA-9033529", "name": "TYSND1 cleaves ACAA1", "equation": "", "summary": "The trypsin-like serine-type endopeptidase TYSND1 cleaves ACAA1 between amino acid residues 26 and 27, yielding ACAA1(1-26) and ACAA1(27-424) (Okumoto et al. 2011). In mice, knockout of Tysnd1 causes reduced localization of Acaa1 to the peroxisome.", "cellular_location": "peroxisomal matrix", "input_participant_list": [ "R-HSA-9033517" ], "output_participant_list": [ "R-HSA-390238", "R-HSA-9033534" ], "enzyme_list": [ "P09110-1", "Q2T9J0-1" ], "evidence": [ { "id": "R-HSA-9033529", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9033529" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-353123", "participant_name": "Ac-CoA [peroxisomal matrix]", "crossref": [ { "id": "C00024", "database": "COMPOUND", "url": "" }, { "id": "000008551095", "database": "ZINC", "url": "" }, { "id": "57288", "database": "ChEBI", "url": "" }, { "id": "57288", "database": "ChEBI", "url": "" }, { "id": "000008551095", "database": "ZINC", "url": "" }, { "id": "C00024", "database": "COMPOUND", "url": "" }, { "id": "C00024", "database": "COMPOUND", "url": "" }, { "id": "57288", "database": "ChEBI", "url": "" }, { "id": "000008551095", "database": "ZINC", "url": "" }, { "id": "C00024", "database": "COMPOUND", "url": "" }, { "id": "57288", "database": "ChEBI", "url": "" }, { "id": "000008551095", "database": "ZINC", "url": "" }, { "id": "C00024", "database": "COMPOUND", "url": "" }, { "id": "57288", "database": "ChEBI", "url": "" }, { "id": "000008551095", "database": "ZINC", "url": "" }, { "id": "000008551095", "database": "ZINC", "url": "" }, { "id": "C00024", "database": "COMPOUND", "url": "" }, { "id": "57288", "database": "ChEBI", "url": "" }, { "id": "C00024", "database": "COMPOUND", "url": "" }, { "id": "57288", "database": "ChEBI", "url": "" }, { "id": "000008551095", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-390241", "participant_name": "3-ketohexacosanoyl-CoA [peroxisomal matrix]", "crossref": [ { "id": "73980", "database": "ChEBI", "url": "" }, { "id": "73980", "database": "ChEBI", "url": "" }, { "id": "73980", "database": "ChEBI", "url": "" }, { "id": "73980", "database": "ChEBI", "url": "" }, { "id": "73980", "database": "ChEBI", "url": "" }, { "id": "73980", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-390246", "participant_name": "tetracosanoyl-CoA [peroxisomal matrix]", "crossref": [ { "id": "65052", "database": "ChEBI", "url": "" }, { "id": "65052", "database": "ChEBI", "url": "" }, { "id": "65052", "database": "ChEBI", "url": "" }, { "id": "65052", "database": "ChEBI", "url": "" }, { "id": "65052", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-HSA-390238", "participant_name": "ACAA1 [peroxisomal matrix]", "crossref": [ { "id": "ENSP00000301810", "database": "Ensembl", "url": "" }, { "id": "ENST00000333167", "database": "Ensembl", "url": "" }, { "id": "P09110", "database": "PRO", "url": "" }, { "id": "HMDBP00045", "database": "HMDB Protein", "url": "" }, { "id": "ENST00000301810", "database": "Ensembl", "url": "" }, { "id": "2.3.1.9", "database": "IntEnz", "url": "" }, { "id": "P09110", "database": "UniProt", "url": "" }, { "id": "ENSG00000060971", "database": "OpenTargets", "url": "" }, { "id": "ENSG00000060971-ACAA1", "database": "HPA", "url": "" }, { "id": "NP_001598.1", "database": "RefSeq", "url": "" }, { "id": "24322", "database": "Orphanet", "url": "" }, { "id": "ENSG00000060971", "database": "Ensembl", "url": "" }, { "id": "NP_001123882.1", "database": "RefSeq", "url": "" }, { "id": "ENSP00000333664", "database": "Ensembl", "url": "" }, { "id": "P09110", "database": "GeneCards", "url": "" }, { "id": "2IIK", "database": "PDB", "url": "" }, { "id": "P09110", "database": "Pharos - Targets", "url": "" } ] }, { "participant_id": "R-HSA-9033517", "participant_name": "ACAA1(1-424) [peroxisomal matrix]", "crossref": [ { "id": "P09110", "database": "UniProt", "url": "" }, { "id": "ENSP00000333664", "database": "Ensembl", "url": "" }, { "id": "ENSP00000301810", "database": "Ensembl", "url": "" }, { "id": "ENSG00000060971", "database": "Ensembl", "url": "" }, { "id": "ENST00000301810", "database": "Ensembl", "url": "" }, { "id": "P09110", "database": "GeneCards", "url": "" }, { "id": "P09110", "database": "PRO", "url": "" }, { "id": "NP_001598.1", "database": "RefSeq", "url": "" }, { "id": "ENSG00000060971", "database": "OpenTargets", "url": "" }, { "id": "P09110", "database": "Pharos - Targets", "url": "" }, { "id": "ENST00000333167", "database": "Ensembl", "url": "" }, { "id": "NP_001123882.1", "database": "RefSeq", "url": "" }, { "id": "2.3.1.9", "database": "IntEnz", "url": "" }, { "id": "2IIK", "database": "PDB", "url": "" }, { "id": "HMDBP00045", "database": "HMDB Protein", "url": "" }, { "id": "24322", "database": "Orphanet", "url": "" }, { "id": "ENSG00000060971-ACAA1", "database": "HPA", "url": "" } ] }, { "participant_id": "R-HSA-9033534", "participant_name": "ACAA1(1-26) [peroxisomal matrix]", "crossref": [ { "id": "2IIK", "database": "PDB", "url": "" }, { "id": "P09110", "database": "GeneCards", "url": "" }, { "id": "P09110", "database": "Pharos - Targets", "url": "" }, { "id": "ENSP00000333664", "database": "Ensembl", "url": "" }, { "id": "NP_001123882.1", "database": "RefSeq", "url": "" }, { "id": "ENSG00000060971", "database": "Ensembl", "url": "" }, { "id": "24322", "database": "Orphanet", "url": "" }, { "id": "NP_001598.1", "database": "RefSeq", "url": "" }, { "id": "ENSG00000060971-ACAA1", "database": "HPA", "url": "" }, { "id": "P09110", "database": "PRO", "url": "" }, { "id": "HMDBP00045", "database": "HMDB Protein", "url": "" }, { "id": "ENSP00000301810", "database": "Ensembl", "url": "" }, { "id": "ENST00000333167", "database": "Ensembl", "url": "" }, { "id": "P09110", "database": "UniProt", "url": "" }, { "id": "ENSG00000060971", "database": "OpenTargets", "url": "" }, { "id": "2.3.1.9", "database": "IntEnz", "url": "" }, { "id": "ENST00000301810", "database": "Ensembl", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "O00116", "gene_name": "AGPS", "activity": [ { "ec_number": "2.5.1.26", "activity": "a 1-acylglycerone 3-phosphate + a long chain fatty alcohol = 1-O-alkylglycerone 3-phosphate + a long-chain fatty acid + H(+).", "evidence": [ { "id": "O00116", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00116" } ] }, { "ec_number": "2.5.1.26", "activity": "", "evidence": [ { "id": "O00116", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00116" } ] } ] }, { "uniprot_ac": "O00391", "gene_name": "QSOX1", "activity": [ { "ec_number": "1.8.3.2", "activity": "O2 + 2 R'C(R)SH = H2O2 + R'C(R)S-S(R)CR'.", "evidence": [ { "id": "O00391", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00391" } ] }, { "ec_number": "1.8.3.2", "activity": "", "evidence": [ { "id": "O00391", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00391" } ] } ] }, { "uniprot_ac": "O00764", "gene_name": "PDXK", "activity": [ { "ec_number": "2.7.1.35", "activity": "ATP + pyridoxal = ADP + H(+) + pyridoxal 5'-phosphate.", "evidence": [ { "id": "O00764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00764" } ] }, { "ec_number": "2.7.1.35", "activity": "", "evidence": [ { "id": "O00764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00764" } ] } ] }, { "uniprot_ac": "O14832", "gene_name": "PHYH", "activity": [ { "ec_number": "1.14.11.18", "activity": "2-oxoglutarate + O2 + phytanoyl-CoA = 2-hydroxyphytanoyl-CoA + CO2 + succinate.", "evidence": [ { "id": "O14832", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14832" } ] }, { "ec_number": "1.14.11.18", "activity": "", "evidence": [ { "id": "O14832", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14832" } ] } ] }, { "uniprot_ac": "O60683", "gene_name": "PEX10", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "O60683", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60683" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "O60683", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60683" } ] } ] }, { "uniprot_ac": "P02788", "gene_name": "LTF", "activity": [ { "ec_number": "3.4.21.-", "activity": "", "evidence": [ { "id": "P02788", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02788" } ] } ] }, { "uniprot_ac": "P05089", "gene_name": "ARG1", "activity": [ { "ec_number": "3.5.3.1", "activity": "H2O + L-arginine = L-ornithine + urea.", "evidence": [ { "id": "P05089", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05089" } ] }, { "ec_number": "3.5.3.1", "activity": "", "evidence": [ { "id": "P05089", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05089" } ] } ] }, { "uniprot_ac": "P07339", "gene_name": "CTSD", "activity": [ { "ec_number": "3.4.23.5", "activity": "Specificity similar to, but narrower than, that of pepsin A. Does not cleave the 4-Gln-|-His-5 bond in B chain of insulin.", "evidence": [ { "id": "P07339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07339" } ] }, { "ec_number": "3.4.23.5", "activity": "", "evidence": [ { "id": "P07339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07339" } ] } ] }, { "uniprot_ac": "P07871", "gene_name": "Acaa1b", "activity": [ { "ec_number": "2.3.1.16", "activity": "acetyl-CoA + an acyl-CoA = a 3-oxoacyl-CoA + CoA.", "evidence": [ { "id": "P07871", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07871" } ] }, { "ec_number": "2.3.1.9", "activity": "2 acetyl-CoA = acetoacetyl-CoA + CoA.", "evidence": [ { "id": "P07871", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07871" } ] }, { "ec_number": "2.3.1.155", "activity": "acetyl-CoA + tetradecanoyl-CoA = 3-oxohexadecanoyl-CoA + CoA.", "evidence": [ { "id": "P07871", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07871" } ] }, { "ec_number": "2.3.1.9", "activity": "", "evidence": [ { "id": "P07871", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07871" } ] }, { "ec_number": "2.3.1.155", "activity": "", "evidence": [ { "id": "P07871", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07871" } ] }, { "ec_number": "2.3.1.16", "activity": "", "evidence": [ { "id": "P07871", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07871" } ] } ] }, { "uniprot_ac": "P08246", "gene_name": "ELANE", "activity": [ { "ec_number": "3.4.21.37", "activity": "Hydrolysis of proteins, including elastin. Preferential cleavage: Val-|-Xaa > Ala-|-Xaa.", "evidence": [ { "id": "P08246", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08246" } ] }, { "ec_number": "3.4.21.37", "activity": "", "evidence": [ { "id": "P08246", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08246" } ] } ] }, { "uniprot_ac": "P09110", "gene_name": "ACAA1", "activity": [ { "ec_number": "2.3.1.9", "activity": "2 acetyl-CoA = acetoacetyl-CoA + CoA.", "evidence": [ { "id": "P09110", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09110" } ] }, { "ec_number": "2.3.1.9", "activity": "", "evidence": [ { "id": "P09110", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09110" } ] }, { "ec_number": "2.3.1.16", "activity": "acetyl-CoA + an acyl-CoA = a 3-oxoacyl-CoA + CoA.", "evidence": [ { "id": "P09110", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09110" } ] }, { "ec_number": "2.3.1.155", "activity": "acetyl-CoA + tetradecanoyl-CoA = 3-oxohexadecanoyl-CoA + CoA.", "evidence": [ { "id": "P09110", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09110" } ] }, { "ec_number": "2.3.1.16", "activity": "", "evidence": [ { "id": "P09110", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09110" } ] } ] }, { "uniprot_ac": "P11915", "gene_name": "Scp2", "activity": [ { "ec_number": "2.3.1.176", "activity": "4,8,12-trimethyltridecanoyl-CoA + propanoyl-CoA = 3-oxopristanoyl-CoA + CoA.", "evidence": [ { "id": "P11915", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11915" } ] }, { "ec_number": "2.3.1.16", "activity": "acetyl-CoA + an acyl-CoA = a 3-oxoacyl-CoA + CoA.", "evidence": [ { "id": "P11915", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11915" } ] }, { "ec_number": "2.3.1.155", "activity": "acetyl-CoA + tetradecanoyl-CoA = 3-oxohexadecanoyl-CoA + CoA.", "evidence": [ { "id": "P11915", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11915" } ] }, { "ec_number": "2.3.1.155", "activity": "", "evidence": [ { "id": "P11915", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11915" } ] }, { "ec_number": "2.3.1.16", "activity": "", "evidence": [ { "id": "P11915", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11915" } ] }, { "ec_number": "2.3.1.176", "activity": "", "evidence": [ { "id": "P11915", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11915" } ] } ] }, { "uniprot_ac": "P13437", "gene_name": "Acaa2", "activity": [ { "ec_number": "3.1.2.-", "activity": "", "evidence": [ { "id": "P13437", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13437" } ] }, { "ec_number": "3.1.2.2", "activity": "H2O + hexadecanoyl-CoA = CoA + H(+) + hexadecanoate.", "evidence": [ { "id": "P13437", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13437" } ] }, { "ec_number": "3.1.2.1", "activity": "acetyl-CoA + H2O = acetate + CoA + H(+).", "evidence": [ { "id": "P13437", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13437" } ] }, { "ec_number": "2.3.1.16", "activity": "acetyl-CoA + an acyl-CoA = a 3-oxoacyl-CoA + CoA.", "evidence": [ { "id": "P13437", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13437" } ] }, { "ec_number": "2.3.1.9", "activity": "2 acetyl-CoA = acetoacetyl-CoA + CoA.", "evidence": [ { "id": "P13437", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13437" } ] }, { "ec_number": "2.3.1.16", "activity": "", "evidence": [ { "id": "P13437", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13437" } ] } ] }, { "uniprot_ac": "P17764", "gene_name": "Acat1", "activity": [ { "ec_number": "2.3.1.9", "activity": "2 acetyl-CoA = acetoacetyl-CoA + CoA.", "evidence": [ { "id": "P17764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17764" } ] }, { "ec_number": "2.3.1.9", "activity": "", "evidence": [ { "id": "P17764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17764" } ] } ] }, { "uniprot_ac": "P19801", "gene_name": "AOC1", "activity": [ { "ec_number": "1.4.3.22", "activity": "H2O + histamine + O2 = H2O2 + imidazole-4-acetaldehyde + NH4(+).", "evidence": [ { "id": "P19801", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19801" } ] }, { "ec_number": "1.4.3.22", "activity": "", "evidence": [ { "id": "P19801", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19801" } ] }, { "ec_number": "1.4.3.-", "activity": "", "evidence": [ { "id": "P19801", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19801" } ] } ] }, { "uniprot_ac": "P21775", "gene_name": "Acaa1a", "activity": [ { "ec_number": "2.3.1.16", "activity": "acetyl-CoA + an acyl-CoA = a 3-oxoacyl-CoA + CoA.", "evidence": [ { "id": "P21775", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21775" } ] }, { "ec_number": "2.3.1.9", "activity": "2 acetyl-CoA = acetoacetyl-CoA + CoA.", "evidence": [ { "id": "P21775", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21775" } ] }, { "ec_number": "2.3.1.155", "activity": "acetyl-CoA + tetradecanoyl-CoA = 3-oxohexadecanoyl-CoA + CoA.", "evidence": [ { "id": "P21775", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21775" } ] }, { "ec_number": "2.3.1.16", "activity": "", "evidence": [ { "id": "P21775", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21775" } ] }, { "ec_number": "2.3.1.9", "activity": "", "evidence": [ { "id": "P21775", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21775" } ] } ] }, { "uniprot_ac": "P22307", "gene_name": "SCP2", "activity": [ { "ec_number": "2.3.1.176", "activity": "4,8,12-trimethyltridecanoyl-CoA + propanoyl-CoA = 3-oxopristanoyl-CoA + CoA.", "evidence": [ { "id": "P22307", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22307" } ] }, { "ec_number": "2.3.1.176", "activity": "", "evidence": [ { "id": "P22307", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22307" } ] }, { "ec_number": "2.3.1.16", "activity": "acetyl-CoA + an acyl-CoA = a 3-oxoacyl-CoA + CoA.", "evidence": [ { "id": "P22307", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22307" } ] }, { "ec_number": "2.3.1.155", "activity": "acetyl-CoA + tetradecanoyl-CoA = 3-oxohexadecanoyl-CoA + CoA.", "evidence": [ { "id": "P22307", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22307" } ] } ] }, { "uniprot_ac": "P22894", "gene_name": "MMP8", "activity": [ { "ec_number": "3.4.24.34", "activity": "Cleavage of interstitial collagens in the triple helical domain. Unlike EC 3.4.24.7, this enzyme cleaves type III collagen more slowly than type I.", "evidence": [ { "id": "P22894", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22894" } ] }, { "ec_number": "3.4.24.34", "activity": "", "evidence": [ { "id": "P22894", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22894" } ] } ] }, { "uniprot_ac": "P24752", "gene_name": "ACAT1", "activity": [ { "ec_number": "2.3.1.9", "activity": "2 acetyl-CoA = acetoacetyl-CoA + CoA.", "evidence": [ { "id": "P24752", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24752" } ] }, { "ec_number": "2.3.1.9", "activity": "", "evidence": [ { "id": "P24752", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24752" } ] } ] }, { "uniprot_ac": "P27796", "gene_name": "POT1", "activity": [ { "ec_number": "2.3.1.16", "activity": "acetyl-CoA + an acyl-CoA = a 3-oxoacyl-CoA + CoA.", "evidence": [ { "id": "P27796", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27796" } ] }, { "ec_number": "2.3.1.16", "activity": "", "evidence": [ { "id": "P27796", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27796" } ] } ] }, { "uniprot_ac": "P28328", "gene_name": "PEX2", "activity": [ { "ec_number": "2.3.2.36", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-cysteine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-S-ubiquitinyl-L-cysteine.", "evidence": [ { "id": "P28328", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28328" } ] }, { "ec_number": "2.3.2.36", "activity": "", "evidence": [ { "id": "P28328", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28328" } ] }, { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P28328", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28328" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "P28328", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28328" } ] } ] }, { "uniprot_ac": "P29350", "gene_name": "PTPN6", "activity": [ { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "P29350", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29350" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P29350", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29350" } ] } ] }, { "uniprot_ac": "P32020", "gene_name": "Scp2", "activity": [ { "ec_number": "2.3.1.176", "activity": "4,8,12-trimethyltridecanoyl-CoA + propanoyl-CoA = 3-oxopristanoyl-CoA + CoA.", "evidence": [ { "id": "P32020", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32020" } ] }, { "ec_number": "2.3.1.16", "activity": "acetyl-CoA + an acyl-CoA = a 3-oxoacyl-CoA + CoA.", "evidence": [ { "id": "P32020", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32020" } ] }, { "ec_number": "2.3.1.155", "activity": "acetyl-CoA + tetradecanoyl-CoA = 3-oxohexadecanoyl-CoA + CoA.", "evidence": [ { "id": "P32020", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32020" } ] } ] }, { "uniprot_ac": "P41338", "gene_name": "ERG10", "activity": [ { "ec_number": "2.3.1.9", "activity": "2 acetyl-CoA = acetoacetyl-CoA + CoA.", "evidence": [ { "id": "P41338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41338" } ] }, { "ec_number": "2.3.1.9", "activity": "", "evidence": [ { "id": "P41338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41338" } ] } ] }, { "uniprot_ac": "P42685", "gene_name": "FRK", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "P42685", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42685" } ] }, { "ec_number": "2.7.10.2", "activity": "", "evidence": [ { "id": "P42685", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42685" } ] } ] }, { "uniprot_ac": "P42765", "gene_name": "ACAA2", "activity": [ { "ec_number": "3.1.2.-", "activity": "", "evidence": [ { "id": "P42765", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42765" } ] }, { "ec_number": "3.1.2.2", "activity": "H2O + hexadecanoyl-CoA = CoA + H(+) + hexadecanoate.", "evidence": [ { "id": "P42765", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42765" } ] }, { "ec_number": "3.1.2.1", "activity": "acetyl-CoA + H2O = acetate + CoA + H(+).", "evidence": [ { "id": "P42765", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42765" } ] }, { "ec_number": "2.3.1.16", "activity": "acetyl-CoA + an acyl-CoA = a 3-oxoacyl-CoA + CoA.", "evidence": [ { "id": "P42765", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42765" } ] }, { "ec_number": "2.3.1.9", "activity": "2 acetyl-CoA = acetoacetyl-CoA + CoA.", "evidence": [ { "id": "P42765", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42765" } ] }, { "ec_number": "2.3.1.16", "activity": "", "evidence": [ { "id": "P42765", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42765" } ] } ] }, { "uniprot_ac": "P49184", "gene_name": "DNASE1L1", "activity": [ { "ec_number": "3.1.21.-", "activity": "", "evidence": [ { "id": "P49184", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49184" } ] } ] }, { "uniprot_ac": "P51159", "gene_name": "RAB27A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P51159", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51159" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P51159", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51159" } ] } ] }, { "uniprot_ac": "P55084", "gene_name": "HADHB", "activity": [ { "ec_number": "2.3.1.16", "activity": "acetyl-CoA + an acyl-CoA = a 3-oxoacyl-CoA + CoA.", "evidence": [ { "id": "P55084", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55084" } ] }, { "ec_number": "2.3.1.155", "activity": "acetyl-CoA + tetradecanoyl-CoA = 3-oxohexadecanoyl-CoA + CoA.", "evidence": [ { "id": "P55084", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55084" } ] }, { "ec_number": "2.3.1.16", "activity": "", "evidence": [ { "id": "P55084", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55084" } ] }, { "ec_number": "2.3.1.155", "activity": "", "evidence": [ { "id": "P55084", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55084" } ] } ] }, { "uniprot_ac": "P61626", "gene_name": "LYZ", "activity": [ { "ec_number": "3.2.1.17", "activity": "Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins.", "evidence": [ { "id": "P61626", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61626" } ] }, { "ec_number": "3.2.1.17", "activity": "", "evidence": [ { "id": "P61626", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61626" } ] } ] }, { "uniprot_ac": "Q13231", "gene_name": "CHIT1", "activity": [ { "ec_number": "3.2.1.14", "activity": "Random endo-hydrolysis of N-acetyl-beta-D-glucosaminide (1->4)-beta-linkages in chitin and chitodextrins.", "evidence": [ { "id": "Q13231", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13231" } ] }, { "ec_number": "3.2.1.14", "activity": "", "evidence": [ { "id": "Q13231", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13231" } ] } ] }, { "uniprot_ac": "Q16769", "gene_name": "QPCT", "activity": [ { "ec_number": "2.3.2.5", "activity": "N-terminal L-glutaminyl-[peptide] = N-terminal 5-oxo-L-prolyl-[peptide] + NH4(+).", "evidence": [ { "id": "Q16769", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16769" } ] }, { "ec_number": "2.3.2.5", "activity": "", "evidence": [ { "id": "Q16769", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16769" } ] } ] }, { "uniprot_ac": "Q2T9J0", "gene_name": "TYSND1", "activity": [ { "ec_number": "3.4.21.-", "activity": "", "evidence": [ { "id": "Q2T9J0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2T9J0" } ] } ] }, { "uniprot_ac": "Q5XI22", "gene_name": "Acat2", "activity": [ { "ec_number": "2.3.1.9", "activity": "2 acetyl-CoA = acetoacetyl-CoA + CoA.", "evidence": [ { "id": "Q5XI22", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XI22" } ] }, { "ec_number": "2.3.1.9", "activity": "", "evidence": [ { "id": "Q5XI22", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XI22" } ] } ] }, { "uniprot_ac": "Q60587", "gene_name": "Hadhb", "activity": [ { "ec_number": "2.3.1.16", "activity": "acetyl-CoA + an acyl-CoA = a 3-oxoacyl-CoA + CoA.", "evidence": [ { "id": "Q60587", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60587" } ] }, { "ec_number": "2.3.1.155", "activity": "acetyl-CoA + tetradecanoyl-CoA = 3-oxohexadecanoyl-CoA + CoA.", "evidence": [ { "id": "Q60587", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60587" } ] }, { "ec_number": "2.3.1.16", "activity": "", "evidence": [ { "id": "Q60587", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60587" } ] }, { "ec_number": "2.3.1.155", "activity": "", "evidence": [ { "id": "Q60587", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60587" } ] } ] }, { "uniprot_ac": "Q86AD9", "gene_name": "", "activity": [ { "ec_number": "2.3.1.9", "activity": "2 acetyl-CoA = acetoacetyl-CoA + CoA.", "evidence": [ { "id": "Q86AD9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86AD9" } ] }, { "ec_number": "2.3.1.9", "activity": "", "evidence": [ { "id": "Q86AD9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86AD9" } ] } ] }, { "uniprot_ac": "Q8BWT1", "gene_name": "Acaa2", "activity": [ { "ec_number": "3.1.2.-", "activity": "", "evidence": [ { "id": "Q8BWT1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BWT1" } ] }, { "ec_number": "3.1.2.2", "activity": "H2O + hexadecanoyl-CoA = CoA + H(+) + hexadecanoate.", "evidence": [ { "id": "Q8BWT1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BWT1" } ] }, { "ec_number": "3.1.2.1", "activity": "acetyl-CoA + H2O = acetate + CoA + H(+).", "evidence": [ { "id": "Q8BWT1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BWT1" } ] }, { "ec_number": "2.3.1.16", "activity": "acetyl-CoA + an acyl-CoA = a 3-oxoacyl-CoA + CoA.", "evidence": [ { "id": "Q8BWT1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BWT1" } ] }, { "ec_number": "2.3.1.9", "activity": "2 acetyl-CoA = acetoacetyl-CoA + CoA.", "evidence": [ { "id": "Q8BWT1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BWT1" } ] }, { "ec_number": "2.3.1.16", "activity": "", "evidence": [ { "id": "Q8BWT1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BWT1" } ] } ] }, { "uniprot_ac": "Q8CAY6", "gene_name": "Acat2", "activity": [ { "ec_number": "2.3.1.9", "activity": "2 acetyl-CoA = acetoacetyl-CoA + CoA.", "evidence": [ { "id": "Q8CAY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CAY6" } ] }, { "ec_number": "2.3.1.9", "activity": "", "evidence": [ { "id": "Q8CAY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CAY6" } ] } ] }, { "uniprot_ac": "Q8QZT1", "gene_name": "Acat1", "activity": [ { "ec_number": "2.3.1.9", "activity": "2 acetyl-CoA = acetoacetyl-CoA + CoA.", "evidence": [ { "id": "Q8QZT1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8QZT1" } ] }, { "ec_number": "2.3.1.9", "activity": "", "evidence": [ { "id": "Q8QZT1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8QZT1" } ] } ] }, { "uniprot_ac": "Q8VCH0", "gene_name": "Acaa1b", "activity": [ { "ec_number": "2.3.1.16", "activity": "acetyl-CoA + an acyl-CoA = a 3-oxoacyl-CoA + CoA.", "evidence": [ { "id": "Q8VCH0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCH0" } ] }, { "ec_number": "2.3.1.9", "activity": "2 acetyl-CoA = acetoacetyl-CoA + CoA.", "evidence": [ { "id": "Q8VCH0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCH0" } ] }, { "ec_number": "2.3.1.155", "activity": "acetyl-CoA + tetradecanoyl-CoA = 3-oxohexadecanoyl-CoA + CoA.", "evidence": [ { "id": "Q8VCH0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCH0" } ] }, { "ec_number": "2.3.1.9", "activity": "", "evidence": [ { "id": "Q8VCH0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCH0" } ] }, { "ec_number": "2.3.1.155", "activity": "", "evidence": [ { "id": "Q8VCH0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCH0" } ] }, { "ec_number": "2.3.1.16", "activity": "", "evidence": [ { "id": "Q8VCH0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCH0" } ] } ] }, { "uniprot_ac": "Q8WVQ1", "gene_name": "CANT1", "activity": [ { "ec_number": "3.6.1.6", "activity": "ADP + H2O = AMP + H(+) + phosphate.", "evidence": [ { "id": "Q8WVQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WVQ1" } ] }, { "ec_number": "3.6.1.6", "activity": "", "evidence": [ { "id": "Q8WVQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WVQ1" } ] } ] }, { "uniprot_ac": "Q921H8", "gene_name": "Acaa1a", "activity": [ { "ec_number": "2.3.1.9", "activity": "2 acetyl-CoA = acetoacetyl-CoA + CoA.", "evidence": [ { "id": "Q921H8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q921H8" } ] }, { "ec_number": "2.3.1.9", "activity": "", "evidence": [ { "id": "Q921H8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q921H8" } ] }, { "ec_number": "2.3.1.16", "activity": "acetyl-CoA + an acyl-CoA = a 3-oxoacyl-CoA + CoA.", "evidence": [ { "id": "Q921H8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q921H8" } ] }, { "ec_number": "2.3.1.155", "activity": "acetyl-CoA + tetradecanoyl-CoA = 3-oxohexadecanoyl-CoA + CoA.", "evidence": [ { "id": "Q921H8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q921H8" } ] }, { "ec_number": "2.3.1.16", "activity": "", "evidence": [ { "id": "Q921H8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q921H8" } ] } ] }, { "uniprot_ac": "Q92820", "gene_name": "GGH", "activity": [ { "ec_number": "3.4.19.9", "activity": "(6S)-5,6,7,8-tetrahydrofolyl-(gamma-L-Glu)(n) + (n-1) H2O = (6S)-5,6,7,8-tetrahydrofolate + (n-1) L-glutamate.", "evidence": [ { "id": "Q92820", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92820" } ] }, { "ec_number": "3.4.19.9", "activity": "", "evidence": [ { "id": "Q92820", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92820" } ] } ] }, { "uniprot_ac": "Q99519", "gene_name": "NEU1", "activity": [ { "ec_number": "3.2.1.18", "activity": "Hydrolysis of alpha-(2->3)-, alpha-(2->6)-, alpha-(2->8)- glycosidic linkages of terminal sialic acid residues in oligosaccharides, glycoproteins, glycolipids, colominic acid and synthetic substrates.", "evidence": [ { "id": "Q99519", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99519" } ] }, { "ec_number": "3.2.1.18", "activity": "", "evidence": [ { "id": "Q99519", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99519" } ] } ] }, { "uniprot_ac": "Q99JY0", "gene_name": "Hadhb", "activity": [ { "ec_number": "2.3.1.16", "activity": "acetyl-CoA + an acyl-CoA = a 3-oxoacyl-CoA + CoA.", "evidence": [ { "id": "Q99JY0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99JY0" } ] }, { "ec_number": "2.3.1.155", "activity": "acetyl-CoA + tetradecanoyl-CoA = 3-oxohexadecanoyl-CoA + CoA.", "evidence": [ { "id": "Q99JY0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99JY0" } ] } ] }, { "uniprot_ac": "Q9BWD1", "gene_name": "ACAT2", "activity": [ { "ec_number": "2.3.1.9", "activity": "2 acetyl-CoA = acetoacetyl-CoA + CoA.", "evidence": [ { "id": "Q9BWD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BWD1" } ] }, { "ec_number": "2.3.1.9", "activity": "", "evidence": [ { "id": "Q9BWD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BWD1" } ] } ] }, { "uniprot_ac": "Q9NQR4", "gene_name": "NIT2", "activity": [ { "ec_number": "3.5.1.3", "activity": "a monoamide of a dicarboxylate + H2O = a dicarboxylate + NH4(+).", "evidence": [ { "id": "Q9NQR4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQR4" } ] }, { "ec_number": "3.5.1.3", "activity": "", "evidence": [ { "id": "Q9NQR4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQR4" } ] } ] }, { "uniprot_ac": "Q9UBR2", "gene_name": "CTSZ", "activity": [ { "ec_number": "3.4.18.1", "activity": "Release of C-terminal amino acid residues with broad specificity, but lacks action on C-terminal proline. Shows weak endopeptidase activity.", "evidence": [ { "id": "Q9UBR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UBR2" } ] }, { "ec_number": "3.4.18.1", "activity": "", "evidence": [ { "id": "Q9UBR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UBR2" } ] } ] }, { "uniprot_ac": "Q9VJ43", "gene_name": "ScpX", "activity": [ { "ec_number": "2.3.1.176", "activity": "4,8,12-trimethyltridecanoyl-CoA + propanoyl-CoA = 3-oxopristanoyl-CoA + CoA.", "evidence": [ { "id": "Q9VJ43", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ43" } ] }, { "ec_number": "2.3.1.16", "activity": "acetyl-CoA + an acyl-CoA = a 3-oxoacyl-CoA + CoA.", "evidence": [ { "id": "Q9VJ43", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ43" } ] }, { "ec_number": "2.3.1.155", "activity": "acetyl-CoA + tetradecanoyl-CoA = 3-oxohexadecanoyl-CoA + CoA.", "evidence": [ { "id": "Q9VJ43", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ43" } ] }, { "ec_number": "2.3.1.176", "activity": "", "evidence": [ { "id": "Q9VJ43", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ43" } ] }, { "ec_number": "2.3.1.16", "activity": "", "evidence": [ { "id": "Q9VJ43", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ43" } ] }, { "ec_number": "2.3.1.155", "activity": "", "evidence": [ { "id": "Q9VJ43", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ43" } ] } ] }, { "uniprot_ac": "Q9Y251", "gene_name": "HPSE", "activity": [ { "ec_number": "3.2.1.166", "activity": "endohydrolysis of (1->4)-beta-D-glycosidic bonds of heparan sulfate chains in heparan sulfate proteoglycan.", "evidence": [ { "id": "Q9Y251", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y251" } ] }, { "ec_number": "3.2.1.166", "activity": "", "evidence": [ { "id": "Q9Y251", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y251" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [ 172 ], "glycation_sites": [], "phosphorylation_sites": [ 59, 60 ], "sequon_annotation_sites": [ { "start_pos": 139, "end_pos": 141 }, { "start_pos": 163, "end_pos": 165 }, { "start_pos": 274, "end_pos": 276 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 103 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }