{
"uniprot_canonical_ac": "P08684-1",
"uniprot_ac": "P08684",
"uniprot_id": "CP3A4_HUMAN",
"mass": {
"chemical_mass": 57343.0,
"monoisotopic_mass": 57343.0
},
"refseq": {
"ac": "NP_001189784",
"name": "cytochrome P450 3A4 isoform 2",
"summary": "This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by glucocorticoids and some pharmacological agents. This enzyme is involved in the metabolism of approximately half the drugs in use today, including acetaminophen, codeine, cyclosporin A, diazepam, erythromycin, and chloroquine. The enzyme also metabolizes some steroids and carcinogens. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Previously another CYP3A gene, CYP3A3, was thought to exist; however, it is now thought that this sequence represents a transcript variant of CYP3A4. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2020].",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001189784"
},
"gene_names": [
{
"name": "CYP3A4",
"resource": "UniProtKB",
"type": "recommended",
"url": "https://www.uniprot.org/uniprot/P08684",
"id": "P08684"
},
{
"name": "CP33; CP34; CYP3A; CYP3A3; CYPIIIA3; CYPIIIA4; HLP; NF-25; P450C3; P450PCN1; VDDR3",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001189784",
"id": "NP_001189784"
},
{
"name": "CYP3A3",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/P08684",
"id": "P08684"
},
{
"name": "CYP3A4",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001189784",
"id": "NP_001189784"
}
],
"protein_names": [
{
"name": "Cytochrome P450 3A4",
"resource": "UniProtKB",
"type": "recommended",
"url": "",
"id": "P08684"
},
{
"name": "1,4-cineole 2-exo-monooxygenase",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P08684"
},
{
"name": "1,8-cineole 2-exo-monooxygenase",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P08684"
},
{
"name": "1.14.14.1",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P08684"
},
{
"name": "1.14.14.55",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P08684"
},
{
"name": "1.14.14.56",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P08684"
},
{
"name": "1.14.14.73",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P08684"
},
{
"name": "Albendazole monooxygenase (sulfoxide-forming)",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P08684"
},
{
"name": "Albendazole sulfoxidase",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P08684"
},
{
"name": "CYPIIIA3",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P08684"
},
{
"name": "CYPIIIA4",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P08684"
},
{
"name": "Cholesterol 25-hydroxylase",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P08684"
},
{
"name": "Cytochrome P450 3A3",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P08684"
},
{
"name": "Cytochrome P450 HLp",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P08684"
},
{
"name": "Cytochrome P450 NF-25",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P08684"
},
{
"name": "Cytochrome P450-PCN1",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P08684"
},
{
"name": "Nifedipine oxidase",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P08684"
},
{
"name": "P450-III, steroid inducible; glucocorticoid-inducible P450; nifedipine oxidase; cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 4; cytochrome P450 3A3; cytochrome P450 3A4; cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 3; cytochrome P450 HLp; cytochrome P450-PCN1; cytochrome P450 NF-25; albendazole sulfoxidase; quinine 3-monooxygenase; taurochenodeoxycholate 6-alpha-hydroxylase; 1,8-cineole 2-exo-monooxygenase; cholesterol 25-hydroxylase; cytochrome P450, family 3, subfamily A, polypeptide 4; 1,4-cineole 2-exo-monooxygenase; albendazole monooxygenase (sulfoxide-forming)",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001189784",
"id": "NP_001189784"
},
{
"name": "Quinine 3-monooxygenase",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P08684"
},
{
"name": "cytochrome P450 3A4 isoform 2",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001189784",
"id": "NP_001189784"
}
],
"function": [
{
"annotation": "A cytochrome P450 monooxygenase involved in the metabolism of sterols, steroid hormones, retinoids and fatty acids (PubMed:10681376, PubMed:11093772, PubMed:11555828, PubMed:14559847, PubMed:12865317, PubMed:15373842, PubMed:15764715, PubMed:20702771, PubMed:19965576, PubMed:21490593, PubMed:21576599). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase). Catalyzes the hydroxylation of carbon-hydrogen bonds (PubMed:2732228, PubMed:14559847, PubMed:12865317, PubMed:15373842, PubMed:15764715, PubMed:21576599, PubMed:21490593). Exhibits high catalytic activity for the formation of hydroxyestrogens from estrone (E1) and 17beta-estradiol (E2), namely 2-hydroxy E1 and E2, as well as D-ring hydroxylated E1 and E2 at the C-16 position (PubMed:11555828, PubMed:14559847, PubMed:12865317). Plays a role in the metabolism of androgens, particularly in oxidative deactivation of testosterone (PubMed:2732228, PubMed:15373842, PubMed:15764715, PubMed:22773874). Metabolizes testosterone to less biologically active 2beta- and 6beta-hydroxytestosterones (PubMed:2732228, PubMed:15373842, PubMed:15764715). Contributes to the formation of hydroxycholesterols (oxysterols), particularly A-ring hydroxylated cholesterol at the C-4beta position, and side chain hydroxylated cholesterol at the C-25 position, likely contributing to cholesterol degradation and bile acid biosynthesis (PubMed:21576599). Catalyzes bisallylic hydroxylation of polyunsaturated fatty acids (PUFA) (PubMed:9435160). Catalyzes the epoxidation of double bonds of PUFA with a preference for the last double bond (PubMed:19965576). Metabolizes endocannabinoid arachidonoylethanolamide (anandamide) to 8,9-, 11,12-, and 14,15-epoxyeicosatrienoic acid ethanolamides (EpETrE-EAs), potentially modulating endocannabinoid system signaling (PubMed:20702771). Plays a role in the metabolism of retinoids. Displays high catalytic activity for oxidation of all-trans-retinol to all-trans-retinal, a rate-limiting step for the biosynthesis of all-trans-retinoic acid (atRA) (PubMed:10681376). Further metabolizes atRA toward 4-hydroxyretinoate and may play a role in hepatic atRA clearance (PubMed:11093772). Responsible for oxidative metabolism of xenobiotics. Acts as a 2-exo-monooxygenase for plant lipid 1,8-cineole (eucalyptol) (PubMed:11159812). Metabolizes the majority of the administered drugs. Catalyzes sulfoxidation of the anthelmintics albendazole and fenbendazole (PubMed:10759686). Hydroxylates antimalarial drug quinine (PubMed:8968357). Acts as a 1,4-cineole 2-exo-monooxygenase (PubMed:11695850). Also involved in vitamin D catabolism and calcium homeostasis. Catalyzes the inactivation of the active hormone calcitriol (1-alpha,25-dihydroxyvitamin D(3)) (PubMed:29461981).",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684#function"
},
{
"database": "PubMed",
"id": "11159812",
"url": "https://glygen.org/publication/PubMed/11159812"
},
{
"database": "PubMed",
"id": "22773874",
"url": "https://glygen.org/publication/PubMed/22773874"
},
{
"database": "PubMed",
"id": "11555828",
"url": "https://glygen.org/publication/PubMed/11555828"
},
{
"database": "PubMed",
"id": "20702771",
"url": "https://glygen.org/publication/PubMed/20702771"
},
{
"database": "PubMed",
"id": "9435160",
"url": "https://glygen.org/publication/PubMed/9435160"
},
{
"database": "PubMed",
"id": "2732228",
"url": "https://glygen.org/publication/PubMed/2732228"
},
{
"database": "PubMed",
"id": "8968357",
"url": "https://glygen.org/publication/PubMed/8968357"
},
{
"database": "PubMed",
"id": "10681376",
"url": "https://glygen.org/publication/PubMed/10681376"
},
{
"database": "PubMed",
"id": "11695850",
"url": "https://glygen.org/publication/PubMed/11695850"
},
{
"database": "PubMed",
"id": "21576599",
"url": "https://glygen.org/publication/PubMed/21576599"
},
{
"database": "PubMed",
"id": "11093772",
"url": "https://glygen.org/publication/PubMed/11093772"
},
{
"database": "PubMed",
"id": "19965576",
"url": "https://glygen.org/publication/PubMed/19965576"
},
{
"database": "PubMed",
"id": "15764715",
"url": "https://glygen.org/publication/PubMed/15764715"
},
{
"database": "PubMed",
"id": "21490593",
"url": "https://glygen.org/publication/PubMed/21490593"
},
{
"database": "PubMed",
"id": "15373842",
"url": "https://glygen.org/publication/PubMed/15373842"
},
{
"database": "PubMed",
"id": "10759686",
"url": "https://glygen.org/publication/PubMed/10759686"
},
{
"database": "PubMed",
"id": "29461981",
"url": "https://glygen.org/publication/PubMed/29461981"
},
{
"database": "PubMed",
"id": "12865317",
"url": "https://glygen.org/publication/PubMed/12865317"
},
{
"database": "PubMed",
"id": "14559847",
"url": "https://glygen.org/publication/PubMed/14559847"
}
]
},
{
"annotation": "Association between CYP3A4/CYP3A5 genetic polymorphisms and treatment outcomes of atorvastatin worldwide: is there enough research on the Egyptian population? Review article Publication Status: Online-Only",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001189784",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001189784"
},
{
"database": "PubMed",
"id": "37759317",
"url": "https://glygen.org/publication/PubMed/37759317"
}
]
},
{
"annotation": "Cytochrome P4503A4 gene polymorphisms guide safe sufentanil analgesic doses in pregnant Chinese mothers: a multicenter, randomized, prospective study.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001189784",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001189784"
},
{
"database": "PubMed",
"id": "37962984",
"url": "https://glygen.org/publication/PubMed/37962984"
}
]
},
{
"annotation": "Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.",
"evidence": [
{
"database": "UniProtKB",
"id": "A0A499FJM4",
"url": "https://www.uniprot.org/uniprot/A0A499FJM4#function"
},
{
"database": "UniProtKB",
"id": "RU368049",
"url": "https://www.uniprot.org/uniprot/RU368049#function"
}
]
},
{
"annotation": "Down-Regulation of CYP3A4 by the KCa1.1 Inhibition Is Responsible for Overcoming Resistance to Doxorubicin in Cancer Spheroid Models. Publication Status: Online-Only",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001189784",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001189784"
},
{
"database": "PubMed",
"id": "37958656",
"url": "https://glygen.org/publication/PubMed/37958656"
}
]
},
{
"annotation": "The impacts of CYP3A4 genetic polymorphism and drug interactions on the metabolism of lurasidone.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001189784",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001189784"
},
{
"database": "PubMed",
"id": "37935069",
"url": "https://glygen.org/publication/PubMed/37935069"
}
]
},
{
"annotation": "The roles of CYP2C19 and CYP3A4 in the in vitro metabolism of beta-eudesmol in human liver: Reaction phenotyping and enzyme kinetics.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001189784",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001189784"
},
{
"database": "PubMed",
"id": "37902256",
"url": "https://glygen.org/publication/PubMed/37902256"
}
]
},
{
"annotation": "This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by glucocorticoids and some pharmacological agents. This enzyme is involved in the metabolism of approximately half the drugs in use today, including acetaminophen, codeine, cyclosporin A, diazepam, erythromycin, and chloroquine. The enzyme also metabolizes some steroids and carcinogens. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Previously another CYP3A gene, CYP3A3, was thought to exist; however, it is now thought that this sequence represents a transcript variant of CYP3A4. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2020].",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001189784",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001189784"
}
]
}
],
"disease": [
{
"disease_id": "MONDO:0033640",
"recommended_name": {
"id": "MONDO:0033640",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0033640",
"name": "vitamin D-dependent rickets, type 3",
"description": ""
},
"synonyms": [
{
"id": "MONDO:0033640",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0033640",
"name": "VDDR3",
"description": ""
},
{
"id": "MIM:619073",
"resource": "MIM",
"url": "https://www.omim.org/entry/619073",
"name": "Vitamin D-dependent rickets 3",
"description": "Vitamin D-dependent rickets 3"
}
],
"evidence": [
{
"id": "619073",
"database": "MIM",
"url": "https://www.omim.org/entry/619073"
}
]
}
],
"snv": [],
"mutagenesis": [],
"expression_tissue": [
{
"tissue": {
"name": "Adult mammalian kidney",
"namespace": "UBERON",
"id": "0000082",
"url": "http://purl.obolibrary.org/obo/UBERON_0000082"
},
"score": "75.97",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000160868",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000160868"
}
]
},
{
"tissue": {
"name": "Oral cavity",
"namespace": "UBERON",
"id": "0000167",
"url": "http://purl.obolibrary.org/obo/UBERON_0000167"
},
"score": "68.43",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000160868",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000160868"
}
]
},
{
"tissue": {
"name": "Stomach",
"namespace": "UBERON",
"id": "0000945",
"url": "http://purl.obolibrary.org/obo/UBERON_0000945"
},
"score": "63.04",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000160868",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000160868"
}
]
},
{
"tissue": {
"name": "Uterus",
"namespace": "UBERON",
"id": "0000995",
"url": "http://purl.obolibrary.org/obo/UBERON_0000995"
},
"score": "93.87",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000160868",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000160868"
}
]
},
{
"tissue": {
"name": "Esophagus",
"namespace": "UBERON",
"id": "0001043",
"url": "http://purl.obolibrary.org/obo/UBERON_0001043"
},
"score": "61.51",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000160868",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000160868"
}
]
},
{
"tissue": {
"name": "Rectum",
"namespace": "UBERON",
"id": "0001052",
"url": "http://purl.obolibrary.org/obo/UBERON_0001052"
},
"score": "76.13",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000160868",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000160868"
}
]
},
{
"tissue": {
"name": "Colon",
"namespace": "UBERON",
"id": "0001155",
"url": "http://purl.obolibrary.org/obo/UBERON_0001155"
},
"score": "87.95",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000160868",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000160868"
}
]
},
{
"tissue": {
"name": "Urinary bladder",
"namespace": "UBERON",
"id": "0001255",
"url": "http://purl.obolibrary.org/obo/UBERON_0001255"
},
"score": "56.72",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000160868",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000160868"
}
]
},
{
"tissue": {
"name": "Thyroid gland",
"namespace": "UBERON",
"id": "0002046",
"url": "http://purl.obolibrary.org/obo/UBERON_0002046"
},
"score": "54.85",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000160868",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000160868"
}
]
},
{
"tissue": {
"name": "Lung",
"namespace": "UBERON",
"id": "0002048",
"url": "http://purl.obolibrary.org/obo/UBERON_0002048"
},
"score": "86.45",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000160868",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000160868"
}
]
},
{
"tissue": {
"name": "Liver",
"namespace": "UBERON",
"id": "0002107",
"url": "http://purl.obolibrary.org/obo/UBERON_0002107"
},
"score": "99.23",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000160868",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000160868"
}
]
},
{
"tissue": {
"name": "Prostate gland",
"namespace": "UBERON",
"id": "0002367",
"url": "http://purl.obolibrary.org/obo/UBERON_0002367"
},
"score": "56.08",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000160868",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000160868"
}
]
},
{
"tissue": {
"name": "Thoracic mammary gland",
"namespace": "UBERON",
"id": "0005200",
"url": "http://purl.obolibrary.org/obo/UBERON_0005200"
},
"score": "55.82",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000160868",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000160868"
}
]
}
],
"expression_disease": [
{
"significant": "Yes",
"trend": "up",
"name": "Prostate cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10283",
"evidence": [
{
"database": "BioXpress",
"id": "P08684",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08684"
}
],
"disease": [
{
"disease_id": "DOID:10283",
"recommended_name": {
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer",
"description": "A male reproductive organ cancer that is located_in the prostate."
},
"synonyms": [
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "NGP - new growth of prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "malignant tumor of the prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "tumor of the prostate",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, type 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "HPC9",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "EHBP1 familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "familial prostate cancer caused by mutation in EHBP1",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, type 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "HPC12",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, type 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "HPC5",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, type 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, susceptibility to, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "HPC3",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, type 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, susceptibility to, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "HPC4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, on chromosome 7",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "MSMB familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "familial prostate cancer caused by mutation in MSMB",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, type 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "HPC13",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, type 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "HPC8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "predisposing for prostate cancer",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, type 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "HPC6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "HPC10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate carcinoma",
"description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate carcinoma",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, somatic",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, hereditary",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "HPC7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer aggressiveness",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "RNASEL familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "familial prostate cancer caused by mutation in RNASEL",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, type 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "HPC1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "Prca1",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "HPC11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "HPC14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "HPC15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "HPCX1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer susceptibility, X-linked",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "HPCX2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MIM:611868",
"resource": "MIM",
"url": "https://www.omim.org/entry/611868",
"name": "Prostate cancer, hereditary, 12",
"description": "Prostate cancer, hereditary, 12"
},
{
"id": "MIM:611928",
"resource": "MIM",
"url": "https://www.omim.org/entry/611928",
"name": "Prostate cancer, hereditary, 13",
"description": "Prostate cancer, hereditary, 13"
},
{
"id": "MIM:176807",
"resource": "MIM",
"url": "https://www.omim.org/entry/176807",
"name": "Prostate cancer",
"description": "Prostate cancer"
},
{
"id": "MIM:601518",
"resource": "MIM",
"url": "https://www.omim.org/entry/601518",
"name": "Prostate cancer, hereditary, 1",
"description": "Prostate cancer, hereditary, 1"
},
{
"id": "MIM:611955",
"resource": "MIM",
"url": "https://www.omim.org/entry/611955",
"name": "Prostate cancer, hereditary, 11",
"description": "Prostate cancer, hereditary, 11"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Stomach cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10534",
"evidence": [
{
"database": "BioXpress",
"id": "P08684",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08684"
}
],
"disease": [
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Urinary bladder cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11054",
"evidence": [
{
"database": "BioXpress",
"id": "P08684",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08684"
}
],
"disease": [
{
"disease_id": "DOID:11054",
"recommended_name": {
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "urinary bladder cancer",
"description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
},
"synonyms": [
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "bladder cancer",
"description": ""
},
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": "A primary or metastatic malignant neoplasm involving the bladder."
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "bladder cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "cancer of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumour",
"description": ""
},
{
"id": "MIM:109800",
"resource": "MIM",
"url": "https://www.omim.org/entry/109800",
"name": "Bladder cancer",
"description": "Bladder cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Head and neck cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11934",
"evidence": [
{
"database": "BioXpress",
"id": "P08684",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08684"
}
],
"disease": [
{
"disease_id": "DOID:11934",
"recommended_name": {
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck cancer",
"description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx."
},
"synonyms": [
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck tumours",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head/neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "tumor of head and neck",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Lung cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1324",
"evidence": [
{
"database": "BioXpress",
"id": "P08684",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08684"
}
],
"disease": [
{
"disease_id": "DOID:1324",
"recommended_name": {
"id": "DOID:1324",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1324",
"name": "lung cancer",
"description": "A respiratory system cancer that is located_in the lung."
},
"synonyms": [
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "LNCR1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "LNCR3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "adenocarcinoma of lung, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "LNCR4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "LNCR5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": "A malignant neoplasm involving the lung."
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "cancer of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung neoplasm",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumor",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumour",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "Nonsmall cell lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "alveolar cell carcinoma",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung neoplasm",
"description": ""
},
{
"id": "MIM:211980",
"resource": "MIM",
"url": "https://www.omim.org/entry/211980",
"name": "Lung cancer",
"description": "Lung cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Breast cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1612",
"evidence": [
{
"database": "BioXpress",
"id": "P08684",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08684"
}
],
"disease": [
{
"disease_id": "DOID:1612",
"recommended_name": {
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast cancer",
"description": "A thoracic cancer that originates in the mammary gland."
},
"synonyms": [
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant neoplasm of breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant tumor of the breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary cancer",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "primary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, lobular, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of the breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial Male",
"description": ""
},
{
"id": "MIM:114480",
"resource": "MIM",
"url": "https://www.omim.org/entry/114480",
"name": "Breast cancer",
"description": "Breast cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Thyroid cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1781",
"evidence": [
{
"database": "BioXpress",
"id": "P08684",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08684"
}
],
"disease": [
{
"disease_id": "DOID:1781",
"recommended_name": {
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid cancer",
"description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage."
},
"synonyms": [
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid gland cancer",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "Thyroid gland neoplasm",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant tumour of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Kidney cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:263",
"evidence": [
{
"database": "BioXpress",
"id": "P08684",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08684"
}
],
"disease": [
{
"disease_id": "DOID:263",
"recommended_name": {
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "kidney cancer",
"description": "A urinary system cancer that is located_in the kidney."
},
"synonyms": [
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant neoplasm of kidney except pelvis",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant tumour of kidney",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "renal cancer",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Liver cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:3571",
"evidence": [
{
"database": "BioXpress",
"id": "P08684",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08684"
}
],
"disease": [
{
"disease_id": "DOID:3571",
"recommended_name": {
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "liver cancer",
"description": "A hepatobiliary system cancer that is located_in the liver."
},
"synonyms": [
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Ca liver - primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Resectable malignant neoplasm of Liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant hepato-biliary neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant tumor of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "non-resectable primary hepatic malignant neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary liver cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "resectable malignant neoplasm of the liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, not specified as primary or secondary",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Uterine cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:363",
"evidence": [
{
"database": "BioXpress",
"id": "P08684",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08684"
}
],
"disease": [
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Esophageal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:5041",
"evidence": [
{
"database": "BioXpress",
"id": "P08684",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08684"
}
],
"disease": [
{
"disease_id": "DOID:5041",
"recommended_name": {
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophageal cancer",
"description": "A gastrointestinal system cancer that is located_in the esophagus."
},
"synonyms": [
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophagus cancer",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Distal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Proximal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of the middle Third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": "A primary or metastatic malignant neoplasm involving the esophagus."
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "oesophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the middle third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of abdominal oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the middle third of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Aerodigestive tract cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Escc, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "gastric cardia adenocarcinoma, susceptibility to",
"description": ""
},
{
"id": "MIM:133239",
"resource": "MIM",
"url": "https://www.omim.org/entry/133239",
"name": "Esophageal cancer",
"description": "Esophageal cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Colorectal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:9256",
"evidence": [
{
"database": "BioXpress",
"id": "P08684",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08684"
}
],
"disease": [
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
}
]
}
],
"species": [
{
"name": "Homo sapiens",
"taxid": 9606,
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"common_name": "Human"
}
],
"gene": [
{
"name": "CYP3A4",
"url": "https://www.uniprot.org/uniprot/P08684",
"locus": {
"chromosome": "7",
"start_pos": 99756960,
"end_pos": 99784248,
"strand": "+",
"evidence": [
{
"database": "Ensembl Gene",
"id": "ENSG00000160868",
"url": "https://www.ensembl.org/id/ENSG00000160868"
}
]
}
}
],
"crossref": [
{
"id": "ENSG00000160868",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000160868",
"database": "Bgee",
"categories": [
"Gene Expression"
]
},
{
"id": "1.14.14.55",
"url": "https://www.brenda-enzymes.org/enzyme.php?ecno=1.14.14.55&UniProtAcc=P08684",
"database": "BRENDA",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "1.14.14.73",
"url": "https://www.brenda-enzymes.org/enzyme.php?ecno=1.14.14.73&UniProtAcc=P08684",
"database": "BRENDA",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "1.14.99.38",
"url": "https://www.brenda-enzymes.org/enzyme.php?ecno=1.14.99.38&UniProtAcc=P08684",
"database": "BRENDA",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "cd20650",
"url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20650",
"database": "CDD",
"categories": [
"Protein Classification"
]
},
{
"id": "CHEMBL340",
"url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL340",
"database": "ChEMBL",
"categories": [
"Other"
]
},
{
"id": "CYP3A4",
"url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CYP3A4",
"database": "GeneCards",
"categories": [
"Gene Annotation",
"Organism-specific"
]
},
{
"id": "1576",
"url": "https://www.ncbi.nlm.nih.gov/gene/1576",
"database": "GeneID",
"categories": [
"Genome Annotation"
]
},
{
"id": "2637",
"url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=2637",
"database": "HGNC",
"categories": [
"Organism-specific"
]
},
{
"id": "P08684",
"url": "https://www.ebi.ac.uk/intact/interactors/id:P08684*",
"database": "IntAct",
"categories": [
"Other"
]
},
{
"id": "IPR001128",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR001128",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR002401",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR002401",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR002402",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR002402",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR008072",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR008072",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR017972",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR017972",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR036396",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR036396",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "hsa:1576",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1576",
"database": "KEGG Pathway",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "124010",
"url": "http://www.omim.org/entry/124010",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "619073",
"url": "http://www.omim.org/entry/619073",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "NX_P08684",
"url": "https://www.nextprot.org/entry/NX_P08684",
"database": "neXtProt",
"categories": [
"Protein",
"Organism-specific"
]
},
{
"id": "MYPPIAN",
"url": "https://omabrowser.org/oma/group/MYPPIAN/",
"database": "OMA",
"categories": [
"Protein Classification"
]
},
{
"id": "1611592at2759",
"url": "http://www.orthodb.org/?query=1611592at2759",
"database": "OrthoDB",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR24302",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24302",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR24302:SF38",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24302:SF38",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "1TQN",
"url": "https://www.rcsb.org/structure/1TQN",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1W0E",
"url": "https://www.rcsb.org/structure/1W0E",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1W0F",
"url": "https://www.rcsb.org/structure/1W0F",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1W0G",
"url": "https://www.rcsb.org/structure/1W0G",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2J0D",
"url": "https://www.rcsb.org/structure/2J0D",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2V0M",
"url": "https://www.rcsb.org/structure/2V0M",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3NXU",
"url": "https://www.rcsb.org/structure/3NXU",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3TJS",
"url": "https://www.rcsb.org/structure/3TJS",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3UA1",
"url": "https://www.rcsb.org/structure/3UA1",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4D6Z",
"url": "https://www.rcsb.org/structure/4D6Z",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4D75",
"url": "https://www.rcsb.org/structure/4D75",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4D78",
"url": "https://www.rcsb.org/structure/4D78",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4D7D",
"url": "https://www.rcsb.org/structure/4D7D",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4I3Q",
"url": "https://www.rcsb.org/structure/4I3Q",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4I4G",
"url": "https://www.rcsb.org/structure/4I4G",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4I4H",
"url": "https://www.rcsb.org/structure/4I4H",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4K9T",
"url": "https://www.rcsb.org/structure/4K9T",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4K9U",
"url": "https://www.rcsb.org/structure/4K9U",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4K9V",
"url": "https://www.rcsb.org/structure/4K9V",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4K9W",
"url": "https://www.rcsb.org/structure/4K9W",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4K9X",
"url": "https://www.rcsb.org/structure/4K9X",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4NY4",
"url": "https://www.rcsb.org/structure/4NY4",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5A1P",
"url": "https://www.rcsb.org/structure/5A1P",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5A1R",
"url": "https://www.rcsb.org/structure/5A1R",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5G5J",
"url": "https://www.rcsb.org/structure/5G5J",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5TE8",
"url": "https://www.rcsb.org/structure/5TE8",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5VC0",
"url": "https://www.rcsb.org/structure/5VC0",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5VCC",
"url": "https://www.rcsb.org/structure/5VCC",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5VCD",
"url": "https://www.rcsb.org/structure/5VCD",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5VCE",
"url": "https://www.rcsb.org/structure/5VCE",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5VCG",
"url": "https://www.rcsb.org/structure/5VCG",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6BCZ",
"url": "https://www.rcsb.org/structure/6BCZ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6BD5",
"url": "https://www.rcsb.org/structure/6BD5",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6BD6",
"url": "https://www.rcsb.org/structure/6BD6",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6BD7",
"url": "https://www.rcsb.org/structure/6BD7",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6BD8",
"url": "https://www.rcsb.org/structure/6BD8",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6BDH",
"url": "https://www.rcsb.org/structure/6BDH",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6BDI",
"url": "https://www.rcsb.org/structure/6BDI",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6BDK",
"url": "https://www.rcsb.org/structure/6BDK",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6BDM",
"url": "https://www.rcsb.org/structure/6BDM",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6OO9",
"url": "https://www.rcsb.org/structure/6OO9",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6OOA",
"url": "https://www.rcsb.org/structure/6OOA",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6OOB",
"url": "https://www.rcsb.org/structure/6OOB",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7KS8",
"url": "https://www.rcsb.org/structure/7KS8",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7KSA",
"url": "https://www.rcsb.org/structure/7KSA",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7KVH",
"url": "https://www.rcsb.org/structure/7KVH",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7KVI",
"url": "https://www.rcsb.org/structure/7KVI",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7KVJ",
"url": "https://www.rcsb.org/structure/7KVJ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7KVK",
"url": "https://www.rcsb.org/structure/7KVK",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7KVM",
"url": "https://www.rcsb.org/structure/7KVM",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7KVN",
"url": "https://www.rcsb.org/structure/7KVN",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7KVO",
"url": "https://www.rcsb.org/structure/7KVO",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7KVP",
"url": "https://www.rcsb.org/structure/7KVP",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7KVQ",
"url": "https://www.rcsb.org/structure/7KVQ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7KVS",
"url": "https://www.rcsb.org/structure/7KVS",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7LXL",
"url": "https://www.rcsb.org/structure/7LXL",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7UAY",
"url": "https://www.rcsb.org/structure/7UAY",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7UAZ",
"url": "https://www.rcsb.org/structure/7UAZ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7UF9",
"url": "https://www.rcsb.org/structure/7UF9",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7UFA",
"url": "https://www.rcsb.org/structure/7UFA",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7UFB",
"url": "https://www.rcsb.org/structure/7UFB",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7UFC",
"url": "https://www.rcsb.org/structure/7UFC",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7UFD",
"url": "https://www.rcsb.org/structure/7UFD",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7UFE",
"url": "https://www.rcsb.org/structure/7UFE",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7UFF",
"url": "https://www.rcsb.org/structure/7UFF",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8DYC",
"url": "https://www.rcsb.org/structure/8DYC",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8EWD",
"url": "https://www.rcsb.org/structure/8EWD",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8EWE",
"url": "https://www.rcsb.org/structure/8EWE",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8EWL",
"url": "https://www.rcsb.org/structure/8EWL",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8EWM",
"url": "https://www.rcsb.org/structure/8EWM",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8EWN",
"url": "https://www.rcsb.org/structure/8EWN",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8EWP",
"url": "https://www.rcsb.org/structure/8EWP",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8EWQ",
"url": "https://www.rcsb.org/structure/8EWQ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8EWR",
"url": "https://www.rcsb.org/structure/8EWR",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8EWS",
"url": "https://www.rcsb.org/structure/8EWS",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8EXB",
"url": "https://www.rcsb.org/structure/8EXB",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8SO1",
"url": "https://www.rcsb.org/structure/8SO1",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8SO2",
"url": "https://www.rcsb.org/structure/8SO2",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "PF00067",
"url": "http://pfam.xfam.org/family/PF00067",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "P08684",
"url": "https://pharos.nih.gov/targets/P08684",
"database": "PHAROS",
"categories": [
"Organism-specific"
]
},
{
"id": "PR_P08684",
"url": "http://purl.obolibrary.org/obo/PR_P08684",
"database": "PRO",
"categories": [
"Protein"
]
},
{
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-211981",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-5423646",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9027307",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027307",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9754706",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "NP_001189784",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001189784",
"database": "RefSeq",
"categories": [
"Protein"
]
},
{
"id": "17149",
"url": "https://www.rhea-db.org/rhea/17149",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "20149",
"url": "https://www.rhea-db.org/rhea/20149",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "32895",
"url": "https://www.rhea-db.org/rhea/32895",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "39779",
"url": "https://www.rhea-db.org/rhea/39779",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "42092",
"url": "https://www.rhea-db.org/rhea/42092",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "46128",
"url": "https://www.rhea-db.org/rhea/46128",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "46140",
"url": "https://www.rhea-db.org/rhea/46140",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "46144",
"url": "https://www.rhea-db.org/rhea/46144",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "46296",
"url": "https://www.rhea-db.org/rhea/46296",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "47204",
"url": "https://www.rhea-db.org/rhea/47204",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "47208",
"url": "https://www.rhea-db.org/rhea/47208",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "47212",
"url": "https://www.rhea-db.org/rhea/47212",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "47252",
"url": "https://www.rhea-db.org/rhea/47252",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "47256",
"url": "https://www.rhea-db.org/rhea/47256",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "47260",
"url": "https://www.rhea-db.org/rhea/47260",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "47280",
"url": "https://www.rhea-db.org/rhea/47280",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "47292",
"url": "https://www.rhea-db.org/rhea/47292",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "47332",
"url": "https://www.rhea-db.org/rhea/47332",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "47336",
"url": "https://www.rhea-db.org/rhea/47336",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "49160",
"url": "https://www.rhea-db.org/rhea/49160",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "49856",
"url": "https://www.rhea-db.org/rhea/49856",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "49860",
"url": "https://www.rhea-db.org/rhea/49860",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "50256",
"url": "https://www.rhea-db.org/rhea/50256",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "50264",
"url": "https://www.rhea-db.org/rhea/50264",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "51984",
"url": "https://www.rhea-db.org/rhea/51984",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "52120",
"url": "https://www.rhea-db.org/rhea/52120",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "52124",
"url": "https://www.rhea-db.org/rhea/52124",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "52284",
"url": "https://www.rhea-db.org/rhea/52284",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "52288",
"url": "https://www.rhea-db.org/rhea/52288",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "52292",
"url": "https://www.rhea-db.org/rhea/52292",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "52296",
"url": "https://www.rhea-db.org/rhea/52296",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "53140",
"url": "https://www.rhea-db.org/rhea/53140",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "53144",
"url": "https://www.rhea-db.org/rhea/53144",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "53148",
"url": "https://www.rhea-db.org/rhea/53148",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "53200",
"url": "https://www.rhea-db.org/rhea/53200",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "53212",
"url": "https://www.rhea-db.org/rhea/53212",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "53260",
"url": "https://www.rhea-db.org/rhea/53260",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "53264",
"url": "https://www.rhea-db.org/rhea/53264",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "53444",
"url": "https://www.rhea-db.org/rhea/53444",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "55828",
"url": "https://www.rhea-db.org/rhea/55828",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "55832",
"url": "https://www.rhea-db.org/rhea/55832",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "55924",
"url": "https://www.rhea-db.org/rhea/55924",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "55928",
"url": "https://www.rhea-db.org/rhea/55928",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "A0A494C0W7",
"url": "https://www.uniprot.org/uniprot/A0A494C0W7",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A494C0W7-1",
"url": "https://www.uniprot.org/uniprot/A0A494C0W7-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A499FJM4",
"url": "https://www.uniprot.org/uniprot/A0A499FJM4",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A499FJM4-1",
"url": "https://www.uniprot.org/uniprot/A0A499FJM4-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "C9JBD2",
"url": "https://www.uniprot.org/uniprot/C9JBD2",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "C9JBD2-1",
"url": "https://www.uniprot.org/uniprot/C9JBD2-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E7EVM8",
"url": "https://www.uniprot.org/uniprot/E7EVM8",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E7EVM8-1",
"url": "https://www.uniprot.org/uniprot/E7EVM8-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P08684-1",
"url": "https://www.uniprot.org/uniprot/P08684-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
}
],
"sequence": {
"sequence": "MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDGTVSGA",
"length": 503,
"header": "sp|P08684-1|CP3A4_HUMAN Isoform 1 of Cytochrome P450 3A4 OS=Homo sapiens OX=9606 GN=CYP3A4 PE=1 SV=4 CANONICAL=P08684-1"
},
"isoforms": [
{
"isoform_ac": "A0A494C0W7-1",
"url": "",
"sequence": {
"sequence": "MALIPDLAMETWLLLAVSLVLLYLFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDGTVSGA",
"length": 454,
"header": "tr|A0A494C0W7-1|A0A494C0W7_HUMAN Computationally mapped isoform of unspecific monooxygenase OS=Homo sapiens OX=9606 GN=CYP3A4 PE=1 SV=1 CANONICAL=P08684-1"
},
"locus": {
"chromosome": "7",
"start_pos": 99784081,
"end_pos": 99758136,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000652018.1",
"url": "https://www.ensembl.org/id/ENST00000652018.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000498733.1",
"url": "https://www.ensembl.org/id/ENSP00000498733.1"
}
]
}
},
{
"isoform_ac": "A0A499FJM4-1",
"url": "",
"sequence": {
"sequence": "MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERLEKRKLQSSTIPTTYDEGHQLCPYGSSVSKIFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDGTVSGA",
"length": 534,
"header": "tr|A0A499FJM4-1|A0A499FJM4_HUMAN Computationally mapped isoform of Cytochrome P450 3A OS=Homo sapiens OX=9606 GN=CYP3A4 PE=1 SV=1 CANONICAL=P08684-1"
},
"locus": {
"chromosome": "7",
"start_pos": 99784081,
"end_pos": 99758136,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000336411.7",
"url": "https://www.ensembl.org/id/ENST00000336411.7"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000337915.3",
"url": "https://www.ensembl.org/id/ENSP00000337915.3"
}
]
}
},
{
"isoform_ac": "C9JBD2-1",
"url": "",
"sequence": {
"sequence": "MALIPDLAMETWLLLAVSLVLLYLHNRCDLISVSLCRYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSG",
"length": 153,
"header": "tr|C9JBD2-1|C9JBD2_HUMAN Computationally mapped isoform of unspecific monooxygenase OS=Homo sapiens OX=9606 GN=CYP3A4 PE=1 SV=1 CANONICAL=P08684-1"
},
"locus": {
"chromosome": "7",
"start_pos": 99784081,
"end_pos": 99770134,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000415003.1",
"url": "https://www.ensembl.org/id/ENST00000415003.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000397208.1",
"url": "https://www.ensembl.org/id/ENSP00000397208.1"
}
]
}
},
{
"isoform_ac": "E7EVM8-1",
"url": "",
"sequence": {
"sequence": "MALIPDLAMETWLLLAVSLVLLYLVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDGTVSGA",
"length": 353,
"header": "tr|E7EVM8-1|CP3A4_HUMAN Computationally mapped isoform of Cytochrome P450 3A4 OS=Homo sapiens OX=9606 GN=CYP3A4 PE=1 SV=1 CANONICAL=P08684-1"
},
"locus": {
"chromosome": "7",
"start_pos": 99784081,
"end_pos": 99758136,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000354593.6",
"url": "https://www.ensembl.org/id/ENST00000354593.6"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000346607.2",
"url": "https://www.ensembl.org/id/ENSP00000346607.2"
}
]
}
},
{
"isoform_ac": "P08684-1",
"url": "",
"sequence": {
"sequence": "MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDGTVSGA",
"length": 503,
"header": "sp|P08684-1|CP3A4_HUMAN Isoform 1 of Cytochrome P450 3A4 OS=Homo sapiens OX=9606 GN=CYP3A4 PE=1 SV=4 CANONICAL=P08684-1"
},
"locus": {
"chromosome": "7",
"start_pos": 99784081,
"end_pos": 99758136,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000651514.1",
"url": "https://www.ensembl.org/id/ENST00000651514.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000498939.1",
"url": "https://www.ensembl.org/id/ENSP00000498939.1"
}
]
}
}
],
"glycosylation": [],
"phosphorylation": [
{
"start_pos": 116,
"end_pos": 116,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P08684",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08684"
},
{
"database": "PubMed",
"id": "22101235",
"url": "https://glygen.org/publication/PubMed/22101235"
}
],
"site_lbl": "Ser116"
},
{
"start_pos": 119,
"end_pos": 119,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P08684",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08684"
},
{
"database": "PubMed",
"id": "22101235",
"url": "https://glygen.org/publication/PubMed/22101235"
}
],
"site_lbl": "Ser119"
},
{
"start_pos": 134,
"end_pos": 134,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P08684",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08684"
},
{
"database": "PubMed",
"id": "22101235",
"url": "https://glygen.org/publication/PubMed/22101235"
}
],
"site_lbl": "Ser134"
},
{
"start_pos": 259,
"end_pos": 259,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P08684",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08684"
},
{
"database": "PubMed",
"id": "22101235",
"url": "https://glygen.org/publication/PubMed/22101235"
}
],
"site_lbl": "Ser259"
},
{
"start_pos": 264,
"end_pos": 264,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P08684",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08684"
},
{
"database": "PubMed",
"id": "19095658",
"url": "https://glygen.org/publication/PubMed/19095658"
}
],
"site_lbl": "Thr264"
},
{
"start_pos": 420,
"end_pos": 420,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P08684",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08684"
},
{
"database": "PubMed",
"id": "19095658",
"url": "https://glygen.org/publication/PubMed/19095658"
}
],
"site_lbl": "Ser420"
},
{
"start_pos": 478,
"end_pos": 478,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P08684",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08684"
},
{
"database": "PubMed",
"id": "22101235",
"url": "https://glygen.org/publication/PubMed/22101235"
},
{
"database": "PubMed",
"id": "19095658",
"url": "https://glygen.org/publication/PubMed/19095658"
}
],
"site_lbl": "Ser478"
}
],
"glycation": [],
"keywords": [
"enzyme"
],
"publication": [
{
"title": "Drug resistance and ATP-dependent conjugate transport mediated by the apical multidrug resistance protein, MRP2, permanently expressed in human and canine cells.",
"journal": "Molecular pharmacology",
"date": "1999",
"authors": "Cui Y, Konig J, Buchholz JK, Spring H, Leier I, Keppler D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "10220572",
"url": "https://glygen.org/publication/PubMed/10220572"
}
]
},
{
"title": "Establishment of transgenic cell line CHL-3A4 and its metabolic activation.",
"journal": "Zhonghua Yu Fang Yi Xue Za Zhi",
"date": "1998",
"authors": "Chen Q, Wu J, Yu Y",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "10322772",
"url": "https://glygen.org/publication/PubMed/10322772"
}
]
},
{
"title": "Specific dehydrogenation of 3-methylindole and epoxidation of naphthalene by recombinant human CYP2F1 expressed in lymphoblastoid cells.",
"journal": "Drug metabolism and disposition: the biological fate of chemicals",
"date": "1999",
"authors": "Lanza DL, Code E, Crespi CL, Gonzalez FJ, Yost GS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211981",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981"
}
],
"reference": [
{
"type": "PubMed",
"id": "10383923",
"url": "https://glygen.org/publication/PubMed/10383923"
}
]
},
{
"title": "Characterization of the CoA ligases of human liver mitochondria catalyzing the activation of short- and medium-chain fatty acids and xenobiotic carboxylic acids.",
"journal": "Biochimica et biophysica acta",
"date": "1999",
"authors": "Vessey DA, Kelley M, Warren RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "10434065",
"url": "https://glygen.org/publication/PubMed/10434065"
}
]
},
{
"title": "Nefazodone, meta-chlorophenylpiperazine, and their metabolites in vitro: cytochromes mediating transformation, and P450-3A4 inhibitory actions.",
"journal": "Psychopharmacology",
"date": "1999",
"authors": "von Moltke LL, Greenblatt DJ, Granda BW, Grassi JM, Schmider J, Harmatz JS, Shader RI",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "10445380",
"url": "https://glygen.org/publication/PubMed/10445380"
}
]
},
{
"title": "Profound differences in the transport of steroids by two mouse P-glycoproteins.",
"journal": "Biochemical pharmacology",
"date": "1999",
"authors": "Gruol DJ, Vo QD, Zee MC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "10484077",
"url": "https://glygen.org/publication/PubMed/10484077"
}
]
},
{
"title": "A novel human hepatic organic anion transporting polypeptide (OATP2). Identification of a liver-specific human organic anion transporting polypeptide and identification of rat and human hydroxymethylglutaryl-CoA reductase inhibitor transporters.",
"journal": "The Journal of biological chemistry",
"date": "1999",
"authors": "Hsiang B, Zhu Y, Wang Z, Wu Y, Sasseville V, Yang WP, Kirchgessner TG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9754706",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706"
}
],
"reference": [
{
"type": "PubMed",
"id": "10601278",
"url": "https://glygen.org/publication/PubMed/10601278"
}
]
},
{
"title": "Interaction of docetaxel (`Taxotere`) with human P-glycoprotein.",
"journal": "Japanese journal of cancer research : Gann",
"date": "1999",
"authors": "Shirakawa K, Takara K, Tanigawara Y, Aoyama N, Kasuga M, Komada F, Sakaeda T, Okumura K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "10665657",
"url": "https://glygen.org/publication/PubMed/10665657"
}
]
},
{
"title": "CYP3A4 allelic variants with amino acid substitutions in exons 7 and 12: evidence for an allelic variant with altered catalytic activity.",
"journal": "Clinical pharmacology and therapeutics",
"date": "2000",
"authors": "Sata F, Sapone A, Elizondo G, Stocker P, Miller VP, Zheng W, Raunio H, Crespi CL, Gonzalez FJ",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "10668853",
"url": "https://glygen.org/publication/PubMed/10668853"
}
]
},
{
"title": "Quantitative analysis of constitutive and inducible CYPs mRNA expression in the HepG2 cell line using reverse transcription-competitive PCR.",
"journal": "Biochemical and biophysical research communications",
"date": "2000",
"authors": "Sumida A, Fukuen S, Yamamoto I, Matsuda H, Naohara M, Azuma J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "10673364",
"url": "https://glygen.org/publication/PubMed/10673364"
}
]
},
{
"title": "Biosynthesis of all-trans-retinoic acid from all-trans-retinol: catalysis of all-trans-retinol oxidation by human P-450 cytochromes.",
"journal": "Drug metabolism and disposition: the biological fate of chemicals",
"date": "2000-03",
"authors": "Chen H, Howald W N, Juchau M R",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "10681376",
"url": "https://glygen.org/publication/PubMed/10681376"
}
]
},
{
"title": "Quantitative RT-PCR measurement of human cytochrome P-450s: application to drug induction studies.",
"journal": "Archives of biochemistry and biophysics",
"date": "2000",
"authors": "Rodriguez-Antona C, Jover R, Gomez-Lechon MJ, Castell JV",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "10729196",
"url": "https://glygen.org/publication/PubMed/10729196"
}
]
},
{
"title": "Relative contribution of cytochromes P-450 and flavin-containing monoxygenases to the metabolism of albendazole by human liver microsomes.",
"journal": "British journal of clinical pharmacology",
"date": "2000-04",
"authors": "Rawden H C, Kokwaro G O, Ward S A, Edwards G",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "10759686",
"url": "https://glygen.org/publication/PubMed/10759686"
}
]
},
{
"title": "Bioactivation of 5-(aziridin-1-yl)-2,4-dinitrobenzamide (CB 1954) by human NAD(P)H quinone oxidoreductase 2: a novel co-substrate-mediated antitumor prodrug therapy.",
"journal": "Cancer research",
"date": "2000",
"authors": "Knox RJ, Jenkins TC, Hobbs SM, Chen S, Melton RG, Burke PJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "10945627",
"url": "https://glygen.org/publication/PubMed/10945627"
}
]
},
{
"title": "Lactonization is the critical first step in the disposition of the 3-hydroxy-3-methylglutaryl-CoA reductase inhibitor atorvastatin.",
"journal": "Drug metabolism and disposition: the biological fate of chemicals",
"date": "2000",
"authors": "Jacobsen W, Kuhn B, Soldner A, Kirchner G, Sewing KF, Kollman PA, Benet LZ, Christians U",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9754706",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706"
}
],
"reference": [
{
"type": "PubMed",
"id": "11038166",
"url": "https://glygen.org/publication/PubMed/11038166"
}
]
},
{
"title": "Identification of human cytochrome P450s involved in the formation of all-trans-retinoic acid principal metabolites.",
"journal": "Molecular pharmacology",
"date": "2000",
"authors": "Marill J, Cresteil T, Lanotte M, Chabot GG",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "11093772",
"url": "https://glygen.org/publication/PubMed/11093772"
}
]
},
{
"title": "Epoxide hydrolases: biochemistry and molecular biology.",
"journal": "Chemico-biological interactions",
"date": "2000",
"authors": "Fretland AJ, Omiecinski CJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "11154734",
"url": "https://glygen.org/publication/PubMed/11154734"
}
]
},
{
"title": "Oxidation of 1,8-cineole, the monoterpene cyclic ether originated from eucalyptus polybractea, by cytochrome P450 3A enzymes in rat and human liver microsomes.",
"journal": "Drug metabolism and disposition: the biological fate of chemicals",
"date": "2001-02",
"authors": "Miyazawa M, Shindo M, Shimada T",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "11159812",
"url": "https://glygen.org/publication/PubMed/11159812"
}
]
},
{
"title": "Novel mutations of CYP3A4 in Chinese.",
"journal": "Drug metabolism and disposition: the biological fate of chemicals",
"date": "2001",
"authors": "Hsieh KP, Lin YY, Cheng CL, Lai ML, Lin MS, Siest JP, Huang JD",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "11181494",
"url": "https://glygen.org/publication/PubMed/11181494"
}
]
},
{
"title": "Genomic organization of the human CYP3A locus: identification of a new, inducible CYP3A gene.",
"journal": "Pharmacogenetics",
"date": "2001",
"authors": "Gellner K, Eiselt R, Hustert E, Arnold H, Koch I, Haberl M, Deglmann CJ, Burk O, Buntefuss D, Escher S, Bishop C, Koebe HG, Brinkmann U, Klenk HP, Kleine K, Meyer UA, Wojnowski L",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "11266076",
"url": "https://glygen.org/publication/PubMed/11266076"
}
]
},
{
"title": "Isolation of a family of organic anion transporters from human liver and kidney.",
"journal": "Biochemical and biophysical research communications",
"date": "2001",
"authors": "Sun W, Wu RR, van Poelje PD, Erion MD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "11327718",
"url": "https://glygen.org/publication/PubMed/11327718"
}
]
},
{
"title": "Reduction of aflatoxin B1 dialdehyde by rat and human aldo-keto reductases.",
"journal": "Chemical research in toxicology",
"date": "2001",
"authors": "Guengerich FP, Cai H, McMahon M, Hayes JD, Sutter TR, Groopman JD, Deng Z, Harris TM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5423646",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646"
}
],
"reference": [
{
"type": "PubMed",
"id": "11409944",
"url": "https://glygen.org/publication/PubMed/11409944"
}
]
},
{
"title": "Inhibitory effects of verapamil and diltiazem on simvastatin metabolism in human liver microsomes.",
"journal": "British journal of clinical pharmacology",
"date": "2001",
"authors": "Yeo KR, Yeo WW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "11422004",
"url": "https://glygen.org/publication/PubMed/11422004"
}
]
},
{
"title": "Identification and functional characterization of eight CYP3A4 protein variants.",
"journal": "Pharmacogenetics",
"date": "2001",
"authors": "Eiselt R, Domanski TL, Zibat A, Mueller R, Presecan-Siedel E, Hustert E, Zanger UM, Brockmoller J, Klenk HP, Meyer UA, Khan KK, He YA, Halpert JR, Wojnowski L",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "11470997",
"url": "https://glygen.org/publication/PubMed/11470997"
}
]
},
{
"title": "Kinetics of P-glycoprotein-mediated efflux of paclitaxel.",
"journal": "The Journal of pharmacology and experimental therapeutics",
"date": "2001",
"authors": "Jang SH, Wientjes MG, Au JL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "11504826",
"url": "https://glygen.org/publication/PubMed/11504826"
}
]
},
{
"title": "Role of human cytochrome P450 1A1, 1A2, 1B1, and 3A4 in the 2-, 4-, and 16alpha-hydroxylation of 17beta-estradiol.",
"journal": "Metabolism: clinical and experimental",
"date": "2001",
"authors": "Badawi AF, Cavalieri EL, Rogan EG",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "11555828",
"url": "https://glygen.org/publication/PubMed/11555828"
}
]
},
{
"title": "Characterization of drug transport by the human multidrug resistance protein 3 (ABCC3).",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Zelcer N, Saeki T, Reid G, Beijnen JH, Borst P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "11581266",
"url": "https://glygen.org/publication/PubMed/11581266"
}
]
},
{
"title": "Roles of cytochrome P450 3A enzymes in the 2-hydroxylation of 1,4-cineole, a monoterpene cyclic ether, by rat and human liver microsomes.",
"journal": "Xenobiotica; the fate of foreign compounds in biological systems",
"date": "2001-10",
"authors": "Miyazawa M, Shindo M, Shimada T",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "11695850",
"url": "https://glygen.org/publication/PubMed/11695850"
}
]
},
{
"title": "Identification of variants of CYP3A4 and characterization of their abilities to metabolize testosterone and chlorpyrifos.",
"journal": "The Journal of pharmacology and experimental therapeutics",
"date": "2001",
"authors": "Dai D, Tang J, Rose R, Hodgson E, Bienstock RJ, Mohrenweiser HW, Goldstein JA",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "11714865",
"url": "https://glygen.org/publication/PubMed/11714865"
}
]
},
{
"title": "Intergenic mRNA molecules resulting from trans-splicing.",
"journal": "J. Biol. Chem.",
"date": "2002",
"authors": "Finta Csaba, Zaphiropoulos Peter G",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "11726664",
"url": "https://glygen.org/publication/PubMed/11726664"
}
]
},
{
"title": "Common allelic variants of cytochrome P4503A4 and their prevalence in different populations.",
"journal": "Pharmacogenetics",
"date": "2002",
"authors": "Lamba JK, Lin YS, Thummel K, Daly A, Watkins PB, Strom S, Zhang J, Schuetz EG",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "11875366",
"url": "https://glygen.org/publication/PubMed/11875366"
}
]
},
{
"title": "Multidrug resistance in cancer: role of ATP-dependent transporters.",
"journal": "Nature reviews. Cancer",
"date": "2002",
"authors": "Gottesman MM, Fojo T, Bates SE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "11902585",
"url": "https://glygen.org/publication/PubMed/11902585"
}
]
},
{
"title": "The 3-D structure of microsomal glutathione transferase 1 at 6 A resolution as determined by electron crystallography of p22(1)2(1) crystals.",
"journal": "Biochimica et biophysica acta",
"date": "2002",
"authors": "Holm PJ, Morgenstern R, Hebert H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5423646",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646"
}
],
"reference": [
{
"type": "PubMed",
"id": "11904223",
"url": "https://glygen.org/publication/PubMed/11904223"
}
]
},
{
"title": "Glucuronidation of statins in animals and humans: a novel mechanism of statin lactonization.",
"journal": "Drug metabolism and disposition: the biological fate of chemicals",
"date": "2002",
"authors": "Prueksaritanont T, Subramanian R, Fang X, Ma B, Qiu Y, Lin JH, Pearson PG, Baillie TA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9754706",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706"
}
],
"reference": [
{
"type": "PubMed",
"id": "11950779",
"url": "https://glygen.org/publication/PubMed/11950779"
}
]
},
{
"title": "Crystal structure of human renal dipeptidase involved in beta-lactam hydrolysis.",
"journal": "Journal of molecular biology",
"date": "2002",
"authors": "Nitanai Y, Satow Y, Adachi H, Tsujimoto M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5423646",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646"
}
],
"reference": [
{
"type": "PubMed",
"id": "12144777",
"url": "https://glygen.org/publication/PubMed/12144777"
}
]
},
{
"title": "The role of the efflux transporter P-glycoprotein in brain penetration of prednisolone.",
"journal": "The Journal of endocrinology",
"date": "2002",
"authors": "Karssen AM, Meijer OC, van der Sandt IC, De Boer AG, De Lange EC, De Kloet ER",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "12379510",
"url": "https://glygen.org/publication/PubMed/12379510"
}
]
},
{
"title": "Cytochrome P450 oxidations in the generation of reactive electrophiles: epoxidation and related reactions.",
"journal": "Archives of biochemistry and biophysics",
"date": "2003",
"authors": "Guengerich FP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211981",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981"
}
],
"reference": [
{
"type": "PubMed",
"id": "12464245",
"url": "https://glygen.org/publication/PubMed/12464245"
}
]
},
{
"title": "11beta-hydroxysteroid dehydrogenase types 1 and 2: an important pharmacokinetic determinant for the activity of synthetic mineralo- and glucocorticoids.",
"journal": "The Journal of clinical endocrinology and metabolism",
"date": "2002",
"authors": "Diederich S, Eigendorff E, Burkhardt P, Quinkler M, Bumke-Vogt C, Rochel M, Seidelmann D, Esperling P, Oelkers W, Bahr V",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "12466373",
"url": "https://glygen.org/publication/PubMed/12466373"
}
]
},
{
"title": "Distribution of STI-571 to the brain is limited by P-glycoprotein-mediated efflux.",
"journal": "The Journal of pharmacology and experimental therapeutics",
"date": "2003",
"authors": "Dai H, Marbach P, Lemaire M, Hayes M, Elmquist WF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "12604685",
"url": "https://glygen.org/publication/PubMed/12604685"
}
]
},
{
"title": "Isolation, sequencing, and expression of a cDNA for the HXM-A form of xenobiotic/medium-chain fatty acid:CoA ligase from human liver mitochondria.",
"journal": "Journal of biochemical and molecular toxicology",
"date": "2003",
"authors": "Vessey DA, Lau E, Kelley M, Warren RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "12616642",
"url": "https://glygen.org/publication/PubMed/12616642"
}
]
},
{
"title": "Role of polymorphic human CYP2B6 in cyclophosphamide bioactivation.",
"journal": "The pharmacogenomics journal",
"date": "2003",
"authors": "Xie HJ, Yasar U, Lundgren S, Griskevicius L, Terelius Y, Hassan M, Rane A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211981",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981"
}
],
"reference": [
{
"type": "PubMed",
"id": "12629583",
"url": "https://glygen.org/publication/PubMed/12629583"
}
]
},
{
"title": "Induction of CYP3As in HepG2 cells by several drugs. Association between induction of CYP3A4 and expression of glucocorticoid receptor.",
"journal": "Biological & pharmaceutical bulletin",
"date": "2003",
"authors": "Usui T, Saitoh Y, Komada F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "12673034",
"url": "https://glygen.org/publication/PubMed/12673034"
}
]
},
{
"title": "Crystal structure of human carboxylesterase 1 complexed with the Alzheimer's drug tacrine: from binding promiscuity to selective inhibition.",
"journal": "Chemistry & biology",
"date": "2003",
"authors": "Bencharit S, Morton CL, Hyatt JL, Kuhn P, Danks MK, Potter PM, Redinbo MR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "12725862",
"url": "https://glygen.org/publication/PubMed/12725862"
}
]
},
{
"title": "Characterization of the rat aflatoxin B1 aldehyde reductase gene, AKR7A1. Structure and chromosomal localization of AKR7A1 as well as identification of antioxidant response elements in the gene promoter.",
"journal": "Carcinogenesis",
"date": "2003",
"authors": "Ellis EM, Slattery CM, Hayes JD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5423646",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646"
}
],
"reference": [
{
"type": "PubMed",
"id": "12727802",
"url": "https://glygen.org/publication/PubMed/12727802"
}
]
},
{
"title": "Identification of a human valacyclovirase: biphenyl hydrolase-like protein as valacyclovir hydrolase.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Kim I, Chu XY, Kim S, Provoda CJ, Lee KD, Amidon GL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "12732646",
"url": "https://glygen.org/publication/PubMed/12732646"
}
]
},
{
"title": "Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms.",
"journal": "Endocrinology",
"date": "2003-08",
"authors": "Lee Anthony J, Cai May Xiaoxin, Thomas Paul E, Conney Allan H, Zhu Bao Ting",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "12865317",
"url": "https://glygen.org/publication/PubMed/12865317"
}
]
},
{
"title": "Essential roles of zinc ligation and enzyme dimerization for catalysis in the aminoacylase-1/M20 family.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Lindner HA, Lunin VV, Alary A, Hecker R, Cygler M, Menard R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5423646",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646"
}
],
"reference": [
{
"type": "PubMed",
"id": "12933810",
"url": "https://glygen.org/publication/PubMed/12933810"
}
]
},
{
"title": "Wine, alcohol, platelets, and the French paradox for coronary heart disease.",
"journal": "Lancet (London, England)",
"date": "1992",
"authors": "Renaud S, de Lorgeril M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "1351198",
"url": "https://glygen.org/publication/PubMed/1351198"
}
]
},
{
"title": "Efficient inhibition of P-glycoprotein-mediated multidrug resistance with a monoclonal antibody.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1992",
"authors": "Mechetner EB, Roninson IB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "1352877",
"url": "https://glygen.org/publication/PubMed/1352877"
}
]
},
{
"title": "Partial purification and reconstitution of the human multidrug-resistance pump: characterization of the drug-stimulatable ATP hydrolysis.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1992",
"authors": "Ambudkar SV, Lelong IH, Zhang J, Cardarelli CO, Gottesman MM, Pastan I",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "1356264",
"url": "https://glygen.org/publication/PubMed/1356264"
}
]
},
{
"title": "P-glycoprotein but not topoisomerase II and glutathione-S-transferase-pi accounts for enhanced intracellular drug-resistance in LoVo MDR human cell lines.",
"journal": "Tumori",
"date": "1992",
"authors": "Boiocchi M, Tumiotto L, Giannini F, Viel A, Biscontin G, Sartor F, Toffoli G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "1359686",
"url": "https://glygen.org/publication/PubMed/1359686"
}
]
},
{
"title": "Interaction of serum and sodium salicylate: changes during acute infection and its influence on pharmacological activity.",
"journal": "Bulletin of the Johns Hopkins Hospital",
"date": "1960",
"authors": "REYNOLDS RC, CLUFF LE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "13741103",
"url": "https://glygen.org/publication/PubMed/13741103"
}
]
},
{
"title": "Human cytochrome P450 3A7 has a distinct high catalytic activity for the 16alpha-hydroxylation of estrone but not 17beta-estradiol.",
"journal": "Cancer research",
"date": "2003",
"authors": "Lee AJ, Conney AH, Zhu BT",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "14559847",
"url": "https://glygen.org/publication/PubMed/14559847"
}
]
},
{
"title": "Structural determinants of P-glycoprotein-mediated transport of glucocorticoids.",
"journal": "Pharmaceutical research",
"date": "2003",
"authors": "Yates CR, Chang C, Kearbey JD, Yasuda K, Schuetz EG, Miller DD, Dalton JT, Swaan PW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "14661924",
"url": "https://glygen.org/publication/PubMed/14661924"
}
]
},
{
"title": "The endo-8,9-epoxide of aflatoxin B1: a new metabolite.",
"journal": "Chemical research in toxicology",
"date": "1992",
"authors": "Raney KD, Coles B, Guengerich FP, Harris TM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5423646",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646"
}
],
"reference": [
{
"type": "PubMed",
"id": "1504254",
"url": "https://glygen.org/publication/PubMed/1504254"
}
]
},
{
"title": "Pharmacokinetics of erythromycin in rabbit corneas after single-dose infusion: role of P-glycoprotein as a barrier to in vivo ocular drug absorption.",
"journal": "The Journal of pharmacology and experimental therapeutics",
"date": "2004",
"authors": "Dey S, Gunda S, Mitra AK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "15175422",
"url": "https://glygen.org/publication/PubMed/15175422"
}
]
},
{
"title": "Identification of Val117 and Arg372 as critical amino acid residues for the activity difference between human CYP2A6 and CYP2A13 in coumarin 7-hydroxylation.",
"journal": "Archives of biochemistry and biophysics",
"date": "2004",
"authors": "He XY, Shen J, Hu WY, Ding X, Lu AY, Hong JY",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211981",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981"
}
],
"reference": [
{
"type": "PubMed",
"id": "15196988",
"url": "https://glygen.org/publication/PubMed/15196988"
}
]
},
{
"title": "Crystal structures of human cytochrome P450 3A4 bound to metyrapone and progesterone.",
"journal": "Science",
"date": "2004",
"authors": "Williams Pamela A, Cosme Jose, Vinkovic Dijana Matak, Ward Alison, Angove Hayley C, Day Philip J, Vonrhein Clemens, Tickle Ian J, Jhoti Harren",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "15256616",
"url": "https://glygen.org/publication/PubMed/15256616"
}
]
},
{
"title": "The structure of human microsomal cytochrome P450 3A4 determined by X-ray crystallography to 2.05-A resolution.",
"journal": "J. Biol. Chem.",
"date": "2004",
"authors": "Yano Jason K, Wester Michael R, Schoch Guillaume A, Griffin Keith J, Stout C David, Johnson Eric F",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "15258162",
"url": "https://glygen.org/publication/PubMed/15258162"
}
]
},
{
"title": "Crystal structure of quinone reductase 2 in complex with resveratrol.",
"journal": "Biochemistry",
"date": "2004",
"authors": "Buryanovskyy L, Fu Y, Boyd M, Ma Y, Hsieh TC, Wu JM, Zhang Z",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "15350128",
"url": "https://glygen.org/publication/PubMed/15350128"
}
]
},
{
"title": "Identification of cytochrome P450 isoforms involved in the metabolism of loperamide in human liver microsomes.",
"journal": "European journal of clinical pharmacology",
"date": "2004",
"authors": "Kim KA, Chung J, Jung DH, Park JY",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211981",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981"
}
],
"reference": [
{
"type": "PubMed",
"id": "15365656",
"url": "https://glygen.org/publication/PubMed/15365656"
}
]
},
{
"title": "Testosterone 1 beta-hydroxylation by human cytochrome P450 3A4.",
"journal": "European journal of biochemistry",
"date": "2004-10",
"authors": "Krauser Joel A, Voehler Markus, Tseng Li-Hong, Schefer Alexandre B, Godejohann Markus, Guengerich F Peter",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "15373842",
"url": "https://glygen.org/publication/PubMed/15373842"
}
]
},
{
"title": "Increased levels of aflatoxin-albumin adducts are associated with CYP3A5 polymorphisms in The Gambia, West Africa.",
"journal": "Pharmacogenetics",
"date": "2004",
"authors": "Wojnowski L, Turner PC, Pedersen B, Hustert E, Brockmoller J, Mendy M, Whittle HC, Kirk G, Wild CP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211981",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981"
}
],
"reference": [
{
"type": "PubMed",
"id": "15454734",
"url": "https://glygen.org/publication/PubMed/15454734"
}
]
},
{
"title": "Genetic variation in eleven phase I drug metabolism genes in an ethnically diverse population.",
"journal": "Pharmacogenomics",
"date": "2004",
"authors": "Solus JF, Arietta BJ, Harris JR, Sexton DP, Steward JQ, McMunn C, Ihrie P, Mehall JM, Edwards TL, Dawson EP",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "15469410",
"url": "https://glygen.org/publication/PubMed/15469410"
}
]
},
{
"title": "Identification of budesonide and prednisone as substrates of the intestinal drug efflux pump P-glycoprotein.",
"journal": "Inflammatory bowel diseases",
"date": "2004",
"authors": "Dilger K, Schwab M, Fromm MF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "15472518",
"url": "https://glygen.org/publication/PubMed/15472518"
}
]
},
{
"title": "Cardiovascular protective effects of resveratrol.",
"journal": "Cardiovascular drug reviews",
"date": "2004",
"authors": "Bradamante S, Barenghi L, Villa A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "15492766",
"url": "https://glygen.org/publication/PubMed/15492766"
}
]
},
{
"title": "Interactions of human P-glycoprotein with simvastatin, simvastatin acid, and atorvastatin.",
"journal": "Pharmaceutical research",
"date": "2004",
"authors": "Hochman JH, Pudvah N, Qiu J, Yamazaki M, Tang C, Lin JH, Prueksaritanont T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9754706",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706"
}
],
"reference": [
{
"type": "PubMed",
"id": "15497697",
"url": "https://glygen.org/publication/PubMed/15497697"
}
]
},
{
"title": "Mechanism-based inactivation of CYP3A by HIV protease inhibitors.",
"journal": "The Journal of pharmacology and experimental therapeutics",
"date": "2005",
"authors": "Ernest CS 2nd, Hall SD, Jones DR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "15523003",
"url": "https://glygen.org/publication/PubMed/15523003"
}
]
},
{
"title": "Functional analysis of human microsomal epoxide hydrolase genetic variants.",
"journal": "Chemico-biological interactions",
"date": "2004",
"authors": "Hosagrahara VP, Rettie AE, Hassett C, Omiecinski CJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "15535985",
"url": "https://glygen.org/publication/PubMed/15535985"
}
]
},
{
"title": "Kinetic analysis of oxidation of coumarins by human cytochrome P450 2A6.",
"journal": "The Journal of biological chemistry",
"date": "2005",
"authors": "Yun CH, Kim KH, Calcutt MW, Guengerich FP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211981",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981"
}
],
"reference": [
{
"type": "PubMed",
"id": "15665333",
"url": "https://glygen.org/publication/PubMed/15665333"
}
]
},
{
"title": "Characterization of testosterone 11 beta-hydroxylation catalyzed by human liver microsomal cytochromes P450.",
"journal": "Drug metabolism and disposition: the biological fate of chemicals",
"date": "2005-06",
"authors": "Choi Man Ho, Skipper Paul L, Wishnok John S, Tannenbaum Steven R",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "15764715",
"url": "https://glygen.org/publication/PubMed/15764715"
}
]
},
{
"title": "Metabolic properties of the acid and lactone forms of HMG-CoA reductase inhibitors.",
"journal": "Xenobiotica; the fate of foreign compounds in biological systems",
"date": "2004",
"authors": "Fujino H, Saito T, Tsunenari Y, Kojima J, Sakaeda T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9754706",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706"
}
],
"reference": [
{
"type": "PubMed",
"id": "15801541",
"url": "https://glygen.org/publication/PubMed/15801541"
}
]
},
{
"title": "Plasma free cortisol fraction reflects levels of functioning corticosteroid-binding globulin.",
"journal": "Clinica chimica acta; international journal of clinical chemistry",
"date": "2005",
"authors": "Lewis JG, Bagley CJ, Elder PA, Bachmann AW, Torpy DJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "15904907",
"url": "https://glygen.org/publication/PubMed/15904907"
}
]
},
{
"title": "Glucuronidation of the aspirin metabolite salicylic acid by expressed UDP-glucuronosyltransferases and human liver microsomes.",
"journal": "Drug metabolism and disposition: the biological fate of chemicals",
"date": "2006",
"authors": "Kuehl GE, Bigler J, Potter JD, Lampe JW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "16258079",
"url": "https://glygen.org/publication/PubMed/16258079"
}
]
},
{
"title": "P450 2C18 catalyzes the metabolic bioactivation of phenytoin.",
"journal": "Chemical research in toxicology",
"date": "2005",
"authors": "Kinobe RT, Parkinson OT, Mitchell DJ, Gillam EM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211981",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981"
}
],
"reference": [
{
"type": "PubMed",
"id": "16359177",
"url": "https://glygen.org/publication/PubMed/16359177"
}
]
},
{
"title": "Efficient activation of aflatoxin B1 by cytochrome P450 2A13, an enzyme predominantly expressed in human respiratory tract.",
"journal": "International journal of cancer",
"date": "2006",
"authors": "He XY, Tang L, Wang SL, Cai QS, Wang JS, Hong JY",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5423646",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646"
}
],
"reference": [
{
"type": "PubMed",
"id": "16385575",
"url": "https://glygen.org/publication/PubMed/16385575"
}
]
},
{
"title": "Oxidation of aflatoxins and sterigmatocystin by human liver microsomes: significance of aflatoxin Q1 as a detoxication product of aflatoxin B1.",
"journal": "Chemical research in toxicology",
"date": "1992",
"authors": "Raney KD, Shimada T, Kim DH, Groopman JD, Harris TM, Guengerich FP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5423646",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646"
}
],
"reference": [
{
"type": "PubMed",
"id": "1643250",
"url": "https://glygen.org/publication/PubMed/1643250"
}
]
},
{
"title": "RNAi-mediated knockdown of aldehyde dehydrogenase class-1A1 and class-3A1 is specific and reveals that each contributes equally to the resistance against 4-hydroperoxycyclophosphamide.",
"journal": "Cancer chemotherapy and pharmacology",
"date": "2007",
"authors": "Moreb JS, Mohuczy D, Ostmark B, Zucali JR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "16614850",
"url": "https://glygen.org/publication/PubMed/16614850"
}
]
},
{
"title": "NRH:quinone oxidoreductase 2 (NQO2) catalyzes metabolic activation of quinones and anti-tumor drugs.",
"journal": "Biochemical pharmacology",
"date": "2006",
"authors": "Celli CM, Tran N, Knox R, Jaiswal AK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "16765324",
"url": "https://glygen.org/publication/PubMed/16765324"
}
]
},
{
"title": "Substrate specificity of carboxylesterase isozymes and their contribution to hydrolase activity in human liver and small intestine.",
"journal": "Drug metabolism and disposition: the biological fate of chemicals",
"date": "2006",
"authors": "Imai T, Taketani M, Shii M, Hosokawa M, Chiba K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "16837570",
"url": "https://glygen.org/publication/PubMed/16837570"
}
]
},
{
"title": "Human carboxylesterase isozymes: catalytic properties and rational drug design.",
"journal": "Drug metabolism and pharmacokinetics",
"date": "2006",
"authors": "Imai T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "16858120",
"url": "https://glygen.org/publication/PubMed/16858120"
}
]
},
{
"title": "Antiplatelet agents aspirin and clopidogrel are hydrolyzed by distinct carboxylesterases, and clopidogrel is transesterificated in the presence of ethyl alcohol.",
"journal": "The Journal of pharmacology and experimental therapeutics",
"date": "2006",
"authors": "Tang M, Mukundan M, Yang J, Charpentier N, LeCluyse EL, Black C, Yang D, Shi D, Yan B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "16943252",
"url": "https://glygen.org/publication/PubMed/16943252"
}
]
},
{
"title": "Aldo-keto reductases and bioactivation/detoxication.",
"journal": "Annual review of pharmacology and toxicology",
"date": "2007",
"authors": "Jin Y, Penning TM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5423646",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646"
}
],
"reference": [
{
"type": "PubMed",
"id": "16970545",
"url": "https://glygen.org/publication/PubMed/16970545"
}
]
},
{
"title": "Inhibition of 11beta-hydroxysteroid dehydrogenase type 1 activity in vivo limits glucocorticoid exposure to human adipose tissue and decreases lipolysis.",
"journal": "The Journal of clinical endocrinology and metabolism",
"date": "2007",
"authors": "Tomlinson JW, Sherlock M, Hughes B, Hughes SV, Kilvington F, Bartlett W, Courtney R, Rejto P, Carley W, Stewart PM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "17200165",
"url": "https://glygen.org/publication/PubMed/17200165"
}
]
},
{
"title": "Adipogenesis-related increase of semicarbazide-sensitive amine oxidase and monoamine oxidase in human adipocytes.",
"journal": "Biochimie",
"date": "2007",
"authors": "Bour S, Daviaud D, Gres S, Lefort C, Prevot D, Zorzano A, Wabitsch M, Saulnier-Blache JS, Valet P, Carpene C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "17400359",
"url": "https://glygen.org/publication/PubMed/17400359"
}
]
},
{
"title": "Molecular mechanism of phase I and phase II drug-metabolizing enzymes: implications for detoxification.",
"journal": "International review of cytology",
"date": "2007",
"authors": "Iyanagi T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "17482904",
"url": "https://glygen.org/publication/PubMed/17482904"
}
]
},
{
"title": "Model representation of salicylate pharmacokinetics using unbound plasma salicylate concentrations and metabolite urinary excretion rates following a single oral dose.",
"journal": "Journal of pharmacokinetics and biopharmaceutics",
"date": "1991",
"authors": "Shen J, Wanwimolruk S, Purves RD, McQueen EG, Roberts MS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "1783992",
"url": "https://glygen.org/publication/PubMed/1783992"
}
]
},
{
"title": "Kinetic, thermodynamic and X-ray structural insights into the interaction of melatonin and analogues with quinone reductase 2.",
"journal": "The Biochemical journal",
"date": "2008",
"authors": "Calamini B, Santarsiero BD, Boutin JA, Mesecar AD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "18254726",
"url": "https://glygen.org/publication/PubMed/18254726"
}
]
},
{
"title": "Molecular basis of prodrug activation by human valacyclovirase, an alpha-amino acid ester hydrolase.",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Lai L, Xu Z, Zhou J, Lee KD, Amidon GL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "18256025",
"url": "https://glygen.org/publication/PubMed/18256025"
}
]
},
{
"title": "Inhibition of MDR1 expression by retinol treatment increases sensitivity to etoposide (VP16) in human neoplasic cell line.",
"journal": "Toxicology in vitro : an international journal published in association with BIBRA",
"date": "2008",
"authors": "Klamt F, Passos DT, Castro MA, Gelain DP, Grivicich I, Moreira JC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "18282684",
"url": "https://glygen.org/publication/PubMed/18282684"
}
]
},
{
"title": "Rapid clinical induction of hepatic cytochrome P4502B6 activity by ritonavir.",
"journal": "Antimicrobial agents and chemotherapy",
"date": "2008",
"authors": "Kharasch ED, Mitchell D, Coles R, Blanco R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "18285471",
"url": "https://glygen.org/publication/PubMed/18285471"
}
]
},
{
"title": "The human gamma-glutamyltransferase gene family.",
"journal": "Human genetics",
"date": "2008",
"authors": "Heisterkamp N, Groffen J, Warburton D, Sneddon TP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5423646",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646"
}
],
"reference": [
{
"type": "PubMed",
"id": "18357469",
"url": "https://glygen.org/publication/PubMed/18357469"
}
]
},
{
"title": "Protection against aflatoxin B1-induced cytotoxicity by expression of the cloned aflatoxin B1-aldehyde reductases rat AKR7A1 and human AKR7A3.",
"journal": "Chemical research in toxicology",
"date": "2008",
"authors": "Bodreddigari S, Jones LK, Egner PA, Groopman JD, Sutter CH, Roebuck BD, Guengerich FP, Kensler TW, Sutter TR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5423646",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646"
}
],
"reference": [
{
"type": "PubMed",
"id": "18416522",
"url": "https://glygen.org/publication/PubMed/18416522"
}
]
},
{
"title": "The S-to-R transition of corticosteroid-binding globulin and the mechanism of hormone release.",
"journal": "Journal of molecular biology",
"date": "2008",
"authors": "Zhou A, Wei Z, Stanley PL, Read RJ, Stein PE, Carrell RW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "18513745",
"url": "https://glygen.org/publication/PubMed/18513745"
}
]
},
{
"title": "Drug metabolism in human brain: high levels of cytochrome P4503A43 in brain and metabolism of anti-anxiety drug alprazolam to its active metabolite.",
"journal": "PLoS ONE",
"date": "2008",
"authors": "Agarwal Varsha, Kommaddi Reddy P, Valli Khader, Ryder Daniel, Hyde Thomas M, Kleinman Joel E, Strobel Henry W, Ravindranath Vijayalakshmi",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "18545703",
"url": "https://glygen.org/publication/PubMed/18545703"
}
]
},
{
"title": "Contribution of cytochrome P450 3A4 and 3A5 to the metabolism of atorvastatin.",
"journal": "Xenobiotica; the fate of foreign compounds in biological systems",
"date": "2008",
"authors": "Park JE, Kim KB, Bae SK, Moon BS, Liu KH, Shin JG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9754706",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706"
}
],
"reference": [
{
"type": "PubMed",
"id": "18720283",
"url": "https://glygen.org/publication/PubMed/18720283"
}
]
},
{
"title": "The fourth molybdenum containing enzyme mARC: cloning and involvement in the activation of N-hydroxylated prodrugs.",
"journal": "Journal of medicinal chemistry",
"date": "2008",
"authors": "Gruenewald S, Wahl B, Bittner F, Hungeling H, Kanzow S, Kotthaus J, Schwering U, Mendel RR, Clement B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "19053771",
"url": "https://glygen.org/publication/PubMed/19053771"
}
]
},
{
"title": "ABC transporters, cytochromes P450 and their main transcription factors: expression at the human blood-brain barrier.",
"journal": "J. Neurochem.",
"date": "2008",
"authors": "Dauchy Sandrine, Dutheil Fabien, Weaver Richard J, Chassoux Francine, Daumas-Duport Catherine, Couraud Pierre-Olivier, Scherrmann Jean-Michel, De Waziers Isabelle, Decl\u00e8ves Xavier",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "19094056",
"url": "https://glygen.org/publication/PubMed/19094056"
}
]
},
{
"title": "A role for protein phosphorylation in cytochrome P450 3A4 ubiquitin-dependent proteasomal degradation.",
"journal": "The Journal of biological chemistry",
"date": "2009",
"authors": "Wang Y, Liao M, Hoe N, Acharya P, Deng C, Krutchinsky AN, Correia MA",
"evidence": [
{
"database": "iPTMnet",
"id": "P08684",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "19095658",
"url": "https://glygen.org/publication/PubMed/19095658"
}
]
},
{
"title": "CYP3A4 ubiquitination by gp78 (the tumor autocrine motility factor receptor, AMFR) and CHIP E3 ligases.",
"journal": "Archives of biochemistry and biophysics",
"date": "2009",
"authors": "Pabarcus MK, Hoe N, Sadeghi S, Patterson C, Wiertz E, Correia MA",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "19103148",
"url": "https://glygen.org/publication/PubMed/19103148"
}
]
},
{
"title": "Xenobiotic-metabolizing enzymes and transporters in the normal human brain: regional and cellular mapping as a basis for putative roles in cerebral function.",
"journal": "Drug Metab. Dispos.",
"date": "2009",
"authors": "Dutheil Fabien, Dauchy Sandrine, Diry Monique, Sazdovitch V\u00e9ronique, Cloarec Olivier, Mellott\u00e9e Lucille, Bi\u00e8che Ivan, Ingelman-Sundberg Magnus, Flinois Jean-Pierre, de Waziers Isabelle, Beaune Philippe, Decl\u00e8ves Xavier, Duyckaerts Charles, Loriot Marie-Anne",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "19359404",
"url": "https://glygen.org/publication/PubMed/19359404"
}
]
},
{
"title": "Influx and efflux transport as determinants of melphalan cytotoxicity: Resistance to melphalan in MDR1 overexpressing tumor cell lines.",
"journal": "Biochemical pharmacology",
"date": "2009",
"authors": "Kuhne A, Tzvetkov MV, Hagos Y, Lage H, Burckhardt G, Brockmoller J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "19447222",
"url": "https://glygen.org/publication/PubMed/19447222"
}
]
},
{
"title": "Human kidney gamma-glutamyl transpeptidase. Catalytic properties, subunit structure, and localization of the gamma-glutamyl binding site on the light subunit.",
"journal": "The Journal of biological chemistry",
"date": "1977",
"authors": "Tate SS, Ross ME",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5423646",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646"
}
],
"reference": [
{
"type": "PubMed",
"id": "19463",
"url": "https://glygen.org/publication/PubMed/19463"
}
]
},
{
"title": "The unique substrate specificity of human AOC2, a semicarbazide-sensitive amine oxidase.",
"journal": "Cellular and molecular life sciences : CMLS",
"date": "2009",
"authors": "Kaitaniemi S, Elovaara H, Gron K, Kidron H, Liukkonen J, Salminen T, Salmi M, Jalkanen S, Elima K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "19588076",
"url": "https://glygen.org/publication/PubMed/19588076"
}
]
},
{
"title": "Multidrug resistance phenotype of human BRO melanoma cells transfected with a wild-type human mdr1 complementary DNA.",
"journal": "Cancer research",
"date": "1990",
"authors": "Lincke CR, van der Bliek AM, Schuurhuis GJ, van der Velde-Koerts T, Smit JJ, Borst P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "1968359",
"url": "https://glygen.org/publication/PubMed/1968359"
}
]
},
{
"title": "Structure and inhibition of human diamine oxidase.",
"journal": "Biochemistry",
"date": "2009",
"authors": "McGrath AP, Hilmer KM, Collyer CA, Shepard EM, Elmore BO, Brown DE, Dooley DM, Guss JM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "19764817",
"url": "https://glygen.org/publication/PubMed/19764817"
}
]
},
{
"title": "UDP-glucuronosyltransferase (UGT) polymorphisms affect atorvastatin lactonization in vitro and in vivo.",
"journal": "Clinical pharmacology and therapeutics",
"date": "2010",
"authors": "Riedmaier S, Klein K, Hofmann U, Keskitalo JE, Neuvonen PJ, Schwab M, Niemi M, Zanger UM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9754706",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706"
}
],
"reference": [
{
"type": "PubMed",
"id": "19794410",
"url": "https://glygen.org/publication/PubMed/19794410"
}
]
},
{
"title": "Reaction of human albumin with aspirin in vitro: mass spectrometric identification of acetylated lysines 199, 402, 519, and 545.",
"journal": "Biochemical pharmacology",
"date": "2010",
"authors": "Liyasova MS, Schopfer LM, Lockridge O",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "19836360",
"url": "https://glygen.org/publication/PubMed/19836360"
}
]
},
{
"title": "MDR1 polymorphism role in patients treated with cetuximab and irinotecan in irinotecan refractory colorectal cancer.",
"journal": "Medical oncology (Northwood, London, England)",
"date": "2010",
"authors": "Paule B, Castagne V, Picard V, Saffroy R, Adam R, Guettier C, Farinotti R, Bonhomme-Faivre L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "19862647",
"url": "https://glygen.org/publication/PubMed/19862647"
}
]
},
{
"title": "Stereoselective epoxidation of the last double bond of polyunsaturated fatty acids by human cytochromes P450.",
"journal": "Journal of lipid research",
"date": "2010-05",
"authors": "Lucas Dani\u00e8le, Goulitquer Sophie, Marienhagen Jan, Fer Maude, Dreano Yvonne, Schwaneberg Ulrich, Amet Yolande, Corcos Laurent",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "19965576",
"url": "https://glygen.org/publication/PubMed/19965576"
}
]
},
{
"title": "Novel 14,21-dihydroxy-docosahexaenoic acids: structures, formation pathways, and enhancement of wound healing.",
"journal": "Journal of lipid research",
"date": "2010",
"authors": "Lu Y, Tian H, Hong S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9027307",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027307"
}
],
"reference": [
{
"type": "PubMed",
"id": "19965612",
"url": "https://glygen.org/publication/PubMed/19965612"
}
]
},
{
"title": "Naturally occurring variants of human CBR3 alter anthracycline in vitro metabolism.",
"journal": "The Journal of pharmacology and experimental therapeutics",
"date": "2010",
"authors": "Bains OS, Karkling MJ, Lubieniecka JM, Grigliatti TA, Reid RE, Riggs KW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "20007405",
"url": "https://glygen.org/publication/PubMed/20007405"
}
]
},
{
"title": "Human carboxymethylenebutenolidase as a bioactivating hydrolase of olmesartan medoxomil in liver and intestine.",
"journal": "The Journal of biological chemistry",
"date": "2010",
"authors": "Ishizuka T, Fujimori I, Kato M, Noji-Sakikawa C, Saito M, Yoshigae Y, Kubota K, Kurihara A, Izumi T, Ikeda T, Okazaki O",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "20177059",
"url": "https://glygen.org/publication/PubMed/20177059"
}
]
},
{
"title": "Membrane transporters in drug development.",
"journal": "Nature reviews. Drug discovery",
"date": "2010",
"authors": "Giacomini KM, Huang SM, Tweedie DJ, Benet LZ, Brouwer KL, Chu X, Dahlin A, Evers R, Fischer V, Hillgren KM, Hoffmaster KA, Ishikawa T, Keppler D, Kim RB, Lee CA, Niemi M, Polli JW, Sugiyama Y, Swaan PW, Ware JA, Wright SH, Yee SW, Zamek-Gliszczynski MJ, Zhang L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "20190787",
"url": "https://glygen.org/publication/PubMed/20190787"
}
]
},
{
"title": "Tolbutamide and phenytoin hydroxylations by cDNA-expressed human liver cytochrome P4502C9.",
"journal": "Biochemical and biophysical research communications",
"date": "1991",
"authors": "Veronese ME, Mackenzie PI, Doecke CJ, McManus ME, Miners JO, Birkett DJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211981",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981"
}
],
"reference": [
{
"type": "PubMed",
"id": "2025243",
"url": "https://glygen.org/publication/PubMed/2025243"
}
]
},
{
"title": "Mammalian carboxylesterase 3: comparative genomics and proteomics.",
"journal": "Genetica",
"date": "2010",
"authors": "Holmes RS, Cox LA, VandeBerg JL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "20422440",
"url": "https://glygen.org/publication/PubMed/20422440"
}
]
},
{
"title": "Arylacetamide deacetylase is a determinant enzyme for the difference in hydrolase activities of phenacetin and acetaminophen.",
"journal": "Drug metabolism and disposition: the biological fate of chemicals",
"date": "2010",
"authors": "Watanabe A, Fukami T, Takahashi S, Kobayashi Y, Nakagawa N, Nakajima M, Yokoi T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "20542992",
"url": "https://glygen.org/publication/PubMed/20542992"
}
]
},
{
"title": "P-glycoprotein, but not multidrug resistance protein 4, plays a role in the systemic clearance of irinotecan and SN-38 in mice.",
"journal": "Drug metabolism letters",
"date": "2010",
"authors": "Tagen M, Zhuang Y, Zhang F, Harstead KE, Shen J, Schaiquevich P, Fraga CH, Panetta JC, Waters CM, Stewart CF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "20583968",
"url": "https://glygen.org/publication/PubMed/20583968"
}
]
},
{
"title": "Differences in assessment of macrolide interaction with human MDR1 (ABCB1, P-gp) using rhodamine-123 efflux, ATPase activity and cellular accumulation assays.",
"journal": "European journal of pharmaceutical sciences : official journal of the European Federation for Pharmaceutical Sciences",
"date": "2010",
"authors": "Munic V, Kelneric Z, Mikac L, Erakovic Haber V",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "20621639",
"url": "https://glygen.org/publication/PubMed/20621639"
}
]
},
{
"title": "Effects of a commonly occurring genetic polymorphism of human CYP3A4 (I118V) on the metabolism of anandamide.",
"journal": "Drug metabolism and disposition: the biological fate of chemicals",
"date": "2010",
"authors": "Pratt-Hyatt M, Zhang H, Snider NT, Hollenberg PF",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "20702771",
"url": "https://glygen.org/publication/PubMed/20702771"
}
]
},
{
"title": "14S,21R-dihydroxydocosahexaenoic acid remedies impaired healing and mesenchymal stem cell functions in diabetic wounds.",
"journal": "The Journal of biological chemistry",
"date": "2011",
"authors": "Tian H, Lu Y, Shah SP, Hong S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9027307",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027307"
}
],
"reference": [
{
"type": "PubMed",
"id": "21112969",
"url": "https://glygen.org/publication/PubMed/21112969"
}
]
},
{
"title": "Identification of novel functional organic anion-transporting polypeptide 1B3 polymorphisms and assessment of substrate specificity.",
"journal": "Pharmacogenetics and genomics",
"date": "2011",
"authors": "Schwarz UI, Meyer zu Schwabedissen HE, Tirona RG, Suzuki A, Leake BF, Mokrab Y, Mizuguchi K, Ho RH, Kim RB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9754706",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706"
}
],
"reference": [
{
"type": "PubMed",
"id": "21278621",
"url": "https://glygen.org/publication/PubMed/21278621"
}
]
},
{
"title": "Evaluation of 6beta-hydroxycortisol, 6beta-hydroxycortisone, and a combination of the two as endogenous probes for inhibition of CYP3A4 in vivo.",
"journal": "Clinical pharmacology and therapeutics",
"date": "2011",
"authors": "Peng CC, Templeton I, Thummel KE, Davis C, Kunze KL, Isoherranen N",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
},
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "21490593",
"url": "https://glygen.org/publication/PubMed/21490593"
}
]
},
{
"title": "Cholesterol 25-hydroxylation activity of CYP3A.",
"journal": "Journal of lipid research",
"date": "2011-08",
"authors": "Honda Akira, Miyazaki Teruo, Ikegami Tadashi, Iwamoto Junichi, Maeda Tomomi, Hirayama Takeshi, Saito Yoshifumi, Teramoto Tamio, Matsuzaki Yasushi",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "21576599",
"url": "https://glygen.org/publication/PubMed/21576599"
}
]
},
{
"title": "Autacoid 14S,21R-dihydroxy-docosahexaenoic acid counteracts diabetic impairment of macrophage prohealing functions.",
"journal": "The American journal of pathology",
"date": "2011",
"authors": "Tian H, Lu Y, Shah SP, Hong S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9027307",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027307"
}
],
"reference": [
{
"type": "PubMed",
"id": "21839062",
"url": "https://glygen.org/publication/PubMed/21839062"
}
]
},
{
"title": "Paraoxonase (PON1 and PON3) Polymorphisms: Impact on Liver Expression and Atorvastatin-Lactone Hydrolysis.",
"journal": "Frontiers in pharmacology",
"date": "2011",
"authors": "Riedmaier S, Klein K, Winter S, Hofmann U, Schwab M, Zanger UM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9754706",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706"
}
],
"reference": [
{
"type": "PubMed",
"id": "21852972",
"url": "https://glygen.org/publication/PubMed/21852972"
}
]
},
{
"title": "Multisite phosphorylation of human liver cytochrome P450 3A4 enhances Its gp78- and CHIP-mediated ubiquitination: a pivotal role of its Ser-478 residue in the gp78-catalyzed reaction.",
"journal": "Molecular & cellular proteomics : MCP",
"date": "2012",
"authors": "Wang Y, Guan S, Acharya P, Liu Y, Thirumaran RK, Brandman R, Schuetz EG, Burlingame AL, Correia MA",
"evidence": [
{
"database": "iPTMnet",
"id": "P08684",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "22101235",
"url": "https://glygen.org/publication/PubMed/22101235"
}
]
},
{
"title": "Molecular pathways: regulation and therapeutic implications of multidrug resistance.",
"journal": "Clinical cancer research : an official journal of the American Association for Cancer Research",
"date": "2012",
"authors": "Chen KG, Sikic BI",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "22344233",
"url": "https://glygen.org/publication/PubMed/22344233"
}
]
},
{
"title": "Biowaiver monograph for immediate-release solid oral dosage forms: acetylsalicylic acid.",
"journal": "Journal of pharmaceutical sciences",
"date": "2012",
"authors": "Dressman JB, Nair A, Abrahamsson B, Barends DM, Groot DW, Kopp S, Langguth P, Polli JE, Shah VP, Zimmer M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "22674043",
"url": "https://glygen.org/publication/PubMed/22674043"
}
]
},
{
"title": "Identification of a novel intracellular cholesteryl ester hydrolase (carboxylesterase 3) in human macrophages: compensatory increase in its expression after carboxylesterase 1 silencing.",
"journal": "American journal of physiology. Cell physiology",
"date": "2012",
"authors": "Zhao B, Bie J, Wang J, Marqueen SA, Ghosh S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "22700792",
"url": "https://glygen.org/publication/PubMed/22700792"
}
]
},
{
"title": "Oxidation of dihydrotestosterone by human cytochromes P450 19A1 and 3A4.",
"journal": "The Journal of biological chemistry",
"date": "2012-08-24",
"authors": "Cheng Qian, Sohl Christal D, Yoshimoto Francis K, Guengerich F Peter",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "22773874",
"url": "https://glygen.org/publication/PubMed/22773874"
}
]
},
{
"title": "The emerging role of human esterases.",
"journal": "Drug metabolism and pharmacokinetics",
"date": "2012",
"authors": "Fukami T, Yokoi T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "22813719",
"url": "https://glygen.org/publication/PubMed/22813719"
}
]
},
{
"title": "Characterisation of the roles of ABCB1, ABCC1, ABCC2 and ABCG2 in the transport and pharmacokinetics of actinomycin D in vitro and in vivo.",
"journal": "Biochemical pharmacology",
"date": "2013",
"authors": "Hill CR, Jamieson D, Thomas HD, Brown CD, Boddy AV, Veal GJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "23063411",
"url": "https://glygen.org/publication/PubMed/23063411"
}
]
},
{
"title": "Transport function and transcriptional regulation of a liver-enriched human organic anion transporting polypeptide 2B1 transcriptional start site variant.",
"journal": "Molecular pharmacology",
"date": "2013",
"authors": "Knauer MJ, Girdwood AJ, Kim RB, Tirona RG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9754706",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706"
}
],
"reference": [
{
"type": "PubMed",
"id": "23531488",
"url": "https://glygen.org/publication/PubMed/23531488"
}
]
},
{
"title": "ATP-dependent transport of statins by human and rat MRP2/Mrp2.",
"journal": "Toxicology and applied pharmacology",
"date": "2013",
"authors": "Ellis LC, Hawksworth GM, Weaver RJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9754706",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706"
}
],
"reference": [
{
"type": "PubMed",
"id": "23562342",
"url": "https://glygen.org/publication/PubMed/23562342"
}
]
},
{
"title": "Cobicistat, a pharmacoenhancer for HIV treatments.",
"journal": "Drugs of today (Barcelona, Spain : 1998)",
"date": "2013",
"authors": "Temesgen Z",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "23616950",
"url": "https://glygen.org/publication/PubMed/23616950"
}
]
},
{
"title": "Design, synthesis, biological and structural evaluation of functionalized resveratrol analogues as inhibitors of quinone reductase 2.",
"journal": "Bioorganic & medicinal chemistry",
"date": "2013",
"authors": "St John SE, Jensen KC, Kang S, Chen Y, Calamini B, Mesecar AD, Lipton MA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "23953689",
"url": "https://glygen.org/publication/PubMed/23953689"
}
]
},
{
"title": "Functional characterization of protein variants encoded by nonsynonymous single nucleotide polymorphisms in MARC1 and MARC2 in healthy Caucasians.",
"journal": "Drug metabolism and disposition: the biological fate of chemicals",
"date": "2014",
"authors": "Ott G, Reichmann D, Boerger C, Cascorbi I, Bittner F, Mendel RR, Kunze T, Clement B, Havemeyer A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "24423752",
"url": "https://glygen.org/publication/PubMed/24423752"
}
]
},
{
"title": "Characterization of mRNA species related to human liver cytochrome P-450 nifedipine oxidase and the regulation of catalytic activity.",
"journal": "J. Biol. Chem.",
"date": "1989",
"authors": "Bork RW, Muto T, Beaune PH, Srivastava PK, Lloyd RS, Guengerich FP",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "2463251",
"url": "https://glygen.org/publication/PubMed/2463251"
}
]
},
{
"title": "Development of selective inhibitors for human aldehyde dehydrogenase 3A1 (ALDH3A1) for the enhancement of cyclophosphamide cytotoxicity.",
"journal": "Chembiochem : a European journal of chemical biology",
"date": "2014",
"authors": "Parajuli B, Georgiadis TM, Fishel ML, Hurley TD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "24677340",
"url": "https://glygen.org/publication/PubMed/24677340"
}
]
},
{
"title": "Hepatic uptake of atorvastatin: influence of variability in transporter expression on uptake clearance and drug-drug interactions.",
"journal": "Drug metabolism and disposition: the biological fate of chemicals",
"date": "2014",
"authors": "Vildhede A, Karlgren M, Svedberg EK, Wisniewski JR, Lai Y, Noren A, Artursson P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9754706",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706"
}
],
"reference": [
{
"type": "PubMed",
"id": "24799396",
"url": "https://glygen.org/publication/PubMed/24799396"
}
]
},
{
"title": "Cobicistat (GS-9350): A Potent and Selective Inhibitor of Human CYP3A as a Novel Pharmacoenhancer.",
"journal": "ACS medicinal chemistry letters",
"date": "2010",
"authors": "Xu L, Liu H, Murray BP, Callebaut C, Lee MS, Hong A, Strickley RG, Tsai LK, Stray KM, Wang Y, Rhodes GR, Desai MC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "24900196",
"url": "https://glygen.org/publication/PubMed/24900196"
}
]
},
{
"title": "The N-reductive system composed of mitochondrial amidoxime reducing component (mARC), cytochrome b5 (CYB5B) and cytochrome b5 reductase (CYB5R) is regulated by fasting and high fat diet in mice.",
"journal": "PloS one",
"date": "2014",
"authors": "Jakobs HH, Mikula M, Havemeyer A, Strzalkowska A, Borowa-Chmielak M, Dzwonek A, Gajewska M, Hennig EE, Ostrowski J, Clement B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "25144769",
"url": "https://glygen.org/publication/PubMed/25144769"
}
]
},
{
"title": "Maresin-like lipid mediators are produced by leukocytes and platelets and rescue reparative function of diabetes-impaired macrophages.",
"journal": "Chemistry & biology",
"date": "2014",
"authors": "Hong S, Lu Y, Tian H, Alapure BV, Wang Q, Bunnell BA, Laborde JM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9027307",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027307"
}
],
"reference": [
{
"type": "PubMed",
"id": "25200603",
"url": "https://glygen.org/publication/PubMed/25200603"
}
]
},
{
"title": "The mammalian molybdenum enzymes of mARC.",
"journal": "Journal of biological inorganic chemistry : JBIC : a publication of the Society of Biological Inorganic Chemistry",
"date": "2015",
"authors": "Ott G, Havemeyer A, Clement B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "25425164",
"url": "https://glygen.org/publication/PubMed/25425164"
}
]
},
{
"title": "Metabolism of doxorubicin to the cardiotoxic metabolite doxorubicinol is increased in a mouse model of chronic glutathione deficiency: A potential role for carbonyl reductase 3.",
"journal": "Chemico-biological interactions",
"date": "2015",
"authors": "Schaupp CM, White CC, Merrill GF, Kavanagh TJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "25446851",
"url": "https://glygen.org/publication/PubMed/25446851"
}
]
},
{
"title": "The human cytochrome P450 CYP3 locus: assignment to chromosome 7q22-qter.",
"journal": "Hum. Genet.",
"date": "1989",
"authors": "Spurr N K, Gough A C, Stevenson K, Wolf C R",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "2563251",
"url": "https://glygen.org/publication/PubMed/2563251"
}
]
},
{
"title": "Transepithelial transport of drugs by the multidrug transporter in cultured Madin-Darby canine kidney cell epithelia.",
"journal": "The Journal of biological chemistry",
"date": "1989",
"authors": "Horio M, Chin KV, Currier SJ, Goldenberg S, Williams C, Pastan I, Gottesman MM, Handler J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "2570070",
"url": "https://glygen.org/publication/PubMed/2570070"
}
]
},
{
"title": "Different gamma-glutamyl transpeptidase mRNAs are expressed in human liver and kidney.",
"journal": "Biochemical and biophysical research communications",
"date": "1989",
"authors": "Pawlak A, Wu SJ, Bulle F, Suzuki A, Chikhi N, Ferry N, Baik JH, Siegrist S, Guellaen G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5423646",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646"
}
],
"reference": [
{
"type": "PubMed",
"id": "2573352",
"url": "https://glygen.org/publication/PubMed/2573352"
}
]
},
{
"title": "Detection and characterization of prednisolone metabolites in human urine by LC-MS/MS.",
"journal": "Journal of mass spectrometry : JMS",
"date": "2015",
"authors": "Matabosch X, Pozo OJ, Perez-Mana C, Papaseit E, Segura J, Ventura R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "25800201",
"url": "https://glygen.org/publication/PubMed/25800201"
}
]
},
{
"title": "Aromatic hydroxylation of salicylic acid and aspirin by human cytochromes P450.",
"journal": "European journal of pharmaceutical sciences : official journal of the European Federation for Pharmaceutical Sciences",
"date": "2015",
"authors": "Bojic M, Sedgeman CA, Nagy LD, Guengerich FP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "25840124",
"url": "https://glygen.org/publication/PubMed/25840124"
}
]
},
{
"title": "Ritonavir is the best alternative to ketoconazole as an index inhibitor of cytochrome P450-3A in drug-drug interaction studies.",
"journal": "British journal of clinical pharmacology",
"date": "2015",
"authors": "Greenblatt DJ, Harmatz JS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "25923589",
"url": "https://glygen.org/publication/PubMed/25923589"
}
]
},
{
"title": "Temozolomide competes for P-glycoprotein and contributes to chemoresistance in glioblastoma cells.",
"journal": "Cancer letters",
"date": "2015",
"authors": "Munoz JL, Walker ND, Scotto KW, Rameshwar P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "26208431",
"url": "https://glygen.org/publication/PubMed/26208431"
}
]
},
{
"title": "Impact of ketoconazole on the metabolism of prednisolone.",
"journal": "Clinical pharmacology and therapeutics",
"date": "1989",
"authors": "Zurcher RM, Frey BM, Frey FJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "2639662",
"url": "https://glygen.org/publication/PubMed/2639662"
}
]
},
{
"title": "Statin Lactonization by Uridine 5'-Diphospho-glucuronosyltransferases (UGTs).",
"journal": "Molecular pharmaceutics",
"date": "2015",
"authors": "Schirris TJ, Ritschel T, Bilos A, Smeitink JA, Russel FG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9754706",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706"
}
],
"reference": [
{
"type": "PubMed",
"id": "26412035",
"url": "https://glygen.org/publication/PubMed/26412035"
}
]
},
{
"title": "Haem-dependent dimerization of PGRMC1/Sigma-2 receptor facilitates cancer proliferation and chemoresistance.",
"journal": "Nat. Commun.",
"date": "2016",
"authors": "Kabe Y, Nakane T, Koike I, Yamamoto T, Sugiura Y, Harada E, Sugase K, Shimamura T, Ohmura M, Muraoka K, Yamamoto A, Uchida T, Iwata S, Yamaguchi Y, Krayukhina E, Noda M, Handa H, Ishimori K, Uchiyama S, Kobayashi T, Suematsu M",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "26988023",
"url": "https://glygen.org/publication/PubMed/26988023"
}
]
},
{
"title": "Cytochrome P-450 hPCN3, a novel cytochrome P-450 IIIA gene product that is differentially expressed in adult human liver. cDNA and deduced amino acid sequence and distinct specificities of cDNA-expressed hPCN1 and hPCN3 for the metabolism of steroid hormones and cyclosporine.",
"journal": "The Journal of biological chemistry",
"date": "1989-06-25",
"authors": "Aoyama T, Yamano S, Waxman D J, Lapenson D P, Meyer U A, Fischer V, Tyndale R, Inaba T, Kalow W, Gelboin H V",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "2732228",
"url": "https://glygen.org/publication/PubMed/2732228"
}
]
},
{
"title": "Cortisol and CBG - Getting cortisol to the right place at the right time.",
"journal": "Pharmacology & therapeutics",
"date": "2016",
"authors": "Henley D, Lightman S, Carrell R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "27411675",
"url": "https://glygen.org/publication/PubMed/27411675"
}
]
},
{
"title": "Polymorphisms in the multidrug-resistance 1 gene related to glucocorticoid response in rheumatoid arthritis treatment.",
"journal": "Rheumatology international",
"date": "2017",
"authors": "Cuppen BV, Pardali K, Kraan MC, Marijnissen AC, Yrlid L, Olsson M, Bijlsma JW, Lafeber FP, Fritsch-Stork RD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "28132103",
"url": "https://glygen.org/publication/PubMed/28132103"
}
]
},
{
"title": "Carboxylesterases in lipid metabolism: from mouse to human.",
"journal": "Protein & cell",
"date": "2018",
"authors": "Lian J, Nelson R, Lehner R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "28677105",
"url": "https://glygen.org/publication/PubMed/28677105"
}
]
},
{
"title": "Internal duplication and homology with bacterial transport proteins in the mdr1 (P-glycoprotein) gene from multidrug-resistant human cells.",
"journal": "Cell",
"date": "1986",
"authors": "Chen CJ, Chin JE, Ueda K, Clark DP, Pastan I, Gottesman MM, Roninson IB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "2876781",
"url": "https://glygen.org/publication/PubMed/2876781"
}
]
},
{
"title": "Doxorubicin cardiotoxicity may be caused by its metabolite, doxorubicinol.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1988",
"authors": "Olson RD, Mushlin PS, Brenner DE, Fleischer S, Cusack BJ, Chang BK, Boucek RJ Jr",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "2897122",
"url": "https://glygen.org/publication/PubMed/2897122"
}
]
},
{
"title": "A retrovirus carrying an MDR1 cDNA confers multidrug resistance and polarized expression of P-glycoprotein in MDCK cells.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1988",
"authors": "Pastan I, Gottesman MM, Ueda K, Lovelace E, Rutherford AV, Willingham MC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "2898143",
"url": "https://glygen.org/publication/PubMed/2898143"
}
]
},
{
"title": "CYP3A4 Gene Is a Novel Biomarker for Predicting a Poor Prognosis in Hepatocellular Carcinoma.",
"journal": "Cancer genomics & proteomics",
"date": "2017",
"authors": "Ashida R, Okamura Y, Ohshima K, Kakuda Y, Uesaka K, Sugiura T, Ito T, Yamamoto Y, Sugino T, Urakami K, Kusuhara M, Yamaguchi K",
"evidence": [
{
"database": "GlyGen",
"id": "A0015",
"url": "https://data.glygen.org/GLY_000625"
}
],
"reference": [
{
"type": "PubMed",
"id": "29109094",
"url": "https://glygen.org/publication/PubMed/29109094"
}
]
},
{
"title": "CYP3A4 mutation causes vitamin D-dependent rickets type 3.",
"journal": "The Journal of clinical investigation",
"date": "2018",
"authors": "Roizen JD, Li D, O'Lear L, Javaid MK, Shaw NJ, Ebeling PR, Nguyen HH, Rodda CP, Thummel KE, Thacher TD, Hakonarson H, Levine MA",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "29461981",
"url": "https://glygen.org/publication/PubMed/29461981"
}
]
},
{
"title": "Structural and Functional Biology of Aldo-Keto Reductase Steroid-Transforming Enzymes.",
"journal": "Endocrine reviews",
"date": "2019",
"authors": "Penning TM, Wangtrakuldee P, Auchus RJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "30137266",
"url": "https://glygen.org/publication/PubMed/30137266"
}
]
},
{
"title": "Urinary excretion profile of prednisone and prednisolone after different administration routes.",
"journal": "Drug testing and analysis",
"date": "2019",
"authors": "Mazzarino M, Piantadosi C, Comunita F, de la Torre X, Botre F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "31701669",
"url": "https://glygen.org/publication/PubMed/31701669"
}
]
},
{
"title": "Compounds with Therapeutic Potential against Novel Respiratory 2019 Coronavirus.",
"journal": "Antimicrobial agents and chemotherapy",
"date": "2020",
"authors": "Martinez MA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "32152082",
"url": "https://glygen.org/publication/PubMed/32152082"
}
]
},
{
"title": "Arbidol combined with LPV/r versus LPV/r alone against Corona Virus Disease 2019: A retrospective cohort study.",
"journal": "The Journal of infection",
"date": "2020",
"authors": "Deng L, Li C, Zeng Q, Liu X, Li X, Zhang H, Hong Z, Xia J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "32171872",
"url": "https://glygen.org/publication/PubMed/32171872"
}
]
},
{
"title": "A Trial of Lopinavir-Ritonavir in Adults Hospitalized with Severe Covid-19.",
"journal": "The New England journal of medicine",
"date": "2020",
"authors": "Cao B, Wang Y, Wen D, Liu W, Wang J, Fan G, Ruan L, Song B, Cai Y, Wei M, Li X, Xia J, Chen N, Xiang J, Yu T, Bai T, Xie X, Zhang L, Li C, Yuan Y, Chen H, Li H, Huang H, Tu S, Gong F, Liu Y, Wei Y, Dong C, Zhou F, Gu X, Xu J, Liu Z, Zhang Y, Li H, Shang L, Wang K, Li K, Zhou X, Dong X, Qu Z, Lu S, Hu X, Ruan S, Luo S, Wu J, Peng L, Cheng F, Pan L, Zou J, Jia C, Wang J, Liu X, Wang S, Wu X, Ge Q, He J, Zhan H, Qiu F, Guo L, Huang C, Jaki T, Hayden FG, Horby PW, Zhang D, Wang C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "32187464",
"url": "https://glygen.org/publication/PubMed/32187464"
}
]
},
{
"title": "Coronavirus puts drug repurposing on the fast track.",
"journal": "Nature biotechnology",
"date": "2020",
"authors": "Harrison C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "32205870",
"url": "https://glygen.org/publication/PubMed/32205870"
}
]
},
{
"title": "Unrevealing sequence and structural features of novel coronavirus using in silico approaches: The main protease as molecular target.",
"journal": "EXCLI journal",
"date": "2020",
"authors": "Ortega JT, Serrano ML, Pujol FH, Rangel HR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "32210741",
"url": "https://glygen.org/publication/PubMed/32210741"
}
]
},
{
"title": "Cytochrome P-450 in human liver microsomes: high-performance liquid chromatographic isolation of three forms and their characterization.",
"journal": "J. Biochem.",
"date": "1988",
"authors": "Komori M, Hashizume T, Ohi H, Miura T, Kitada M, Nagashima K, Kamataki T",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "3243766",
"url": "https://glygen.org/publication/PubMed/3243766"
}
]
},
{
"title": "Human P450PCN1: sequence, chromosome localization, and direct evidence through cDNA expression that P450PCN1 is nifedipine oxidase.",
"journal": "DNA",
"date": "1988",
"authors": "Gonzalez F J, Schmid B J, Umeno M, Mcbride O W, Hardwick J P, Meyer U A, Gelboin H V, Idle J R",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "3267210",
"url": "https://glygen.org/publication/PubMed/3267210"
}
]
},
{
"title": "Cytochrome P450-mediated drug interactions in COVID-19 patients: Current findings and possible mechanisms.",
"journal": "Medical hypotheses",
"date": "2020",
"authors": "El-Ghiaty MA, Shoieb SM, El-Kadi AOS",
"evidence": [
{
"database": "GlyGen",
"id": "A0015",
"url": "https://data.glygen.org/GLY_000625"
}
],
"reference": [
{
"type": "PubMed",
"id": "32758877",
"url": "https://glygen.org/publication/PubMed/32758877"
}
]
},
{
"title": "Is the emperor wearing shorts? The published structures of ABC transporters.",
"journal": "FEBS letters",
"date": "2020",
"authors": "Jones PM, George AM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "32981041",
"url": "https://glygen.org/publication/PubMed/32981041"
}
]
},
{
"title": "2,3-Dihydroxybenzoic acid is a product of human aspirin metabolism.",
"journal": "Biochemical pharmacology",
"date": "1988",
"authors": "Grootveld M, Halliwell B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "3342084",
"url": "https://glygen.org/publication/PubMed/3342084"
}
]
},
{
"title": "Gene expression of rat and human microsomal glutathione S-transferases.",
"journal": "The Journal of biological chemistry",
"date": "1988",
"authors": "DeJong JL, Morgenstern R, Jornvall H, DePierre JW, Tu CP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5423646",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646"
}
],
"reference": [
{
"type": "PubMed",
"id": "3372534",
"url": "https://glygen.org/publication/PubMed/3372534"
}
]
},
{
"title": "Comparative Hepatic and Intestinal Metabolism and Pharmacodynamics of Statins.",
"journal": "Drug metabolism and disposition: the biological fate of chemicals",
"date": "2021",
"authors": "Filppula AM, Hirvensalo P, Parviainen H, Ivaska VE, Lonnberg KI, Deng F, Viinamaki J, Kurkela M, Neuvonen M, Niemi M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9754706",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706"
}
],
"reference": [
{
"type": "PubMed",
"id": "34045219",
"url": "https://glygen.org/publication/PubMed/34045219"
}
]
},
{
"title": "Complete cDNA sequence of a cytochrome P-450 inducible by glucocorticoids in human liver.",
"journal": "Proc. Natl. Acad. Sci. U.S.A.",
"date": "1986",
"authors": "Molowa D T, Schuetz E G, Wrighton S A, Watkins P B, Kremers P, Mendez-Picon G, Parker G A, Guzelian P S",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "3460094",
"url": "https://glygen.org/publication/PubMed/3460094"
}
]
},
{
"title": "Isolation and sequence determination of a cDNA clone related to human cytochrome P-450 nifedipine oxidase.",
"journal": "Proc. Natl. Acad. Sci. U.S.A.",
"date": "1986",
"authors": "Beaune P H, Umbenhauer D R, Bork R W, Lloyd R S, Guengerich F P",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "3464943",
"url": "https://glygen.org/publication/PubMed/3464943"
}
]
},
{
"title": "Expression of a full-length cDNA for the human `MDR1` gene confers resistance to colchicine, doxorubicin, and vinblastine.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1987",
"authors": "Ueda K, Cardarelli C, Gottesman MM, Pastan I",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "3472246",
"url": "https://glygen.org/publication/PubMed/3472246"
}
]
},
{
"title": "The nonlinear pharmacokinetics of prednisone and prednisolone. II. Plasma protein binding of prednisone and prednisolone in rabbit and human plasma.",
"journal": "Biopharmaceutics & drug disposition",
"date": "1987",
"authors": "Ferry JJ, Wagner JG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "3593903",
"url": "https://glygen.org/publication/PubMed/3593903"
}
]
},
{
"title": "The metabolism of aspirin in man: a population study.",
"journal": "Xenobiotica; the fate of foreign compounds in biological systems",
"date": "1986",
"authors": "Hutt AJ, Caldwell J, Smith RL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "3705620",
"url": "https://glygen.org/publication/PubMed/3705620"
}
]
},
{
"title": "The effect of prednisone and hydrocortisone on the plasma protein binding of prednisolone in man.",
"journal": "European journal of clinical pharmacology",
"date": "1986",
"authors": "Legler UF, Benet LZ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "3709632",
"url": "https://glygen.org/publication/PubMed/3709632"
}
]
},
{
"title": "Association between CYP3A4/CYP3A5 genetic polymorphisms and treatment outcomes of atorvastatin worldwide: is there enough research on the Egyptian population?",
"journal": "European journal of medical research",
"date": "2023-09-27",
"authors": "Maslub Mohammed G, Radwan Mahasen A, Daud Nur Aizati Athirah, Sha'aban Abubakar",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001189784",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001189784"
}
],
"reference": [
{
"type": "PubMed",
"id": "37759317",
"url": "https://glygen.org/publication/PubMed/37759317"
}
]
},
{
"title": "The roles of CYP2C19 and CYP3A4 in the in\u00a0vitro metabolism of \u03b2-eudesmol in human liver: Reaction phenotyping and enzyme kinetics.",
"journal": "Pharmacology research & perspectives",
"date": "2023-12",
"authors": "Muhamad Nadda, Na-Bangchang Kesara",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001189784",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001189784"
}
],
"reference": [
{
"type": "PubMed",
"id": "37902256",
"url": "https://glygen.org/publication/PubMed/37902256"
}
]
},
{
"title": "The impacts of CYP3A4 genetic polymorphism and drug interactions on the metabolism of lurasidone.",
"journal": "Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie",
"date": "2023-12",
"authors": "Li Qingqing, Wang Jing, Wang Zheng-Lu, Shen Yuxin, Zhou Qi, Liu Ya-Nan, Hu Guo-Xin, Cai Jian-Ping, Xu Ren-Ai",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001189784",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001189784"
}
],
"reference": [
{
"type": "PubMed",
"id": "37935069",
"url": "https://glygen.org/publication/PubMed/37935069"
}
]
},
{
"title": "Down-Regulation of CYP3A4 by the KCa1.1 Inhibition Is Responsible for Overcoming Resistance to Doxorubicin in Cancer Spheroid Models.",
"journal": "International journal of molecular sciences",
"date": "2023-10-27",
"authors": "Ohya Susumu, Kajikuri Junko, Kito Hiroaki, Matsui Miki",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001189784",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001189784"
}
],
"reference": [
{
"type": "PubMed",
"id": "37958656",
"url": "https://glygen.org/publication/PubMed/37958656"
}
]
},
{
"title": "Cytochrome P4503A4 gene polymorphisms guide safe sufentanil analgesic doses in pregnant Chinese mothers: a multicenter, randomized, prospective study.",
"journal": "Pharmacogenetics and genomics",
"date": "2024-01-01",
"authors": "Shu Xiangrong, Yan Yan, Yu Jingxian, Chi Liqun",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001189784",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001189784"
}
],
"reference": [
{
"type": "PubMed",
"id": "37962984",
"url": "https://glygen.org/publication/PubMed/37962984"
}
]
},
{
"title": "Identification of an inducible form of cytochrome P-450 in human liver.",
"journal": "Proc. Natl. Acad. Sci. U.S.A.",
"date": "1985",
"authors": "Watkins P B, Wrighton S A, Maurel P, Schuetz E G, Mendez-Picon G, Parker G A, Guzelian P S",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "3898085",
"url": "https://glygen.org/publication/PubMed/3898085"
}
]
},
{
"title": "Aflatoxin metabolism in humans: detection of metabolites and nucleic acid adducts in urine by affinity chromatography.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1985",
"authors": "Groopman JD, Donahue PR, Zhu JQ, Chen JS, Wogan GN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5423646",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646"
}
],
"reference": [
{
"type": "PubMed",
"id": "3931076",
"url": "https://glygen.org/publication/PubMed/3931076"
}
]
},
{
"title": "Absorption kinetics of aspirin in man following oral administration of an aqueous solution.",
"journal": "Journal of pharmaceutical sciences",
"date": "1972",
"authors": "Rowland M, Riegelman S, Harris PA, Sholkoff SD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "5013373",
"url": "https://glygen.org/publication/PubMed/5013373"
}
]
},
{
"title": "Structural changes in human serum albumin induced by ingestion of acetylsalicylic acid.",
"journal": "The Journal of clinical investigation",
"date": "1969",
"authors": "Hawkins D, Pinckard RN, Crawford IP, Farr RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "5773090",
"url": "https://glygen.org/publication/PubMed/5773090"
}
]
},
{
"title": "Pharmacokinetics of salicylate elimination in man.",
"journal": "Journal of pharmaceutical sciences",
"date": "1965",
"authors": "Levy G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "5862532",
"url": "https://glygen.org/publication/PubMed/5862532"
}
]
},
{
"title": "Substrate specificity of the form of cytochrome P-450 catalyzing the 4-hydroxylation of debrisoquine in man.",
"journal": "Molecular pharmacology",
"date": "1983",
"authors": "Boobis AR, Murray S, Kahn GC, Robertz GM, Davies DS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211981",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981"
}
],
"reference": [
{
"type": "PubMed",
"id": "6220203",
"url": "https://glygen.org/publication/PubMed/6220203"
}
]
},
{
"title": "Difference in hepatic uptake kinetics of aspirin and salicylamide in rats.",
"journal": "Biochemical pharmacology",
"date": "1984",
"authors": "Iwamoto K, Furune Y, Watanabe J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "6487359",
"url": "https://glygen.org/publication/PubMed/6487359"
}
]
},
{
"title": "Plasma protein binding interaction of prednisone and prednisolone.",
"journal": "Journal of steroid biochemistry",
"date": "1984",
"authors": "Boudinot FD, Jusko WJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "6492791",
"url": "https://glygen.org/publication/PubMed/6492791"
}
]
},
{
"title": "Plasma aspirin esterases in normal individuals, patients with alcoholic liver disease and rheumatoid arthritis: characterization and the importance of the enzymic components.",
"journal": "European journal of clinical investigation",
"date": "1980",
"authors": "Rainsford KD, Ford NL, Brooks PM, Watson HM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "6777177",
"url": "https://glygen.org/publication/PubMed/6777177"
}
]
},
{
"title": "Identification and partial purification of the major aspirin hydrolyzing enzyme in human blood.",
"journal": "Arthritis and rheumatism",
"date": "1983",
"authors": "Costello PB, Green FA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "6838677",
"url": "https://glygen.org/publication/PubMed/6838677"
}
]
},
{
"title": "Prednisolone binding to albumin and transcortin in the presence of cortisol.",
"journal": "Biochemical pharmacology",
"date": "1982",
"authors": "Rocci ML Jr, D'Ambrosio R, Johnson NF, Jusko WJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "7073761",
"url": "https://glygen.org/publication/PubMed/7073761"
}
]
},
{
"title": "Transport of steroid hormones: interaction of 70 drugs with testosterone-binding globulin and corticosteroid-binding globulin in human plasma.",
"journal": "The Journal of clinical endocrinology and metabolism",
"date": "1981",
"authors": "Pugeat MM, Dunn JF, Nisula BC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "7195405",
"url": "https://glygen.org/publication/PubMed/7195405"
}
]
},
{
"title": "Comparative study of human intestinal and hepatic esterases as related to enzymatic properties and hydrolizing activity for ester-type drugs.",
"journal": "Japanese journal of pharmacology",
"date": "1980",
"authors": "Inoue M, Morikawa M, Tsuboi M, Ito Y, Sugiura M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "7206363",
"url": "https://glygen.org/publication/PubMed/7206363"
}
]
},
{
"title": "Destruction of cytochrome P-450 by ethylene. Structure of the resulting prosthetic heme adduct.",
"journal": "The Journal of biological chemistry",
"date": "1981",
"authors": "Ortiz de Montellano PR, Beilan HS, Kunze KL, Mico BA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211981",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981"
}
],
"reference": [
{
"type": "PubMed",
"id": "7217086",
"url": "https://glygen.org/publication/PubMed/7217086"
}
]
},
{
"title": "Dose dependent pharmacokinetics of prednisone and prednisolone in man.",
"journal": "Journal of pharmacokinetics and biopharmaceutics",
"date": "1981",
"authors": "Rose JQ, Yurchak AM, Jusko WJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "7310640",
"url": "https://glygen.org/publication/PubMed/7310640"
}
]
},
{
"title": "Serum protein binding of prednisolone in four species.",
"journal": "Journal of pharmaceutical sciences",
"date": "1980",
"authors": "Rocci ML Jr, Johnson NF, Jusko WJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "7400951",
"url": "https://glygen.org/publication/PubMed/7400951"
}
]
},
{
"title": "11 beta-hydroxysteroid dehydrogenase is an exclusive 11 beta- reductase in primary cultures of rat hepatocytes: effect of physicochemical and hormonal manipulations.",
"journal": "Endocrinology",
"date": "1995",
"authors": "Jamieson PM, Chapman KE, Edwards CR, Seckl JR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "7588203",
"url": "https://glygen.org/publication/PubMed/7588203"
}
]
},
{
"title": "Gene structural analysis and expression of human renal dipeptidase.",
"journal": "Biotechnology progress",
"date": "1994",
"authors": "Satoh S, Ohtsuka K, Keida Y, Kusunoki C, Konta Y, Niwa M, Kohsaka M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5423646",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646"
}
],
"reference": [
{
"type": "PubMed",
"id": "7764673",
"url": "https://glygen.org/publication/PubMed/7764673"
}
]
},
{
"title": "Oxidation of aflatoxin B1 by bacterial recombinant human cytochrome P450 enzymes.",
"journal": "Chemical research in toxicology",
"date": "1995",
"authors": "Ueng YF, Shimada T, Yamazaki H, Guengerich FP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5423646",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646"
}
],
"reference": [
{
"type": "PubMed",
"id": "7766804",
"url": "https://glygen.org/publication/PubMed/7766804"
}
]
},
{
"title": "Purification to homogeneity of mitochondrial acyl coa:glycine n-acyltransferase from human liver.",
"journal": "Biochemical and biophysical research communications",
"date": "1994",
"authors": "Mawal YR, Qureshi IA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "7802672",
"url": "https://glygen.org/publication/PubMed/7802672"
}
]
},
{
"title": "P-glycoprotein mediates profound resistance to bisantrene.",
"journal": "Oncology research",
"date": "1994",
"authors": "Zhang XP, Ritke MK, Yalowich JC, Slovak ML, Ho JP, Collins KI, Annable T, Arceci RJ, Durr FE, Greenberger LM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "7865904",
"url": "https://glygen.org/publication/PubMed/7865904"
}
]
},
{
"title": "CYP3A gene expression in human gut epithelium.",
"journal": "Pharmacogenetics",
"date": "1994",
"authors": "Kolars J C, Lown K S, Schmiedlin-Ren P, Ghosh M, Fang C, Wrighton S A, Merion R M, Watkins P B",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "7894497",
"url": "https://glygen.org/publication/PubMed/7894497"
}
]
},
{
"title": "Inherited amplification of an active gene in the cytochrome P450 CYP2D locus as a cause of ultrarapid metabolism of debrisoquine.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1993",
"authors": "Johansson I, Lundqvist E, Bertilsson L, Dahl ML, Sjoqvist F, Ingelman-Sundberg M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211981",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981"
}
],
"reference": [
{
"type": "PubMed",
"id": "7903454",
"url": "https://glygen.org/publication/PubMed/7903454"
}
]
},
{
"title": "Purification and characterization of a human liver cocaine carboxylesterase that catalyzes the production of benzoylecgonine and the formation of cocaethylene from alcohol and cocaine.",
"journal": "Biochemical pharmacology",
"date": "1994",
"authors": "Brzezinski MR, Abraham TL, Stone CL, Dean RA, Bosron WF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "7980644",
"url": "https://glygen.org/publication/PubMed/7980644"
}
]
},
{
"title": "Interindividual variations in human liver cytochrome P-450 enzymes involved in the oxidation of drugs, carcinogens and toxic chemicals: studies with liver microsomes of 30 Japanese and 30 Caucasians.",
"journal": "J. Pharmacol. Exp. Ther.",
"date": "1994",
"authors": "Shimada T, Yamazaki H, Mimura M, Inui Y, Guengerich F P",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "8035341",
"url": "https://glygen.org/publication/PubMed/8035341"
}
]
},
{
"title": "Cloning and structural analysis of genomic DNA for human renal dipeptidase.",
"journal": "Biochimica et biophysica acta",
"date": "1993",
"authors": "Satoh S, Kusunoki C, Konta Y, Niwa M, Kohsaka M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5423646",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646"
}
],
"reference": [
{
"type": "PubMed",
"id": "8439558",
"url": "https://glygen.org/publication/PubMed/8439558"
}
]
},
{
"title": "Identification of residues 99, 220, and 221 of human cytochrome P450 2C19 as key determinants of omeprazole activity.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Ibeanu GC, Ghanayem BI, Linko P, Li L, Pederson LG, Goldstein JA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211981",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981"
}
],
"reference": [
{
"type": "PubMed",
"id": "8647857",
"url": "https://glygen.org/publication/PubMed/8647857"
}
]
},
{
"title": "Identification and characterization of a novel human microsomal glutathione S-transferase with leukotriene C4 synthase activity and significant sequence identity to 5-lipoxygenase-activating protein and leukotriene C4 synthase.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Jakobsson PJ, Mancini JA, Ford-Hutchinson AW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5423646",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646"
}
],
"reference": [
{
"type": "PubMed",
"id": "8703034",
"url": "https://glygen.org/publication/PubMed/8703034"
}
]
},
{
"title": "Structural organization of the human microsomal glutathione S-transferase gene (GST12).",
"journal": "Genomics",
"date": "1996",
"authors": "Kelner MJ, Stokely MN, Stovall NE, Montoya MA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5423646",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646"
}
],
"reference": [
{
"type": "PubMed",
"id": "8812420",
"url": "https://glygen.org/publication/PubMed/8812420"
}
]
},
{
"title": "Identification of human cytochrome P450 isoforms involved in the 3-hydroxylation of quinine by human live microsomes and nine recombinant human cytochromes P450.",
"journal": "The Journal of pharmacology and experimental therapeutics",
"date": "1996-12",
"authors": "Zhao X J, Yokoyama H, Chiba K, Wanwimolruk S, Ishizaki T",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "8968357",
"url": "https://glygen.org/publication/PubMed/8968357"
}
]
},
{
"title": "The kinetics of aflatoxin B1 oxidation by human cDNA-expressed and human liver microsomal cytochromes P450 1A2 and 3A4.",
"journal": "Toxicology and applied pharmacology",
"date": "1996",
"authors": "Gallagher EP, Kunze KL, Stapleton PL, Eaton DL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5423646",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646"
}
],
"reference": [
{
"type": "PubMed",
"id": "8975785",
"url": "https://glygen.org/publication/PubMed/8975785"
}
]
},
{
"title": "Cancer chemopreventive activity of resveratrol, a natural product derived from grapes.",
"journal": "Science (New York, N.Y.)",
"date": "1997",
"authors": "Jang M, Cai L, Udeani GO, Slowing KV, Thomas CF, Beecher CW, Fong HH, Farnsworth NR, Kinghorn AD, Mehta RG, Moon RC, Pezzuto JM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "8985016",
"url": "https://glygen.org/publication/PubMed/8985016"
}
]
},
{
"title": "Molecular cloning and characterization of a novel putative carboxylesterase, present in human intestine and liver.",
"journal": "Biochemical and biophysical research communications",
"date": "1997",
"authors": "Schwer H, Langmann T, Daig R, Becker A, Aslanidis C, Schmitz G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "9144407",
"url": "https://glygen.org/publication/PubMed/9144407"
}
]
},
{
"title": "Purification and cloning of a broad substrate specificity human liver carboxylesterase that catalyzes the hydrolysis of cocaine and heroin.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Pindel EV, Kedishvili NY, Abraham TL, Brzezinski MR, Zhang J, Dean RA, Bosron WF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "9169443",
"url": "https://glygen.org/publication/PubMed/9169443"
}
]
},
{
"title": "Identification and characterization of a novel microsomal enzyme with glutathione-dependent transferase and peroxidase activities.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Jakobsson PJ, Mancini JA, Riendeau D, Ford-Hutchinson AW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5423646",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646"
}
],
"reference": [
{
"type": "PubMed",
"id": "9278457",
"url": "https://glygen.org/publication/PubMed/9278457"
}
]
},
{
"title": "Identification of separate acyl- CoA:glycine and acyl-CoA:L-glutamine N-acyltransferase activities in mitochondrial fractions from liver of rhesus monkey and man.",
"journal": "The Journal of biological chemistry",
"date": "1976",
"authors": "Webster LT, Siddiqui UA, Lucas SV, Strong JM, Mieyal JJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "931988",
"url": "https://glygen.org/publication/PubMed/931988"
}
]
},
{
"title": "Catalytic properties of NAD(P)H:quinone oxidoreductase-2 (NQO2), a dihydronicotinamide riboside dependent oxidoreductase.",
"journal": "Archives of biochemistry and biophysics",
"date": "1997",
"authors": "Wu K, Knox R, Sun XZ, Joseph P, Jaiswal AK, Zhang D, Deng PS, Chen S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "9367528",
"url": "https://glygen.org/publication/PubMed/9367528"
}
]
},
{
"title": "Human liver paraoxonase (PON1): subcellular distribution and characterization.",
"journal": "Journal of biochemical and molecular toxicology",
"date": "1998",
"authors": "Gonzalvo MC, Gil F, Hernandez AF, Rodrigo L, Villanueva E, Pla A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9754706",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706"
}
],
"reference": [
{
"type": "PubMed",
"id": "9414488",
"url": "https://glygen.org/publication/PubMed/9414488"
}
]
},
{
"title": "Cytochromes P450 with bisallylic hydroxylation activity on arachidonic and linoleic acids studied with human recombinant enzymes and with human and rat liver microsomes.",
"journal": "The Journal of pharmacology and experimental therapeutics",
"date": "1998",
"authors": "Bylund J, Kunz T, Valmsen K, Oliw EH",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"reference": [
{
"type": "PubMed",
"id": "9435160",
"url": "https://glygen.org/publication/PubMed/9435160"
}
]
},
{
"title": "Immunohistochemical localization of type 1 11beta-hydroxysteroid dehydrogenase in human tissues.",
"journal": "The Journal of clinical endocrinology and metabolism",
"date": "1998",
"authors": "Ricketts ML, Verhaeg JM, Bujalska I, Howie AJ, Rainey WE, Stewart PM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "9543163",
"url": "https://glygen.org/publication/PubMed/9543163"
}
]
},
{
"title": "Molecular cloning, expression and catalytic activity of a human AKR7 member of the aldo-keto reductase superfamily: evidence that the major 2-carboxybenzaldehyde reductase from human liver is a homologue of rat aflatoxin B1-aldehyde reductase.",
"journal": "The Biochemical journal",
"date": "1998",
"authors": "Ireland LS, Harrison DJ, Neal GE, Hayes JD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5423646",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646"
}
],
"reference": [
{
"type": "PubMed",
"id": "9576847",
"url": "https://glygen.org/publication/PubMed/9576847"
}
]
},
{
"title": "Steroid hydroxylation by human fetal CYP3A7 and human NADPH-cytochrome P450 reductase coexpressed in insect cells using baculovirus.",
"journal": "Research communications in molecular pathology and pharmacology",
"date": "1998",
"authors": "Ohmori S, Fujiki N, Nakasa H, Nakamura H, Ishii I, Itahashi K, Kitada M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211981",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981"
}
],
"reference": [
{
"type": "PubMed",
"id": "9644715",
"url": "https://glygen.org/publication/PubMed/9644715"
}
]
},
{
"title": "Identification of multispecific organic anion transporter 2 expressed predominantly in the liver.",
"journal": "FEBS letters",
"date": "1998",
"authors": "Sekine T, Cha SH, Tsuda M, Apiwattanakul N, Nakajima N, Kanai Y, Endou H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "9650585",
"url": "https://glygen.org/publication/PubMed/9650585"
}
]
},
{
"title": "Stoichiometry of coupling of rhodamine 123 transport to ATP hydrolysis by P-glycoprotein.",
"journal": "European journal of biochemistry",
"date": "1998",
"authors": "Shapiro AB, Ling V",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "9652413",
"url": "https://glygen.org/publication/PubMed/9652413"
}
]
},
{
"title": "Cloning of vascular adhesion protein 1 reveals a novel multifunctional adhesion molecule.",
"journal": "The Journal of experimental medicine",
"date": "1998",
"authors": "Smith DJ, Salmi M, Bono P, Hellman J, Leu T, Jalkanen S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211945",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945"
}
],
"reference": [
{
"type": "PubMed",
"id": "9653080",
"url": "https://glygen.org/publication/PubMed/9653080"
}
]
},
{
"title": "Protein binding of salicylate in uremic and normal plasma.",
"journal": "Clinical pharmacology and therapeutics",
"date": "1976",
"authors": "Borga O, Cederlof IO, Ringberger VA, Norlin A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9749641",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641"
}
],
"reference": [
{
"type": "PubMed",
"id": "975718",
"url": "https://glygen.org/publication/PubMed/975718"
}
]
},
{
"title": "Retroviral transfer of the human MDR1 gene confers resistance to bisantrene-specific hematotoxicity.",
"journal": "Clinical cancer research : an official journal of the American Association for Cancer Research",
"date": "1996",
"authors": "Aksentijevich I, Cardarelli CO, Pastan I, Gottesman MM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9757110",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110"
}
],
"reference": [
{
"type": "PubMed",
"id": "9816258",
"url": "https://glygen.org/publication/PubMed/9816258"
}
]
},
{
"title": "Human liver microsomal metabolism of paclitaxel and drug interactions.",
"journal": "European journal of drug metabolism and pharmacokinetics",
"date": "1998",
"authors": "Desai PB, Duan JZ, Zhu YW, Kouzi S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-211981",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981"
}
],
"reference": [
{
"type": "PubMed",
"id": "9842986",
"url": "https://glygen.org/publication/PubMed/9842986"
}
]
}
],
"pathway": [
{
"id": "hsa:1576",
"name": "",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1576",
"resource": "KEGG Pathway"
},
{
"id": "R-HSA-211945",
"name": "Phase I - Functionalization of compounds",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945",
"resource": "Reactome",
"description": "Phase I - Functionalization of compounds"
},
{
"id": "R-HSA-211981",
"name": "Xenobiotics",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211981",
"resource": "Reactome",
"description": "Xenobiotics"
},
{
"id": "R-HSA-5423646",
"name": "Aflatoxin activation and detoxification",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646",
"resource": "Reactome",
"description": "Aflatoxin activation and detoxification"
},
{
"id": "R-HSA-9027307",
"name": "Biosynthesis of maresin-like SPMs",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027307",
"resource": "Reactome",
"description": "Biosynthesis of maresin-like SPMs"
},
{
"id": "R-HSA-9749641",
"name": "Aspirin ADME",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641",
"resource": "Reactome",
"description": "Aspirin ADME"
},
{
"id": "R-HSA-9754706",
"name": "Atorvastatin ADME",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9754706",
"resource": "Reactome",
"description": "Atorvastatin ADME"
},
{
"id": "R-HSA-9757110",
"name": "Prednisone ADME",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9757110",
"resource": "Reactome",
"description": "Prednisone ADME"
}
],
"orthologs": [
{
"uniprot_canonical_ac": "P20815-1",
"protein_name": "Cytochrome P450 3A5",
"gene_name": "CYP3A5",
"tax_id": 9606,
"organism": "Homo sapiens",
"sequence": {
"sequence": "MDLIPNLAVETWLLLAVSLVLLYLYGTRTHGLFKRLGIPGPTPLPLLGNVLSYRQGLWKFDTECYKKYGKMWGTYEGQLPVLAITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISLAEDEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKGKPVTLKDIFGAYSMDVITGTSFGVNIDSLNNPQDPFVESTKKFLKFGFLDPLFLSIILFPFLTPVFEALNVSLFPKDTINFLSKSVNRMKKSRLNDKQKHRLDFLQLMIDSQNSKETESHKALSDLELAAQSIIFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAVLPNKAPPTYDAVVQMEYLDMVVNETLRLFPVAIRLERTCKKDVEINGVFIPKGSMVVIPTYALHHDPKYWTEPEEFRPERFSKKKDSIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLDTQGLLQPEKPIVLKVDSRDGTLSGE",
"length": 502
},
"evidence": [
{
"id": "45919553",
"url": "http://www.informatics.jax.org/homology/45919553",
"database": "MGI"
}
],
"common_name": "Human"
},
{
"uniprot_canonical_ac": "P24462-1",
"protein_name": "Cytochrome P450 3A7",
"gene_name": "CYP3A7",
"tax_id": 9606,
"organism": "Homo sapiens",
"sequence": {
"sequence": "MDLIPNLAVETWLLLAVSLILLYLYGTRTHGLFKKLGIPGPTPLPFLGNALSFRKGYWTFDMECYKKYRKVWGIYDCQQPMLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKNAISIAEDEEWKRIRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKHVFGAYSMDVITSTSFGVSIDSLNNPQDPFVENTKKLLRFNPLDPFVLSIKVFPFLTPILEALNITVFPRKVISFLTKSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSIIFIFAGYETTSSVLSFIIYELATHPDVQQKVQKEIDTVLPNKAPPTYDTVLQLEYLDMVVNETLRLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYVLHHDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESRDETVSGA",
"length": 503
},
"evidence": [
{
"id": "45919553",
"url": "http://www.informatics.jax.org/homology/45919553",
"database": "MGI"
}
],
"common_name": "Human"
},
{
"uniprot_canonical_ac": "P51538-1",
"protein_name": "Cytochrome P450 3A9",
"gene_name": "Cyp3a9",
"tax_id": 10116,
"organism": "Rattus norvegicus",
"sequence": {
"sequence": "MDLIPNFSMETWLLLVISLVLLYLYGTHSHGIFKKLGIPGPKPLPFLGTILAYRKGFWEFDKYCHKKYGKLWGLYDGRQPVLAITDPDIIKTVLVKECYSTFTNRRNFGPVGILKKAISISEDEEWKRIRALLSPTFTSGKLKEMFPIINQYTDMLVRNMRQGSEEGKPTSMKDIFGAYSMDVITATSFGVNVDSLNNPQDPFVEKVKKLLKFDIFDPLFLSVTLFPFLTPLFEALNVSMFPRDVIDFFKTSVERMKENRMKEKEKQRMDFLQLMINSQNSKVKDSHKALSDVEIVAQSVIFIFAGYETTSSALSFVLYLLAIHPDIQKKLQDEIDAALPNKAHATYDTLLQMEYLDMVVNETLRLYPIAGRLERVCKTDVEINGVFIPKGTVVMIPTFALHKDPHYWPEPEEFRPERFSKKNQDNINPYMYLPFGNGPRNCIGMRFALMNMKVALFRVLQNFSFQPCKETQIPLKLSKQGLLQPEKPLLLKVVSRDETVNGA",
"length": 503
},
"evidence": [
{
"id": "45919553",
"url": "http://www.informatics.jax.org/homology/45919553",
"database": "MGI"
}
],
"common_name": "Rat"
},
{
"uniprot_canonical_ac": "Q64464-1",
"protein_name": "Cytochrome P450 3A13",
"gene_name": "Cyp3a13",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MDLIPNFSMETWMLLATSLVLLYLYGTHSHGIFKKLGIPGPKPLPFLGTILAYQKGFWECDIQCHKKYGKMWGLYDGRQPVLAITDPDIIKTVLVKECYSTFTNRRRFGPVGILKKAISISENEEWKRIRALLSPTFTSGRLKEMFPIINQFTDVLVRNMRQGLGEGKPTSMKDIFGAYSMDVITATSFGVNIDSLNNPQDPFVEKIKKLLKFDIFDPLFLSVTLFPFLTPVFDALNVSLFPRDVISFFTTSVERMKENRMKEKEKQRVDFLQLMINSQNYKTKESHKALSDVEIVAQSVIFIFAGYETTSSALSFALYLLAIHPDVQKKLQDEIDAALPNKAPATYDTLLQMEYLDMVVNETLRLYPIAGRLERVCKTDVEINGLFIPKGTVVMIPTFALHKDPKYWPEPEEFRPERFSKKNQDSINPYMYLPFGSGPRNCIGMRFALINMKVALVRVLQNFTVQPCKETEIPLKLSKQGLLQPENPLLLKVVSRDETVSDE",
"length": 503
},
"evidence": [
{
"id": "45919553",
"url": "http://www.informatics.jax.org/homology/45919553",
"database": "MGI"
}
],
"common_name": "Mouse"
}
],
"go_annotation": {
"categories": [
{
"name": "Biological Process",
"total": 19,
"go_terms": [
{
"name": "lipid hydroxylation",
"id": "GO:0002933",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002933",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "estrogen metabolic process",
"id": "GO:0008210",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008210",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "monoterpenoid metabolic process",
"id": "GO:0016098",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016098",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "vitamin D metabolic process",
"id": "GO:0042359",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042359",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "vitamin D catabolic process",
"id": "GO:0042369",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042369",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "heterocycle metabolic process",
"id": "GO:0046483",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046483",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "lipid metabolic process",
"id": "GO:0006629",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006629",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "cholesterol metabolic process",
"id": "GO:0008203",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008203",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "retinol metabolic process",
"id": "GO:0042572",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042572",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "retinoic acid metabolic process",
"id": "GO:0042573",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042573",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "xenobiotic metabolic process",
"id": "GO:0006805",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006805",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "xenobiotic catabolic process",
"id": "GO:0042178",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042178",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "androgen metabolic process",
"id": "GO:0008209",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008209",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "oxidative demethylation",
"id": "GO:0070989",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070989",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "steroid metabolic process",
"id": "GO:0008202",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008202",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "long-chain fatty acid biosynthetic process",
"id": "GO:0042759",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042759",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "steroid catabolic process",
"id": "GO:0006706",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006706",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "alkaloid catabolic process",
"id": "GO:0009822",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009822",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "aflatoxin metabolic process",
"id": "GO:0046222",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046222",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
}
]
},
{
"name": "Molecular Function",
"total": 24,
"go_terms": [
{
"name": "retinoic acid 4-hydroxylase activity",
"id": "GO:0008401",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008401",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "aromatase activity",
"id": "GO:0070330",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070330",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "estrogen 16-alpha-hydroxylase activity",
"id": "GO:0101020",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0101020",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "iron ion binding",
"id": "GO:0005506",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005506",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "enzyme binding",
"id": "GO:0019899",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "oxidoreductase activity",
"id": "GO:0016491",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016491",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "steroid binding",
"id": "GO:0005496",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005496",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "heme binding",
"id": "GO:0020037",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0020037",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "steroid hydroxylase activity",
"id": "GO:0008395",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008395",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "monooxygenase activity",
"id": "GO:0004497",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004497",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "oxygen binding",
"id": "GO:0019825",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019825",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "vitamin D3 25-hydroxylase activity",
"id": "GO:0030343",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030343",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "caffeine oxidase activity",
"id": "GO:0034875",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034875",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "quinine 3-monooxygenase activity",
"id": "GO:0050591",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050591",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "testosterone 6-beta-hydroxylase activity",
"id": "GO:0050649",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050649",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "vitamin D 24-hydroxylase activity",
"id": "GO:0070576",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070576",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "1,8-cineole 2-exo-monooxygenase activity",
"id": "GO:0102320",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0102320",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "estrogen 2-hydroxylase activity",
"id": "GO:0101021",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0101021",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "anandamide 8,9 epoxidase activity",
"id": "GO:0062187",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062187",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "anandamide 11,12 epoxidase activity",
"id": "GO:0062188",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062188",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "1-alpha,25-dihydroxyvitamin D3 23-hydroxylase activity",
"id": "GO:0062181",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062181",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "anandamide 14,15 epoxidase activity",
"id": "GO:0062189",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062189",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen",
"id": "GO:0016705",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016705",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen",
"id": "GO:0016712",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016712",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
}
]
},
{
"name": "Cellular Component",
"total": 4,
"go_terms": [
{
"name": "cytoplasm",
"id": "GO:0005737",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "intracellular membrane-bounded organelle",
"id": "GO:0043231",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "endoplasmic reticulum membrane",
"id": "GO:0005789",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
},
{
"name": "membrane",
"id": "GO:0016020",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
}
],
"pmid": ""
}
]
}
]
},
"pro_annotation": [],
"site_annotation": [
{
"start_pos": 361,
"end_pos": 363,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 462,
"end_pos": 464,
"annotation": "n_glycosylation_sequon"
}
],
"ptm_annotation": [
{
"annotation": "Polyubiquitinated in the presence of AMFR and UBE2G1 and also STUB1/CHIP and UBE2D1 (in vitro).",
"evidence": [
{
"database": "UniProtKB",
"id": "P08684",
"url": "https://www.uniprot.org/uniprot/P08684"
},
{
"database": "PubMed",
"id": "19103148",
"url": "https://glygen.org/publication/PubMed/19103148"
}
]
}
],
"interactions": [],
"reactions": [
{
"id": "17149",
"name": "",
"equation": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P11711-1",
"P05182-1",
"A0A8I6A0P6-1",
"P10633-1",
"P51538-1",
"P00176-1",
"P05178-1",
"P10610-1",
"P13107-1",
"P20812-1",
"P33272-1",
"P51870-1",
"P00185-1",
"Q64581-1",
"P05179-1",
"P51871-1",
"P04167-1",
"P04800-1",
"P05183-1",
"P10634-1",
"P11510-1",
"P12938-1",
"P12939-1",
"P15129-1",
"P15149-1",
"P20814-1",
"P33273-1",
"P51590-1",
"Q64583-1",
"Q64680-1",
"P04799-1",
"Q64678-1",
"P08683-1",
"P24464-1",
"D4A820-1",
"A0A0G2K5K4-1",
"F1LT33-1",
"G3V9D2-1",
"Q9QXF7-1",
"A0A8I5ZZ08-1",
"P05181-1",
"A0A087X1C5-1",
"P08684-1",
"P20853-1",
"P04798-1",
"P05177-1",
"P33261-1",
"Q86W10-1",
"Q16678-1",
"P98187-1",
"P10632-1",
"P24462-1",
"Q9HB55-1",
"P13584-1",
"Q16696-1",
"Q9HCS2-1",
"P33260-1",
"Q02928-1",
"Q08477-1",
"Q9HBI6-1",
"P78329-1",
"P11712-1",
"P24903-1",
"P20815-1",
"Q6V0L0-1",
"P20852-1",
"O09158-1",
"O55071-1",
"Q64459-1",
"Q64481-1",
"O54749-1",
"P15392-1",
"Q8CIM7-1",
"P56654-1",
"P56655-1",
"P56656-1",
"P12791-1",
"P56593-1",
"O54750-1",
"Q91WL5-1",
"Q91X77-1",
"Q64458-1",
"P00186-1",
"P00184-1",
"Q6XVG2-1",
"Q9D816-1",
"P11714-1",
"P12790-1",
"P24457-1",
"Q9JMA7-1",
"P24456-1",
"Q64462-1",
"Q64464-1",
"Q05421-1",
"Q64429-1",
"D3YYZ0-1",
"D3Z2W7-1",
"B2RXZ2-1",
"Q9WV19-1",
"Q9DBX6-1",
"E9Q593-1",
"A2A974-1",
"A6H6J2-1",
"Q9EQW4-1",
"B2RXA7-1"
],
"evidence": [
{
"id": "17149",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/17149"
}
]
},
{
"id": "20149",
"name": "",
"equation": "O2 + quinine + reduced [NADPH--hemoprotein reductase] = 3-hydroxyquinine + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P08684-1"
],
"evidence": [
{
"id": "20149",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/20149"
}
]
},
{
"id": "32895",
"name": "",
"equation": "1,8-cineole + O2 + reduced [NADPH--hemoprotein reductase] = 2-exo-hydroxy-1,8-cineole + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P08684-1"
],
"evidence": [
{
"id": "32895",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/32895"
}
]
},
{
"id": "39779",
"name": "",
"equation": "(5Z,8Z,11Z,14Z,17Z)-eicosapentaenoate + O2 + reduced [NADPH--hemoprotein reductase] = (17R,18S)-epoxy-(5Z,8Z,11Z,14Z)-eicosatetraenoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00185-1",
"P04799-1",
"P08683-1",
"P24470-1",
"P08684-1",
"P51589-1",
"P04798-1",
"P05177-1",
"P33261-1",
"P10632-1",
"P11712-1",
"P00186-1",
"P00184-1",
"Q91WL5-1",
"E9Q5K4-1",
"A2A974-1"
],
"evidence": [
{
"id": "39779",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/39779"
}
]
},
{
"id": "42092",
"name": "",
"equation": "all-trans-retinol + O2 + reduced [NADPH--hemoprotein reductase] = all-trans-retinal + H(+) + 2 H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00185-1",
"P04799-1",
"Q64678-1",
"P10635-1",
"P08684-1",
"P04798-1",
"P05177-1",
"Q16678-1",
"P20815-1",
"P00186-1",
"P00184-1",
"Q64429-1"
],
"evidence": [
{
"id": "42092",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/42092"
}
]
},
{
"id": "46128",
"name": "",
"equation": "cholesterol + O2 + reduced [NADPH--hemoprotein reductase] = 4beta-hydroxycholesterol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P08684-1"
],
"evidence": [
{
"id": "46128",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/46128"
}
]
},
{
"id": "46140",
"name": "",
"equation": "cholesterol + O2 + reduced [NADPH--hemoprotein reductase] = (22R)-hydroxycholesterol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P08684-1"
],
"evidence": [
{
"id": "46140",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/46140"
}
]
},
{
"id": "46144",
"name": "",
"equation": "cholesterol + O2 + reduced [NADPH--hemoprotein reductase] = (24R)-hydroxycholesterol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P08684-1"
],
"evidence": [
{
"id": "46144",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/46144"
}
]
},
{
"id": "46296",
"name": "",
"equation": "O2 + reduced [NADPH--hemoprotein reductase] + testosterone = 6beta,17beta-dihydroxyandrost-4-en-3-one + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q64678-1",
"P08684-1",
"Q16678-1",
"P24462-1",
"Q9Y6A2-1",
"P20815-1",
"Q9WVK8-1",
"Q64429-1"
],
"evidence": [
{
"id": "46296",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/46296"
}
]
},
{
"id": "47204",
"name": "",
"equation": "estrone + O2 + reduced [NADPH--hemoprotein reductase] = 16alpha-hydroxyestrone + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00185-1",
"P08684-1",
"P04798-1",
"P10632-1",
"P24462-1",
"P00184-1"
],
"evidence": [
{
"id": "47204",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/47204"
}
]
},
{
"id": "47208",
"name": "",
"equation": "estrone + O2 + reduced [NADPH--hemoprotein reductase] = 2-hydroxyestrone + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00185-1",
"P04799-1",
"Q64678-1",
"P08684-1",
"P04798-1",
"P05177-1",
"Q16678-1",
"P11511-1",
"P20813-1",
"P24462-1",
"P11712-1",
"P20815-1",
"P28649-1",
"P00186-1",
"P00184-1",
"Q64429-1"
],
"evidence": [
{
"id": "47208",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/47208"
}
]
},
{
"id": "47212",
"name": "",
"equation": "17beta-estradiol + O2 + reduced [NADPH--hemoprotein reductase] = 2-hydroxy-17beta-estradiol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00185-1",
"P04799-1",
"Q64678-1",
"P08684-1",
"P04798-1",
"P05177-1",
"Q16678-1",
"P11712-1",
"P20813-1",
"P24462-1",
"P20815-1",
"P00186-1",
"P00184-1",
"Q64429-1"
],
"evidence": [
{
"id": "47212",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/47212"
}
]
},
{
"id": "47252",
"name": "",
"equation": "O2 + progesterone + reduced [NADPH--hemoprotein reductase] = 6beta-hydroxyprogesterone + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q64678-1",
"P08684-1",
"Q16678-1",
"P20815-1",
"Q64429-1"
],
"evidence": [
{
"id": "47252",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/47252"
}
]
},
{
"id": "47256",
"name": "",
"equation": "androst-4-ene-3,17-dione + O2 + reduced [NADPH--hemoprotein reductase] = 6beta-hydroxyandrost-4-ene-3,17-dione + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P08684-1",
"P20815-1"
],
"evidence": [
{
"id": "47256",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/47256"
}
]
},
{
"id": "47260",
"name": "",
"equation": "O2 + progesterone + reduced [NADPH--hemoprotein reductase] = 16alpha-hydroxyprogesterone + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q64678-1",
"P08684-1",
"Q16678-1",
"Q64429-1"
],
"evidence": [
{
"id": "47260",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/47260"
}
]
},
{
"id": "47280",
"name": "",
"equation": "17beta-estradiol + O2 + reduced [NADPH--hemoprotein reductase] = 4-hydroxy-17beta-estradiol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00185-1",
"P04799-1",
"Q64678-1",
"P08684-1",
"P04798-1",
"P05177-1",
"Q16678-1",
"P20815-1",
"P00186-1",
"P00184-1",
"Q64429-1"
],
"evidence": [
{
"id": "47280",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/47280"
}
]
},
{
"id": "47292",
"name": "",
"equation": "estrone + O2 + reduced [NADPH--hemoprotein reductase] = 4-hydroxyestrone + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00185-1",
"P04799-1",
"Q64678-1",
"P08684-1",
"P04798-1",
"P05177-1",
"Q16678-1",
"P24462-1",
"P20815-1",
"P00186-1",
"P00184-1",
"Q64429-1"
],
"evidence": [
{
"id": "47292",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/47292"
}
]
},
{
"id": "47332",
"name": "",
"equation": "17beta-estradiol + O2 + reduced [NADPH--hemoprotein reductase] = 16alpha,17beta-estriol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P08684-1",
"P10632-1"
],
"evidence": [
{
"id": "47332",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/47332"
}
]
},
{
"id": "47336",
"name": "",
"equation": "17beta-estradiol + O2 + reduced [NADPH--hemoprotein reductase] = 16beta,17beta-estriol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P08684-1"
],
"evidence": [
{
"id": "47336",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/47336"
}
]
},
{
"id": "49160",
"name": "",
"equation": "1,4-cineole + O2 + reduced [NADPH--hemoprotein reductase] = 2-exo-hydroxy-1,4-cineole + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P08684-1",
"P20813-1",
"P11509-1"
],
"evidence": [
{
"id": "49160",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/49160"
}
]
},
{
"id": "49856",
"name": "",
"equation": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 + reduced [NADPH--hemoprotein reductase] = (14S,15R)-epoxy-(5Z,8Z,11Z)-eicosatrienoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P04799-1",
"Q64678-1",
"P08683-1",
"P24470-1",
"P10635-1",
"P08684-1",
"P51589-1",
"P04798-1",
"P05177-1",
"P10632-1",
"P11712-1",
"Q86W10-1",
"P00186-1",
"P00184-1",
"P56657-1"
],
"evidence": [
{
"id": "49856",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/49856"
}
]
},
{
"id": "49860",
"name": "",
"equation": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 + reduced [NADPH--hemoprotein reductase] = (14R,15S)-epoxy-(5Z,8Z,11Z)-eicosatrienoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00185-1",
"P04799-1",
"Q64678-1",
"P08683-1",
"P24470-1",
"P08684-1",
"P51589-1",
"P04798-1",
"P05177-1",
"P33261-1",
"Q16678-1",
"P10632-1",
"P11712-1",
"P00186-1",
"P00184-1",
"Q64429-1",
"P56657-1"
],
"evidence": [
{
"id": "49860",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/49860"
}
]
},
{
"id": "50256",
"name": "",
"equation": "cholesterol + O2 + reduced [NADPH--hemoprotein reductase] = 25-hydroxycholesterol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P04799-1",
"P10635-1",
"P08684-1",
"P05177-1",
"P11712-1",
"P00186-1"
],
"evidence": [
{
"id": "50256",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/50256"
}
]
},
{
"id": "50264",
"name": "",
"equation": "cholesterol + O2 + reduced [NADPH--hemoprotein reductase] = 26-hydroxycholesterol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P08684-1"
],
"evidence": [
{
"id": "50264",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/50264"
}
]
},
{
"id": "51984",
"name": "",
"equation": "all-trans-retinoate + O2 + reduced [NADPH--hemoprotein reductase] = all-trans-4-hydroxyretinoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"G3V7X8-1",
"P08684-1",
"P10632-1",
"P24462-1",
"P20815-1",
"Q96SQ9-1",
"Q9NR63-1",
"P33260-1",
"Q8TAV3-1",
"Q6V0L0-1",
"Q811W2-1",
"Q9DBX6-1",
"E9Q816-1",
"B2RXA7-1"
],
"evidence": [
{
"id": "51984",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/51984"
}
]
},
{
"id": "52120",
"name": "",
"equation": "(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate + O2 + reduced [NADPH--hemoprotein reductase] = (19R,20S)-epoxy-(4Z,7Z,10Z,13Z,16Z)-docosapentaenoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00185-1",
"P04799-1",
"P10635-1",
"P08684-1",
"P51589-1",
"P04798-1",
"P05177-1",
"P33261-1",
"P10632-1",
"P00186-1",
"P00184-1"
],
"evidence": [
{
"id": "52120",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/52120"
}
]
},
{
"id": "52124",
"name": "",
"equation": "(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate + O2 + reduced [NADPH--hemoprotein reductase] = (19S,20R)-epoxy-(4Z,7Z,10Z,13Z,16Z)-docosapentaenoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00185-1",
"P10635-1",
"P08684-1",
"P51589-1",
"P04798-1",
"P33261-1",
"P10632-1",
"P00184-1"
],
"evidence": [
{
"id": "52124",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/52124"
}
]
},
{
"id": "52284",
"name": "",
"equation": "(9Z,12Z)-octadecadienoate + O2 + reduced [NADPH--hemoprotein reductase] = 11-hydroxy-(9Z,12Z)-octadecadienoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P04799-1",
"P08684-1",
"P05177-1",
"P00186-1"
],
"evidence": [
{
"id": "52284",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/52284"
}
]
},
{
"id": "52288",
"name": "",
"equation": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 + reduced [NADPH--hemoprotein reductase] = 7-hydroxy-(5Z,8Z,11Z,14Z)-eicosatetraenoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P08684-1"
],
"evidence": [
{
"id": "52288",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/52288"
}
]
},
{
"id": "52292",
"name": "",
"equation": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 + reduced [NADPH--hemoprotein reductase] = 13-hydroxy-(5Z,8Z,11Z,14Z)-eicosatetraenoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P04799-1",
"P08684-1",
"P05177-1",
"P11712-1",
"P00186-1"
],
"evidence": [
{
"id": "52292",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/52292"
}
]
},
{
"id": "52296",
"name": "",
"equation": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 + reduced [NADPH--hemoprotein reductase] = 10-hydroxy-(5Z,8Z,11Z,14Z)-eicosatetraenoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P08684-1",
"P11712-1"
],
"evidence": [
{
"id": "52296",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/52296"
}
]
},
{
"id": "53140",
"name": "",
"equation": "N-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-ethanolamine + O2 + reduced [NADPH--hemoprotein reductase] = H(+) + H2O + N-(8,9-epoxy-5Z,11Z,14Z-eicosatrienoyl)-ethanolamine + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P10635-1",
"P08684-1",
"P20813-1"
],
"evidence": [
{
"id": "53140",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/53140"
}
]
},
{
"id": "53144",
"name": "",
"equation": "N-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-ethanolamine + O2 + reduced [NADPH--hemoprotein reductase] = H(+) + H2O + N-(11,12-epoxy-5Z,8Z,14Z-eicosatrienoyl)-ethanolamine + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P10635-1",
"P08684-1",
"P20813-1"
],
"evidence": [
{
"id": "53144",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/53144"
}
]
},
{
"id": "53148",
"name": "",
"equation": "N-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-ethanolamine + O2 + reduced [NADPH--hemoprotein reductase] = H(+) + H2O + N-(14,15-epoxy-5Z,8Z,11Z-eicosatrienoyl)-ethanolamine + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q8K4D6-1",
"P10635-1",
"P08684-1",
"P20813-1",
"Q8N118-1",
"Q6A152-1"
],
"evidence": [
{
"id": "53148",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/53148"
}
]
},
{
"id": "53200",
"name": "",
"equation": "17beta-hydroxy-5alpha-androstan-3-one + O2 + reduced [NADPH--hemoprotein reductase] = 17beta,19-dihydroxy-3-oxo-5alpha-androstanone + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P08684-1",
"P11511-1",
"P28649-1"
],
"evidence": [
{
"id": "53200",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/53200"
}
]
},
{
"id": "53212",
"name": "",
"equation": "17beta-hydroxy-5alpha-androstan-3-one + O2 + reduced [NADPH--hemoprotein reductase] = 17beta,18-dihydroxy-3-oxo-5alpha-androstanone + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P08684-1"
],
"evidence": [
{
"id": "53212",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/53212"
}
]
},
{
"id": "53260",
"name": "",
"equation": "O2 + reduced [NADPH--hemoprotein reductase] + testosterone = 1beta-hydroxytestosterone + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P08684-1"
],
"evidence": [
{
"id": "53260",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/53260"
}
]
},
{
"id": "53264",
"name": "",
"equation": "O2 + reduced [NADPH--hemoprotein reductase] + testosterone = 2beta-hydroxytestosterone + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P08684-1"
],
"evidence": [
{
"id": "53264",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/53264"
}
]
},
{
"id": "53444",
"name": "",
"equation": "O2 + reduced [NADPH--hemoprotein reductase] + testosterone = 11beta,17beta-dihydroxyandrost-4-ene-3-one + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P08684-1"
],
"evidence": [
{
"id": "53444",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/53444"
}
]
},
{
"id": "55828",
"name": "",
"equation": "cortisol + O2 + reduced [NADPH--hemoprotein reductase] = 6beta-hydroxycortisol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P08684-1"
],
"evidence": [
{
"id": "55828",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/55828"
}
]
},
{
"id": "55832",
"name": "",
"equation": "cortisone + O2 + reduced [NADPH--hemoprotein reductase] = 6beta-hydroxycortisone + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P08684-1"
],
"evidence": [
{
"id": "55832",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/55832"
}
]
},
{
"id": "55924",
"name": "",
"equation": "albendazole + O2 + reduced [NADPH--hemoprotein reductase] = albendazole S-oxide + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P08684-1",
"P51589-1"
],
"evidence": [
{
"id": "55924",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/55924"
}
]
},
{
"id": "55928",
"name": "",
"equation": "fenbendazole + O2 + reduced [NADPH--hemoprotein reductase] = fenbendazole S-oxide + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P08684-1",
"P51589-1"
],
"evidence": [
{
"id": "55928",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/55928"
}
]
},
{
"id": "R-HSA-156526",
"name": "CYP1A2,3A4,3A5,2A13 oxidise AFB1 to AFXBO",
"equation": "",
"summary": "Aflatoxin B1 (AFB1) requires microsomal oxidation to produce epoxides which cause the toxic and carcinogenic effects. In humans, cytochrome P450 enzymes produce epoxide stereoisomers of AFB1, the most potent being aflatoxin exo-8,9-oxide (AFXBO). This conversion is carried out by at least four P450s; 1A2, 3A4, 3A5 and 2A13. CYP3A4 mainly produces the exo form whereas CYP1A2 produces a racemic mixture of exo and endo forms (Gallagher et al. 1996, He et al. 2006).",
"cellular_location": "cytosol, endoplasmic reticulum membrane",
"input_participant_list": [
"R-ALL-5423605"
],
"output_participant_list": [
"R-ALL-159211"
],
"enzyme_list": [
"P20815-1",
"Q16696-1",
"P05177-1",
"P08684-1"
],
"evidence": [
{
"id": "R-HSA-156526",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156526"
}
]
},
{
"id": "R-HSA-211882",
"name": "CYP3A7 can 6beta-hydroxylate testosterone",
"equation": "",
"summary": "CYP3A7 is only expressed in fetal liver and not in adults. It has lower biotransformation capability than other members of the CYP3A family such as 3A4 or 3A5 but possesses a similar broad specificity. CYP3A7 plays a major role in fetal steroid hydroxylation, an example being the 6beta-hydroxylation of testosterone.",
"cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane",
"input_participant_list": [
"R-ALL-30321"
],
"output_participant_list": [
"R-ALL-213144"
],
"enzyme_list": [
"P24462-1",
"P20815-1",
"Q9HB55-1",
"P08684-1"
],
"evidence": [
{
"id": "R-HSA-211882",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211882"
}
]
},
{
"id": "R-HSA-211948",
"name": "CYP3A4 can N-demethylate loperamide",
"equation": "",
"summary": "The CYP3A family are the most abundantly expressed P450s in human liver, accounting for around 50% of xenobiotic drug metabolism. CYP3A4 is the most abundant member of the family and possesses broad specificity to a range of xenobiotics. Loperamide (LOP), an antidiarrheal, is mainly metabolized to desmethylloperamide (DLOP) through the N-demethylation pathway. This initial N-demethylation is carried out by CYP3A4.",
"cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane",
"input_participant_list": [
"R-ALL-213155"
],
"output_participant_list": [
"R-ALL-213151"
],
"enzyme_list": [
"P24462-1",
"P20815-1",
"Q9HB55-1",
"P08684-1"
],
"evidence": [
{
"id": "R-HSA-211948",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211948"
}
]
},
{
"id": "R-HSA-213175",
"name": "CYP3A4,5 oxidise AFB1 to AFXBO",
"equation": "",
"summary": "Aflatoxins are produced by the fungal molds Aspergillus flavus and Aspergillus parasiticus. Dietary contamination accounts for adverse health problems including liver cancer therby classifying aflatoxins as Group 1 carcinogens in humans. The B1 form of aflatoxin (AFB1) is especially carcinogenic in a number of species including humans.
AFB1 requires microsomal oxidation to produce epoxides which are the cause of their toxic and carcinogenic effects. In humans, both CYP3A4 and CYP3A5 are able to produce epoxide stereoisomers of AFB1, the most potent being aflatoxin B1 exo-8,9-oxide (AFXBO) (Gallagher et al. 1996).",
"cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane",
"input_participant_list": [
"R-ALL-156522"
],
"output_participant_list": [
"R-ALL-156523"
],
"enzyme_list": [
"P24462-1",
"P20815-1",
"Q9HB55-1",
"P08684-1"
],
"evidence": [
{
"id": "R-HSA-213175",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-213175"
}
]
},
{
"id": "R-HSA-5423664",
"name": "CYP3A4,5 hydroxylates AFB1 to AFQ1",
"equation": "",
"summary": "Metabolites that are formed from aflatoxin B1 (AFB1) include AFQ1, AFM1 and AFP1 (Gallagher et al. 1996). These metabolites and other naturally occurring aflatoxins (G1, B2 and G2) are poorer substrates for epoxidation and, consequently, are less mutagenic, carcinogenic and toxic than AFB1. AFB1 metabolites can be useful biomarkers of human exposure to aflatoxins and AFM1, AFQ1 and AFP1 have all been detected in human urine samples (Groopman et al. 1985). Cytochrome P450 3A4 and 3A5 are the predominant enzymes involved in AFQ1 (3-hydroxy aflatoxin) production (Raney et al. 1992).",
"cellular_location": "cytosol, endoplasmic reticulum membrane",
"input_participant_list": [],
"output_participant_list": [
"R-ALL-5423660"
],
"enzyme_list": [
"P20815-1",
"P08684-1"
],
"evidence": [
{
"id": "R-HSA-5423664",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423664"
}
]
},
{
"id": "R-HSA-5423672",
"name": "CYP1A2, 3A4 oxidise AFB1 to AFNBO",
"equation": "",
"summary": "Aflatoxin B1 (AFB1) requires microsomal oxidation to produce epoxides which cause the toxic and carcinogenic effects. In humans, cytochrome P450 enzymes produce epoxide stereoisomers of AFB1, the most potent being aflatoxin exo-8,9-oxide (AFNBO). CYP3A4 and CYP1A2 can also produce aflatoxin B1-endo-8,9-epoxide (Raney et al. 1992, Ueng et al. 1995).",
"cellular_location": "cytosol, endoplasmic reticulum membrane",
"input_participant_list": [],
"output_participant_list": [
"R-ALL-5423663"
],
"enzyme_list": [
"P05177-1",
"P08684-1"
],
"evidence": [
{
"id": "R-HSA-5423672",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423672"
}
]
},
{
"id": "R-HSA-9027043",
"name": "CYPs hydroxylate DHA to 14(R)-HDHA",
"equation": "",
"summary": "Using human leukocytes and platelets, Hong et al. found that incubating docosahexaenoic acid (DHA) with a mixture of human cytochrome P450 enzymes (CYP1A2, 2C8, 2C9, 2D6, 2E1 and 3A4) formed 14(R)-hydroxy-docsosahexaenoic acid (14(R)-HDHA), the precursor to maresin-like mediator 2 (MaR-L2) (Hong et al. 2014). There is no data to indicate which one or ones of these CYPs mediate this event under physiological conditions. CYP inhibition diminishes the formation of 14(R)-HDHA, confirming CYP determines 14(R)-hydroxylation (Hong et al. 2014). The CYP mixture also formed 22-hydroxy-docosahexaenoic acid (22-HDHA) by \u03c9-oxidation (not shown here). Although the CYP mixture also catalysed the formation of 14(S)-HDHA, the amount formed is minor compared to that formed by 12-lipoxygenase (Hong et al. 2014).",
"cellular_location": "cytosol, endoplasmic reticulum membrane",
"input_participant_list": [
"R-ALL-9024011"
],
"output_participant_list": [],
"enzyme_list": [
"P05181-1",
"P10635-1",
"P10632-1",
"P11712-1",
"P05177-1",
"P08684-1"
],
"evidence": [
{
"id": "R-HSA-9027043",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027043"
}
]
},
{
"id": "R-HSA-9678766",
"name": "CYP3A4 binds CYP3A4 inhibitors",
"equation": "",
"summary": "These compounds are inhibitors of cytochrome P450 3A enzymes (von Moltke et al. 1999, Yeo & Yeo 2001, Xu et al. 2010, Temesgen 2013, Greenblatt & Harmatz 2015). Cytochrome P450 3A4 (CYP3A4) is the most broadly active drug-metabolizing enzyme in humans. It oxidizes and clears over half of all administered pharmaceuticals due to its promiscuity. By inhibiting CYP3A4, these drugs can enhance bioavailability and prolong the plasma half-life of antiretroviral drugs such as those used to treat HIV infection.",
"cellular_location": "cytosol, endoplasmic reticulum membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P08684-1"
],
"evidence": [
{
"id": "R-HSA-9678766",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9678766"
}
]
},
{
"id": "R-HSA-9680865",
"name": "CYP3A4, CYP2B6 bind ritonavir",
"equation": "",
"summary": "Ritonavir binds and inhibits Cytochrome P450 3A4 (CYP3A4), the most broadly active drug metabolizing enzyme in humans. CYP3A4 oxidizes and clears over half of all administered pharmaceuticals due to its promiscuity, including antiretroviral drugs such as those used to treat HIV infection (Ernest et al. 2005). Ritonavir can thereby enhance bioavailability and prolong the plasma half life of antiretroviral drugs (Kharasch et al. 2008, Greenblatt & Harmatz 2015).
Ritonavir treatment is currently being investigated for patients with COVID-19 (many clinical trials, example registration nos. ChiCTR2000029603, ChiCTR2000029539, NCT04261270, NCT04255017) (Martinez 2020, Ortega et al. 2020, Cao et al. 2020, Deng et al. 2020, Harrison 2020). It turns out however that the best use of ritonavir is in combination with the SARS-CoV-2 nsp5 inhibitor nirmatrelvir, the combination approved and sold as Paxlovid (NCT04960202).",
"cellular_location": "cytosol, endoplasmic reticulum membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P20813-1",
"P08684-1"
],
"evidence": [
{
"id": "R-HSA-9680865",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680865"
}
]
},
{
"id": "R-HSA-9749986",
"name": "CYP2,3 cytochromes hydroxylate ST to 2,3-DHBA",
"equation": "",
"summary": "2,3-Dihydroxybenzoate (2,3-DHBA) is a minor oxidation product of salicylate (ST). The reaction is catalyzed by several CYP2 and CYP3 cytochromes in the ER of hepatocytes (Grootveld & Halliwell, 1988; Bojic et al, 2015)",
"cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane",
"input_participant_list": [],
"output_participant_list": [
"R-ALL-9750011"
],
"enzyme_list": [
"P05181-1",
"P10635-1",
"P33261-1",
"P10632-1",
"P11712-1",
"P08684-1"
],
"evidence": [
{
"id": "R-HSA-9749986",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749986"
}
]
},
{
"id": "R-HSA-9750016",
"name": "CYP2,3 cytochromes hydroxylate ST to 2,5-DHBA",
"equation": "",
"summary": "2,5-Dihydroxybenzoate (gentisic acid, 2,5-DHBA) is a minor oxidation product of salicylate (ST). The reaction is catalyzed by several CYP2 and CYP3 cytochromes in the ER of hepatocytes (Grootveld & Halliwell, 1988; Bojic et al, 2015).",
"cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane",
"input_participant_list": [],
"output_participant_list": [
"R-ALL-9750014"
],
"enzyme_list": [
"P05181-1",
"P10635-1",
"P33261-1",
"P10632-1",
"P11712-1",
"P08684-1"
],
"evidence": [
{
"id": "R-HSA-9750016",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9750016"
}
]
},
{
"id": "R-HSA-9756138",
"name": "CYP3A4 monooxygenates ATVL to 2-OH-ATVL",
"equation": "",
"summary": "Atorvastatin lactone (ATVL) is hydroxylated to hydroxy-metabolites, predominantly by cytochrome P450 3A4 (CYP3A4) (Park et al. 2008). Statin lactones are metabolized to a much higher extent than their acid forms by CYP enzymes, suggesting that metabolism of the lactone is the relevant pathway for atorvastatin elimination (Jacobsen et al. 2000, Fujino et al. 2004, Filppula et al. 2021). Described here is the formation of 2-hydroxyatorvastatin lactone (2-OH-ATVL).",
"cellular_location": "cytosol, endoplasmic reticulum membrane",
"input_participant_list": [
"R-ALL-9756319"
],
"output_participant_list": [],
"enzyme_list": [
"P08684-1"
],
"evidence": [
{
"id": "R-HSA-9756138",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9756138"
}
]
},
{
"id": "R-HSA-9756162",
"name": "CYP3A4 monooxygenates ATV to 4-OH-ATV",
"equation": "",
"summary": "Atorvastatin (ATV) is hydroxylated to hydroxy-metabolites, predominantly by cytochrome P450 3A4 (CYP3A4) (Fujino et al. 2004, Park et al. 2008). Here, ATV hydroxylation to 4-hydroxyatorvastatin (4-OH-ATV, aka para-hydroxyatorvastatin) is described.",
"cellular_location": "cytosol, endoplasmic reticulum membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P08684-1"
],
"evidence": [
{
"id": "R-HSA-9756162",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9756162"
}
]
},
{
"id": "R-HSA-9756169",
"name": "CYP3A4 monooxygenates ATV to 2-OH-ATV",
"equation": "",
"summary": "Atorvastatin (ATV) is hydroxylated to hydroxy-metabolites, predominantly by cytochrome P450 3A4 (CYP3A4) (Fujino et al. 2004, Park et al. 2008). Here, ATV hydroxylation to 2-hydroxyatorvastatin (2-OH-ATV, aka ortho-hydroxyatorvastatin) is described.",
"cellular_location": "cytosol, endoplasmic reticulum membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P08684-1"
],
"evidence": [
{
"id": "R-HSA-9756169",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9756169"
}
]
},
{
"id": "R-HSA-9756180",
"name": "CYP3A4 monooxygenates ATVL to 4-OH-ATVL",
"equation": "",
"summary": "Atorvastatin lactone (ATVL) is hydroxylated to hydroxy-metabolites, predominantly by cytochrome P450 3A4 (CYP3A4) (Park et al. 2008). Statin lactones are metabolized to a much higher extent than their acid forms by CYP enzymes, suggesting that metabolism of the lactone is the relevant pathway for atorvastatin elimination (Jacobsen et al. 2000, Fujino et al. 2004, Filppula et al. 2021). Described here is the formation of 4-hydroxyatorvastatin lactone (4-OH-ATVL).",
"cellular_location": "cytosol, endoplasmic reticulum membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P08684-1"
],
"evidence": [
{
"id": "R-HSA-9756180",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9756180"
}
]
},
{
"id": "R-HSA-9758674",
"name": "CYP3A4 oxidizes PREDN,PREDL",
"equation": "",
"summary": "Prednisolone (PREDL) strongly induces the expression of cytochrome P450 3A4 (CYP3A4) in hepatic cells (Sumida et al, 2000; Usui et al, 2002). Co-application of the CYP3A4 inhibitor ketoconazole with predisolone decreased urinary output of the metabolite 6beta-hydroxyprednisolone (6\u03b2OH-PREDL) significantly (Z\u00fcrcher et al, 1989). As CYP3A4 also hydroxylates cortisol to the 6betaOH-product (Peng et al, 2011) it is probable that CYP3A4 oxidizes PREDN to 6\u03b2OH-PREDN, and PREDL to 6\u03b2OH-PREDL.",
"cellular_location": "cytosol, endoplasmic reticulum membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P08684-1"
],
"evidence": [
{
"id": "R-HSA-9758674",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9758674"
}
]
}
],
"reaction_participants": [
{
"participant_id": "R-ALL-156522",
"participant_name": "AFB1 [endoplasmic reticulum lumen]",
"crossref": [
{
"id": "8147046",
"database": "PubChem Substance",
"url": ""
},
{
"id": "2504",
"database": "ChEBI",
"url": ""
},
{
"id": "C06800",
"database": "COMPOUND",
"url": ""
},
{
"id": "000000402671",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0006552",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "C06800",
"database": "COMPOUND",
"url": ""
},
{
"id": "2504",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0006552",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "8147046",
"database": "PubChem Substance",
"url": ""
},
{
"id": "000000402671",
"database": "ZINC",
"url": ""
},
{
"id": "C06800",
"database": "COMPOUND",
"url": ""
},
{
"id": "2504",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0006552",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "8147046",
"database": "PubChem Substance",
"url": ""
},
{
"id": "000000402671",
"database": "ZINC",
"url": ""
},
{
"id": "2504",
"database": "ChEBI",
"url": ""
},
{
"id": "8147046",
"database": "PubChem Substance",
"url": ""
},
{
"id": "C06800",
"database": "COMPOUND",
"url": ""
},
{
"id": "000000402671",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0006552",
"database": "HMDB Metabolite",
"url": ""
}
]
},
{
"participant_id": "R-ALL-156523",
"participant_name": "AFXBO [endoplasmic reticulum lumen]",
"crossref": [
{
"id": "30725",
"database": "ChEBI",
"url": ""
},
{
"id": "000006017718",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0006558",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "000006017718",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0006558",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "30725",
"database": "ChEBI",
"url": ""
},
{
"id": "000006017718",
"database": "ZINC",
"url": ""
},
{
"id": "30725",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0006558",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "30725",
"database": "ChEBI",
"url": ""
},
{
"id": "000006017718",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0006558",
"database": "HMDB Metabolite",
"url": ""
}
]
},
{
"participant_id": "R-ALL-159211",
"participant_name": "AFXBO [cytosol]",
"crossref": [
{
"id": "30725",
"database": "ChEBI",
"url": ""
},
{
"id": "000006017718",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0006558",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "HMDB0006558",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "30725",
"database": "ChEBI",
"url": ""
},
{
"id": "000006017718",
"database": "ZINC",
"url": ""
},
{
"id": "30725",
"database": "ChEBI",
"url": ""
},
{
"id": "000006017718",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0006558",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "000006017718",
"database": "ZINC",
"url": ""
},
{
"id": "30725",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0006558",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "30725",
"database": "ChEBI",
"url": ""
},
{
"id": "000006017718",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0006558",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "30725",
"database": "ChEBI",
"url": ""
},
{
"id": "000006017718",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0006558",
"database": "HMDB Metabolite",
"url": ""
}
]
},
{
"participant_id": "R-ALL-213144",
"participant_name": "6BHT [endoplasmic reticulum lumen]",
"crossref": [
{
"id": "34477",
"database": "ChEBI",
"url": ""
},
{
"id": "000005764534",
"database": "ZINC",
"url": ""
},
{
"id": "C14497",
"database": "COMPOUND",
"url": ""
},
{
"id": "34477",
"database": "ChEBI",
"url": ""
},
{
"id": "C14497",
"database": "COMPOUND",
"url": ""
},
{
"id": "000005764534",
"database": "ZINC",
"url": ""
},
{
"id": "000005764534",
"database": "ZINC",
"url": ""
},
{
"id": "C14497",
"database": "COMPOUND",
"url": ""
},
{
"id": "34477",
"database": "ChEBI",
"url": ""
},
{
"id": "34477",
"database": "ChEBI",
"url": ""
},
{
"id": "000005764534",
"database": "ZINC",
"url": ""
},
{
"id": "C14497",
"database": "COMPOUND",
"url": ""
}
]
},
{
"participant_id": "R-ALL-213151",
"participant_name": "N-demethylated loperamide [endoplasmic reticulum lumen]",
"crossref": [
{
"id": "64043",
"database": "ChEBI",
"url": ""
},
{
"id": "000021981239",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0255118",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "HMDB0255118",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "64043",
"database": "ChEBI",
"url": ""
},
{
"id": "000021981239",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0255118",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "64043",
"database": "ChEBI",
"url": ""
},
{
"id": "000021981239",
"database": "ZINC",
"url": ""
},
{
"id": "64043",
"database": "ChEBI",
"url": ""
},
{
"id": "000021981239",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0255118",
"database": "HMDB Metabolite",
"url": ""
}
]
},
{
"participant_id": "R-ALL-213155",
"participant_name": "LPAM [endoplasmic reticulum lumen]",
"crossref": [
{
"id": "C07080",
"database": "COMPOUND",
"url": ""
},
{
"id": "HMDB0004999",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "000000537928",
"database": "ZINC",
"url": ""
},
{
"id": "6532",
"database": "ChEBI",
"url": ""
},
{
"id": "C07080",
"database": "COMPOUND",
"url": ""
},
{
"id": "6532",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0004999",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "000000537928",
"database": "ZINC",
"url": ""
},
{
"id": "C07080",
"database": "COMPOUND",
"url": ""
},
{
"id": "6532",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0004999",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "000000537928",
"database": "ZINC",
"url": ""
},
{
"id": "C07080",
"database": "COMPOUND",
"url": ""
},
{
"id": "HMDB0004999",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "000000537928",
"database": "ZINC",
"url": ""
},
{
"id": "6532",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-ALL-30321",
"participant_name": "TES [endoplasmic reticulum lumen]",
"crossref": [
{
"id": "2858",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "17347",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0000234",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "C00535",
"database": "COMPOUND",
"url": ""
},
{
"id": "8144176",
"database": "PubChem Substance",
"url": ""
},
{
"id": "000118912393",
"database": "ZINC",
"url": ""
},
{
"id": "C00535",
"database": "COMPOUND",
"url": ""
},
{
"id": "17347",
"database": "ChEBI",
"url": ""
},
{
"id": "8144176",
"database": "PubChem Substance",
"url": ""
},
{
"id": "2858",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "000118912393",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0000234",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "C00535",
"database": "COMPOUND",
"url": ""
},
{
"id": "17347",
"database": "ChEBI",
"url": ""
},
{
"id": "8144176",
"database": "PubChem Substance",
"url": ""
},
{
"id": "2858",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "000118912393",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0000234",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "2858",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "17347",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0000234",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "C00535",
"database": "COMPOUND",
"url": ""
},
{
"id": "000118912393",
"database": "ZINC",
"url": ""
},
{
"id": "8144176",
"database": "PubChem Substance",
"url": ""
}
]
},
{
"participant_id": "R-ALL-5423605",
"participant_name": "AFB1 [cytosol]",
"crossref": [
{
"id": "C06800",
"database": "COMPOUND",
"url": ""
},
{
"id": "HMDB0006552",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "000000402671",
"database": "ZINC",
"url": ""
},
{
"id": "2504",
"database": "ChEBI",
"url": ""
},
{
"id": "8147046",
"database": "PubChem Substance",
"url": ""
},
{
"id": "C06800",
"database": "COMPOUND",
"url": ""
},
{
"id": "2504",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0006552",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "8147046",
"database": "PubChem Substance",
"url": ""
},
{
"id": "000000402671",
"database": "ZINC",
"url": ""
},
{
"id": "2504",
"database": "ChEBI",
"url": ""
},
{
"id": "8147046",
"database": "PubChem Substance",
"url": ""
},
{
"id": "C06800",
"database": "COMPOUND",
"url": ""
},
{
"id": "000000402671",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0006552",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "C06800",
"database": "COMPOUND",
"url": ""
},
{
"id": "2504",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0006552",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "8147046",
"database": "PubChem Substance",
"url": ""
},
{
"id": "000000402671",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0006552",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "000000402671",
"database": "ZINC",
"url": ""
},
{
"id": "C06800",
"database": "COMPOUND",
"url": ""
},
{
"id": "8147046",
"database": "PubChem Substance",
"url": ""
},
{
"id": "2504",
"database": "ChEBI",
"url": ""
},
{
"id": "000000402671",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0006552",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "C06800",
"database": "COMPOUND",
"url": ""
},
{
"id": "8147046",
"database": "PubChem Substance",
"url": ""
},
{
"id": "2504",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-ALL-5423660",
"participant_name": "AFQ1 [cytosol]",
"crossref": [
{
"id": "C06800",
"database": "COMPOUND",
"url": ""
},
{
"id": "78582",
"database": "ChEBI",
"url": ""
},
{
"id": "000006017736",
"database": "ZINC",
"url": ""
},
{
"id": "78582",
"database": "ChEBI",
"url": ""
},
{
"id": "000006017736",
"database": "ZINC",
"url": ""
},
{
"id": "C06800",
"database": "COMPOUND",
"url": ""
},
{
"id": "78582",
"database": "ChEBI",
"url": ""
},
{
"id": "C06800",
"database": "COMPOUND",
"url": ""
},
{
"id": "000006017736",
"database": "ZINC",
"url": ""
},
{
"id": "C06800",
"database": "COMPOUND",
"url": ""
},
{
"id": "78582",
"database": "ChEBI",
"url": ""
},
{
"id": "000006017736",
"database": "ZINC",
"url": ""
}
]
},
{
"participant_id": "R-ALL-5423663",
"participant_name": "AFNBO [cytosol]",
"crossref": [
{
"id": "78586",
"database": "ChEBI",
"url": ""
},
{
"id": "000070647042",
"database": "ZINC",
"url": ""
},
{
"id": "78586",
"database": "ChEBI",
"url": ""
},
{
"id": "000070647042",
"database": "ZINC",
"url": ""
},
{
"id": "78586",
"database": "ChEBI",
"url": ""
},
{
"id": "000070647042",
"database": "ZINC",
"url": ""
},
{
"id": "78586",
"database": "ChEBI",
"url": ""
},
{
"id": "000070647042",
"database": "ZINC",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9024011",
"participant_name": "DHA [cytosol]",
"crossref": [
{
"id": "000004474564",
"database": "ZINC",
"url": ""
},
{
"id": "77016",
"database": "ChEBI",
"url": ""
},
{
"id": "77016",
"database": "ChEBI",
"url": ""
},
{
"id": "000004474564",
"database": "ZINC",
"url": ""
},
{
"id": "77016",
"database": "ChEBI",
"url": ""
},
{
"id": "000004474564",
"database": "ZINC",
"url": ""
},
{
"id": "77016",
"database": "ChEBI",
"url": ""
},
{
"id": "000004474564",
"database": "ZINC",
"url": ""
},
{
"id": "77016",
"database": "ChEBI",
"url": ""
},
{
"id": "000004474564",
"database": "ZINC",
"url": ""
},
{
"id": "000004474564",
"database": "ZINC",
"url": ""
},
{
"id": "77016",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9750011",
"participant_name": "2,3-DHBA [endoplasmic reticulum lumen]",
"crossref": [
{
"id": "36654",
"database": "ChEBI",
"url": ""
},
{
"id": "000000388166",
"database": "ZINC",
"url": ""
},
{
"id": "36654",
"database": "ChEBI",
"url": ""
},
{
"id": "000000388166",
"database": "ZINC",
"url": ""
},
{
"id": "36654",
"database": "ChEBI",
"url": ""
},
{
"id": "000000388166",
"database": "ZINC",
"url": ""
},
{
"id": "000000388166",
"database": "ZINC",
"url": ""
},
{
"id": "36654",
"database": "ChEBI",
"url": ""
},
{
"id": "36654",
"database": "ChEBI",
"url": ""
},
{
"id": "000000388166",
"database": "ZINC",
"url": ""
},
{
"id": "36654",
"database": "ChEBI",
"url": ""
},
{
"id": "000000388166",
"database": "ZINC",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9750014",
"participant_name": "2,5-DHBA [endoplasmic reticulum lumen]",
"crossref": [
{
"id": "58044",
"database": "ChEBI",
"url": ""
},
{
"id": "000000001507",
"database": "ZINC",
"url": ""
},
{
"id": "58044",
"database": "ChEBI",
"url": ""
},
{
"id": "000000001507",
"database": "ZINC",
"url": ""
},
{
"id": "58044",
"database": "ChEBI",
"url": ""
},
{
"id": "000000001507",
"database": "ZINC",
"url": ""
},
{
"id": "58044",
"database": "ChEBI",
"url": ""
},
{
"id": "000000001507",
"database": "ZINC",
"url": ""
},
{
"id": "58044",
"database": "ChEBI",
"url": ""
},
{
"id": "000000001507",
"database": "ZINC",
"url": ""
},
{
"id": "58044",
"database": "ChEBI",
"url": ""
},
{
"id": "000000001507",
"database": "ZINC",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9756319",
"participant_name": "ATVL [cytosol]",
"crossref": [
{
"id": "2957",
"database": "Guide to Pharmacology",
"url": ""
},
{
"id": "2957",
"database": "Guide to Pharmacology",
"url": ""
},
{
"id": "2957",
"database": "Guide to Pharmacology",
"url": ""
},
{
"id": "2957",
"database": "Guide to Pharmacology",
"url": ""
},
{
"id": "2957",
"database": "Guide to Pharmacology",
"url": ""
}
]
}
],
"reaction_enzymes": [
{
"uniprot_ac": "A0A087X1C5",
"gene_name": "CYP2D7",
"activity": [
{
"ec_number": "1.14.14.-",
"activity": "",
"evidence": [
{
"id": "A0A087X1C5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A087X1C5"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "A0A087X1C5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A087X1C5"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "A0A087X1C5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A087X1C5"
}
]
}
]
},
{
"uniprot_ac": "A0A0G2K5K4",
"gene_name": "Cyp3a62",
"activity": [
{
"ec_number": "1.14.14.-",
"activity": "",
"evidence": [
{
"id": "A0A0G2K5K4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A0G2K5K4"
}
]
}
]
},
{
"uniprot_ac": "A0A8I5ZZ08",
"gene_name": "LOC103691092",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "A0A8I5ZZ08",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A8I5ZZ08"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "A0A8I5ZZ08",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A8I5ZZ08"
}
]
}
]
},
{
"uniprot_ac": "A0A8I6A0P6",
"gene_name": "Cyp3a73",
"activity": [
{
"ec_number": "1.14.14.-",
"activity": "",
"evidence": [
{
"id": "A0A8I6A0P6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A8I6A0P6"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "A0A8I6A0P6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A8I6A0P6"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "A0A8I6A0P6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A8I6A0P6"
}
]
}
]
},
{
"uniprot_ac": "A2A974",
"gene_name": "Cyp4a12b",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "A2A974",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A2A974"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "A2A974",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A2A974"
}
]
}
]
},
{
"uniprot_ac": "A6H6J2",
"gene_name": "Cyp2b13",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "A6H6J2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A6H6J2"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "A6H6J2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A6H6J2"
}
]
}
]
},
{
"uniprot_ac": "B2RXA7",
"gene_name": "Cyp26c1",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "B2RXA7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/B2RXA7"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "B2RXA7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/B2RXA7"
}
]
}
]
},
{
"uniprot_ac": "B2RXZ2",
"gene_name": "Cyp2a22",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "B2RXZ2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/B2RXZ2"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "B2RXZ2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/B2RXZ2"
}
]
}
]
},
{
"uniprot_ac": "D3YYZ0",
"gene_name": "Cyp3a57",
"activity": [
{
"ec_number": "1.14.14.-",
"activity": "",
"evidence": [
{
"id": "D3YYZ0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D3YYZ0"
}
]
}
]
},
{
"uniprot_ac": "D3Z2W7",
"gene_name": "Cyp3a59",
"activity": [
{
"ec_number": "1.14.14.-",
"activity": "",
"evidence": [
{
"id": "D3Z2W7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D3Z2W7"
}
]
}
]
},
{
"uniprot_ac": "D4A820",
"gene_name": "Cyp2s1",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "D4A820",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D4A820"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "D4A820",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D4A820"
}
]
}
]
},
{
"uniprot_ac": "E9Q593",
"gene_name": "Cyp2b23",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "E9Q593",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/E9Q593"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "E9Q593",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/E9Q593"
}
]
}
]
},
{
"uniprot_ac": "E9Q5K4",
"gene_name": "Cyp2c23",
"activity": [
{
"ec_number": "1.14.14.-",
"activity": "",
"evidence": [
{
"id": "E9Q5K4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/E9Q5K4"
}
]
}
]
},
{
"uniprot_ac": "E9Q816",
"gene_name": "Cyp2w1",
"activity": [
{
"ec_number": "1.14.14.-",
"activity": "",
"evidence": [
{
"id": "E9Q816",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/E9Q816"
}
]
}
]
},
{
"uniprot_ac": "F1LT33",
"gene_name": "Cyp2b14",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "F1LT33",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1LT33"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "F1LT33",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1LT33"
}
]
}
]
},
{
"uniprot_ac": "G3V7X8",
"gene_name": "Cyp26b1",
"activity": [
{
"ec_number": "1.14.13.-",
"activity": "",
"evidence": [
{
"id": "G3V7X8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/G3V7X8"
}
]
}
]
},
{
"uniprot_ac": "G3V9D2",
"gene_name": "Cyp2b21",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "G3V9D2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/G3V9D2"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "G3V9D2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/G3V9D2"
}
]
}
]
},
{
"uniprot_ac": "O09158",
"gene_name": "Cyp3a25",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "O09158",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O09158"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "O09158",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O09158"
}
]
},
{
"ec_number": "1.14.14.-",
"activity": "",
"evidence": [
{
"id": "O09158",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O09158"
}
]
}
]
},
{
"uniprot_ac": "O54749",
"gene_name": "Cyp2j5",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "O54749",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54749"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "O54749",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54749"
}
]
}
]
},
{
"uniprot_ac": "O54750",
"gene_name": "Cyp2j6",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "O54750",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54750"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "O54750",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54750"
}
]
}
]
},
{
"uniprot_ac": "O55071",
"gene_name": "Cyp2b19",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "O55071",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O55071"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "O55071",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O55071"
}
]
}
]
},
{
"uniprot_ac": "P00176",
"gene_name": "Cyp2b1",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P00176",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00176"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P00176",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00176"
}
]
}
]
},
{
"uniprot_ac": "P00184",
"gene_name": "Cyp1a1",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P00184",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00184"
}
]
},
{
"ec_number": "4.2.1.152",
"activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.",
"evidence": [
{
"id": "P00184",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00184"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P00184",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00184"
}
]
}
]
},
{
"uniprot_ac": "P00185",
"gene_name": "Cyp1a1",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P00185",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00185"
}
]
},
{
"ec_number": "4.2.1.152",
"activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.",
"evidence": [
{
"id": "P00185",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00185"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P00185",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00185"
}
]
}
]
},
{
"uniprot_ac": "P00186",
"gene_name": "Cyp1a2",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P00186",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00186"
}
]
},
{
"ec_number": "4.2.1.152",
"activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.",
"evidence": [
{
"id": "P00186",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00186"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P00186",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00186"
}
]
}
]
},
{
"uniprot_ac": "P04167",
"gene_name": "Cyp2b2",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P04167",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04167"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P04167",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04167"
}
]
}
]
},
{
"uniprot_ac": "P04798",
"gene_name": "CYP1A1",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P04798",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04798"
}
]
},
{
"ec_number": "4.2.1.152",
"activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.",
"evidence": [
{
"id": "P04798",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04798"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P04798",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04798"
}
]
}
]
},
{
"uniprot_ac": "P04799",
"gene_name": "Cyp1a2",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P04799",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04799"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P04799",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04799"
}
]
},
{
"ec_number": "4.2.1.152",
"activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.",
"evidence": [
{
"id": "P04799",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04799"
}
]
}
]
},
{
"uniprot_ac": "P04800",
"gene_name": "Cyp3a1",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P04800",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04800"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P04800",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04800"
}
]
},
{
"ec_number": "1.14.14.-",
"activity": "",
"evidence": [
{
"id": "P04800",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04800"
}
]
}
]
},
{
"uniprot_ac": "P05177",
"gene_name": "CYP1A2",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P05177",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05177"
}
]
},
{
"ec_number": "4.2.1.152",
"activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.",
"evidence": [
{
"id": "P05177",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05177"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P05177",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05177"
}
]
}
]
},
{
"uniprot_ac": "P05178",
"gene_name": "Cyp2c6",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P05178",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05178"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P05178",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05178"
}
]
}
]
},
{
"uniprot_ac": "P05179",
"gene_name": "Cyp2c7",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P05179",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05179"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P05179",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05179"
}
]
}
]
},
{
"uniprot_ac": "P05181",
"gene_name": "CYP2E1",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P05181",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05181"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P05181",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05181"
}
]
},
{
"ec_number": "1.14.13.n7",
"activity": "4-nitrophenol + H(+) + NADPH + O2 = 4-nitrocatechol + H2O + NADP(+).",
"evidence": [
{
"id": "P05181",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05181"
}
]
},
{
"ec_number": "1.14.13.n7",
"activity": "",
"evidence": [
{
"id": "P05181",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05181"
}
]
}
]
},
{
"uniprot_ac": "P05182",
"gene_name": "Cyp2e1",
"activity": [
{
"ec_number": "1.14.13.n7",
"activity": "4-nitrophenol + H(+) + NADPH + O2 = 4-nitrocatechol + H2O + NADP(+).",
"evidence": [
{
"id": "P05182",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05182"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P05182",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05182"
}
]
},
{
"ec_number": "1.14.13.n7",
"activity": "",
"evidence": [
{
"id": "P05182",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05182"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P05182",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05182"
}
]
}
]
},
{
"uniprot_ac": "P05183",
"gene_name": "Cyp3a2",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P05183",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05183"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P05183",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05183"
}
]
}
]
},
{
"uniprot_ac": "P08683",
"gene_name": "Cyp2c11",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P08683",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08683"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P08683",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08683"
}
]
}
]
},
{
"uniprot_ac": "P08684",
"gene_name": "CYP3A4",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P08684",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08684"
}
]
},
{
"ec_number": "1.14.14.55",
"activity": "O2 + quinine + reduced [NADPH--hemoprotein reductase] = 3-hydroxyquinine + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P08684",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08684"
}
]
},
{
"ec_number": "1.14.14.56",
"activity": "1,8-cineole + O2 + reduced [NADPH--hemoprotein reductase] = 2-exo-hydroxy-1,8-cineole + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P08684",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08684"
}
]
},
{
"ec_number": "1.14.14.73",
"activity": "albendazole + O2 + reduced [NADPH--hemoprotein reductase] = albendazole S-oxide + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P08684",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08684"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P08684",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08684"
}
]
},
{
"ec_number": "1.14.14.-",
"activity": "",
"evidence": [
{
"id": "P08684",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08684"
}
]
}
]
},
{
"uniprot_ac": "P10610",
"gene_name": "Cyp2g1",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P10610",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10610"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P10610",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10610"
}
]
}
]
},
{
"uniprot_ac": "P10632",
"gene_name": "CYP2C8",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P10632",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10632"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P10632",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10632"
}
]
}
]
},
{
"uniprot_ac": "P10633",
"gene_name": "Cyp2d1",
"activity": [
{
"ec_number": "1.14.14.-",
"activity": "",
"evidence": [
{
"id": "P10633",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10633"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P10633",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10633"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P10633",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10633"
}
]
}
]
},
{
"uniprot_ac": "P10634",
"gene_name": "Cyp2d26",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P10634",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10634"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P10634",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10634"
}
]
}
]
},
{
"uniprot_ac": "P10635",
"gene_name": "CYP2D6",
"activity": [
{
"ec_number": "1.14.14.-",
"activity": "",
"evidence": [
{
"id": "P10635",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10635"
}
]
}
]
},
{
"uniprot_ac": "P11509",
"gene_name": "CYP2A6",
"activity": [
{
"ec_number": "1.14.14.-",
"activity": "",
"evidence": [
{
"id": "P11509",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11509"
}
]
}
]
},
{
"uniprot_ac": "P11510",
"gene_name": "Cyp2c12",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P11510",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11510"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P11510",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11510"
}
]
}
]
},
{
"uniprot_ac": "P11511",
"gene_name": "CYP19A1",
"activity": [
{
"ec_number": "1.14.14.14",
"activity": "androst-4-ene-3,17-dione + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = estrone + formate + 4 H(+) + 4 H2O + 3 oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P11511",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11511"
}
]
},
{
"ec_number": "1.14.14.14",
"activity": "",
"evidence": [
{
"id": "P11511",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11511"
}
]
}
]
},
{
"uniprot_ac": "P11711",
"gene_name": "Cyp2a1",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P11711",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11711"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P11711",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11711"
}
]
}
]
},
{
"uniprot_ac": "P11712",
"gene_name": "CYP2C9",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P11712",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11712"
}
]
},
{
"ec_number": "1.14.14.51",
"activity": "(4S)-limonene + O2 + reduced [NADPH--hemoprotein reductase] = (1S,5R)-carveol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P11712",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11712"
}
]
},
{
"ec_number": "1.14.14.52",
"activity": "(4S)-limonene + O2 + reduced [NADPH--hemoprotein reductase] = (4S)-perillyl alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P11712",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11712"
}
]
},
{
"ec_number": "1.14.14.53",
"activity": "(4R)-limonene + O2 + reduced [NADPH--hemoprotein reductase] = (1R,5S)-carveol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P11712",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11712"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P11712",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11712"
}
]
}
]
},
{
"uniprot_ac": "P11714",
"gene_name": "Cyp2d9",
"activity": [
{
"ec_number": "1.14.14.-",
"activity": "",
"evidence": [
{
"id": "P11714",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11714"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P11714",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11714"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P11714",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11714"
}
]
}
]
},
{
"uniprot_ac": "P12790",
"gene_name": "Cyp2b9",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P12790",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P12790"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P12790",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P12790"
}
]
}
]
},
{
"uniprot_ac": "P12791",
"gene_name": "Cyp2b10",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P12791",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P12791"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P12791",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P12791"
}
]
}
]
},
{
"uniprot_ac": "P12938",
"gene_name": "Cyp2d3",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P12938",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P12938"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P12938",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P12938"
}
]
}
]
},
{
"uniprot_ac": "P12939",
"gene_name": "Cyp2d10",
"activity": [
{
"ec_number": "1.14.14.-",
"activity": "",
"evidence": [
{
"id": "P12939",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P12939"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P12939",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P12939"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P12939",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P12939"
}
]
}
]
},
{
"uniprot_ac": "P13107",
"gene_name": "Cyp2b3",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P13107",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13107"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P13107",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13107"
}
]
}
]
},
{
"uniprot_ac": "P13584",
"gene_name": "CYP4B1",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P13584",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13584"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P13584",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13584"
}
]
}
]
},
{
"uniprot_ac": "P15129",
"gene_name": "Cyp4b1",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P15129",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P15129"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P15129",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P15129"
}
]
}
]
},
{
"uniprot_ac": "P15149",
"gene_name": "Cyp2a2",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P15149",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P15149"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P15149",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P15149"
}
]
}
]
},
{
"uniprot_ac": "P15392",
"gene_name": "Cyp2a4",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P15392",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P15392"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P15392",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P15392"
}
]
}
]
},
{
"uniprot_ac": "P20812",
"gene_name": "Cyp2a3",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P20812",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20812"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P20812",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20812"
}
]
}
]
},
{
"uniprot_ac": "P20813",
"gene_name": "CYP2B6",
"activity": [
{
"ec_number": "1.14.13.-",
"activity": "",
"evidence": [
{
"id": "P20813",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20813"
}
]
}
]
},
{
"uniprot_ac": "P20814",
"gene_name": "Cyp2c13",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P20814",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20814"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P20814",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20814"
}
]
}
]
},
{
"uniprot_ac": "P20815",
"gene_name": "CYP3A5",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P20815",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20815"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P20815",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20815"
}
]
}
]
},
{
"uniprot_ac": "P20852",
"gene_name": "Cyp2a5",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P20852",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20852"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P20852",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20852"
}
]
}
]
},
{
"uniprot_ac": "P20853",
"gene_name": "CYP2A7",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P20853",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20853"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P20853",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20853"
}
]
}
]
},
{
"uniprot_ac": "P24456",
"gene_name": "Cyp2d10",
"activity": [
{
"ec_number": "1.14.14.-",
"activity": "",
"evidence": [
{
"id": "P24456",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24456"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P24456",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24456"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P24456",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24456"
}
]
}
]
},
{
"uniprot_ac": "P24457",
"gene_name": "Cyp2d11",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P24457",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24457"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P24457",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24457"
}
]
}
]
},
{
"uniprot_ac": "P24462",
"gene_name": "CYP3A7",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P24462",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24462"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P24462",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24462"
}
]
}
]
},
{
"uniprot_ac": "P24464",
"gene_name": "Cyp4a12",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P24464",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24464"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P24464",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24464"
}
]
}
]
},
{
"uniprot_ac": "P24470",
"gene_name": "Cyp2c23",
"activity": [
{
"ec_number": "1.14.14.-",
"activity": "",
"evidence": [
{
"id": "P24470",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24470"
}
]
}
]
},
{
"uniprot_ac": "P24903",
"gene_name": "CYP2F1",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P24903",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24903"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P24903",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24903"
}
]
}
]
},
{
"uniprot_ac": "P28649",
"gene_name": "Cyp19a1",
"activity": [
{
"ec_number": "1.14.14.14",
"activity": "androst-4-ene-3,17-dione + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = estrone + formate + 4 H(+) + 4 H2O + 3 oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P28649",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P28649"
}
]
},
{
"ec_number": "1.14.14.14",
"activity": "",
"evidence": [
{
"id": "P28649",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P28649"
}
]
}
]
},
{
"uniprot_ac": "P33260",
"gene_name": "CYP2C18",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P33260",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P33260"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P33260",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P33260"
}
]
}
]
},
{
"uniprot_ac": "P33261",
"gene_name": "CYP2C19",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P33261",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P33261"
}
]
},
{
"ec_number": "1.14.14.51",
"activity": "(4S)-limonene + O2 + reduced [NADPH--hemoprotein reductase] = (1S,5R)-carveol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P33261",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P33261"
}
]
},
{
"ec_number": "1.14.14.52",
"activity": "(4S)-limonene + O2 + reduced [NADPH--hemoprotein reductase] = (4S)-perillyl alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P33261",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P33261"
}
]
},
{
"ec_number": "1.14.14.53",
"activity": "(4R)-limonene + O2 + reduced [NADPH--hemoprotein reductase] = (1R,5S)-carveol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P33261",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P33261"
}
]
},
{
"ec_number": "1.14.14.75",
"activity": "fenbendazole + O2 + reduced [NADPH--hemoprotein reductase] = 4'-hydroxyfenbendazole + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P33261",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P33261"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P33261",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P33261"
}
]
}
]
},
{
"uniprot_ac": "P33272",
"gene_name": "Cyp2b12",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P33272",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P33272"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P33272",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P33272"
}
]
}
]
},
{
"uniprot_ac": "P33273",
"gene_name": "Cyp2c55",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P33273",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P33273"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P33273",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P33273"
}
]
}
]
},
{
"uniprot_ac": "P51538",
"gene_name": "Cyp3a9",
"activity": [
{
"ec_number": "1.14.14.-",
"activity": "",
"evidence": [
{
"id": "P51538",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51538"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P51538",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51538"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P51538",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51538"
}
]
}
]
},
{
"uniprot_ac": "P51589",
"gene_name": "CYP2J2",
"activity": [
{
"ec_number": "1.14.14.-",
"activity": "",
"evidence": [
{
"id": "P51589",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51589"
}
]
},
{
"ec_number": "5.4.4.7",
"activity": "a hydroperoxyeicosatetraenoate = a hydroxy-epoxy-eicosatetraenoate.",
"evidence": [
{
"id": "P51589",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51589"
}
]
},
{
"ec_number": "1.14.14.73",
"activity": "albendazole + O2 + reduced [NADPH--hemoprotein reductase] = albendazole S-oxide + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P51589",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51589"
}
]
},
{
"ec_number": "1.14.14.74",
"activity": "albendazole + O2 + reduced [NADPH--hemoprotein reductase] = H(+) + H2O + hydroxyalbendazole + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P51589",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51589"
}
]
}
]
},
{
"uniprot_ac": "P51590",
"gene_name": "Cyp2j3",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P51590",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51590"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P51590",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51590"
}
]
}
]
},
{
"uniprot_ac": "P51870",
"gene_name": "Cyp4f5",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P51870",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51870"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P51870",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51870"
}
]
}
]
},
{
"uniprot_ac": "P51871",
"gene_name": "Cyp4f6",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P51871",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51871"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P51871",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51871"
}
]
}
]
},
{
"uniprot_ac": "P56593",
"gene_name": "Cyp2a12",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P56593",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P56593"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P56593",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P56593"
}
]
}
]
},
{
"uniprot_ac": "P56654",
"gene_name": "Cyp2c37",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P56654",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P56654"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P56654",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P56654"
}
]
}
]
},
{
"uniprot_ac": "P56655",
"gene_name": "Cyp2c38",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P56655",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P56655"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P56655",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P56655"
}
]
}
]
},
{
"uniprot_ac": "P56656",
"gene_name": "Cyp2c39",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P56656",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P56656"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P56656",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P56656"
}
]
}
]
},
{
"uniprot_ac": "P56657",
"gene_name": "Cyp2c40",
"activity": [
{
"ec_number": "1.14.14.-",
"activity": "",
"evidence": [
{
"id": "P56657",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P56657"
}
]
}
]
},
{
"uniprot_ac": "P78329",
"gene_name": "CYP4F2",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P78329",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P78329"
}
]
},
{
"ec_number": "1.14.14.78",
"activity": "O2 + phylloquinone + reduced [NADPH--hemoprotein reductase] = H(+) + H2O + omega-hydroxyphylloquinone + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P78329",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P78329"
}
]
},
{
"ec_number": "1.14.14.79",
"activity": "(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate + O2 + reduced [NADPH--hemoprotein reductase] = 22-hydroxy-(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P78329",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P78329"
}
]
},
{
"ec_number": "1.14.14.94",
"activity": "leukotriene B4 + O2 + reduced [NADPH--hemoprotein reductase] = 20-hydroxy-leukotriene B4 + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P78329",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P78329"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P78329",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P78329"
}
]
}
]
},
{
"uniprot_ac": "P98187",
"gene_name": "CYP4F8",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "P98187",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P98187"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "P98187",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P98187"
}
]
}
]
},
{
"uniprot_ac": "Q02928",
"gene_name": "CYP4A11",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q02928",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q02928"
}
]
},
{
"ec_number": "1.14.14.80",
"activity": "O2 + octadecanoate + reduced [NADPH--hemoprotein reductase] = 18-hydroxyoctadecanoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q02928",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q02928"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "Q02928",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q02928"
}
]
}
]
},
{
"uniprot_ac": "Q05421",
"gene_name": "Cyp2e1",
"activity": [
{
"ec_number": "1.14.13.n7",
"activity": "4-nitrophenol + H(+) + NADPH + O2 = 4-nitrocatechol + H2O + NADP(+).",
"evidence": [
{
"id": "Q05421",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q05421"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q05421",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q05421"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "Q05421",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q05421"
}
]
},
{
"ec_number": "1.14.13.n7",
"activity": "",
"evidence": [
{
"id": "Q05421",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q05421"
}
]
}
]
},
{
"uniprot_ac": "Q08477",
"gene_name": "CYP4F3",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q08477",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q08477"
}
]
},
{
"ec_number": "1.14.14.79",
"activity": "(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate + O2 + reduced [NADPH--hemoprotein reductase] = 22-hydroxy-(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q08477",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q08477"
}
]
},
{
"ec_number": "1.14.14.94",
"activity": "leukotriene B4 + O2 + reduced [NADPH--hemoprotein reductase] = 20-hydroxy-leukotriene B4 + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q08477",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q08477"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "Q08477",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q08477"
}
]
}
]
},
{
"uniprot_ac": "Q16678",
"gene_name": "CYP1B1",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q16678",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16678"
}
]
},
{
"ec_number": "4.2.1.152",
"activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.",
"evidence": [
{
"id": "Q16678",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16678"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "Q16678",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16678"
}
]
}
]
},
{
"uniprot_ac": "Q16696",
"gene_name": "CYP2A13",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q16696",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16696"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "Q16696",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16696"
}
]
}
]
},
{
"uniprot_ac": "Q64429",
"gene_name": "Cyp1b1",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q64429",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64429"
}
]
},
{
"ec_number": "4.2.1.152",
"activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.",
"evidence": [
{
"id": "Q64429",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64429"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "Q64429",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64429"
}
]
}
]
},
{
"uniprot_ac": "Q64458",
"gene_name": "Cyp2c29",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q64458",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64458"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "Q64458",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64458"
}
]
}
]
},
{
"uniprot_ac": "Q64459",
"gene_name": "Cyp3a11",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q64459",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64459"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "Q64459",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64459"
}
]
}
]
},
{
"uniprot_ac": "Q64462",
"gene_name": "Cyp4b1",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q64462",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64462"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "Q64462",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64462"
}
]
}
]
},
{
"uniprot_ac": "Q64464",
"gene_name": "Cyp3a13",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q64464",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64464"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "Q64464",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64464"
}
]
}
]
},
{
"uniprot_ac": "Q64481",
"gene_name": "Cyp3a16",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q64481",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64481"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "Q64481",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64481"
}
]
}
]
},
{
"uniprot_ac": "Q64581",
"gene_name": "Cyp3a18",
"activity": [
{
"ec_number": "1.14.14.-",
"activity": "",
"evidence": [
{
"id": "Q64581",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64581"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q64581",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64581"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "Q64581",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64581"
}
]
}
]
},
{
"uniprot_ac": "Q64583",
"gene_name": "Cyp2b15",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q64583",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64583"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "Q64583",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64583"
}
]
}
]
},
{
"uniprot_ac": "Q64678",
"gene_name": "Cyp1b1",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q64678",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64678"
}
]
},
{
"ec_number": "4.2.1.152",
"activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.",
"evidence": [
{
"id": "Q64678",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64678"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "Q64678",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64678"
}
]
}
]
},
{
"uniprot_ac": "Q64680",
"gene_name": "Cyp2d4",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q64680",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64680"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "Q64680",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64680"
}
]
}
]
},
{
"uniprot_ac": "Q6A152",
"gene_name": "Cyp4x1",
"activity": [
{
"ec_number": "1.14.14.-",
"activity": "",
"evidence": [
{
"id": "Q6A152",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6A152"
}
]
}
]
},
{
"uniprot_ac": "Q6V0L0",
"gene_name": "CYP26C1",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q6V0L0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6V0L0"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "Q6V0L0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6V0L0"
}
]
}
]
},
{
"uniprot_ac": "Q6XVG2",
"gene_name": "Cyp2c54",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q6XVG2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6XVG2"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "Q6XVG2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6XVG2"
}
]
}
]
},
{
"uniprot_ac": "Q811W2",
"gene_name": "Cyp26b1",
"activity": [
{
"ec_number": "1.14.13.-",
"activity": "",
"evidence": [
{
"id": "Q811W2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q811W2"
}
]
}
]
},
{
"uniprot_ac": "Q86W10",
"gene_name": "CYP4Z1",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q86W10",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q86W10"
}
]
},
{
"ec_number": "1.14.14.130",
"activity": "dodecanoate + O2 + reduced [NADPH--hemoprotein reductase] = 7-hydroxydodecanoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q86W10",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q86W10"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "Q86W10",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q86W10"
}
]
}
]
},
{
"uniprot_ac": "Q8CIM7",
"gene_name": "Cyp2d26",
"activity": [
{
"ec_number": "1.14.14.-",
"activity": "",
"evidence": [
{
"id": "Q8CIM7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8CIM7"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q8CIM7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8CIM7"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "Q8CIM7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8CIM7"
}
]
}
]
},
{
"uniprot_ac": "Q8K4D6",
"gene_name": "Cyp4x1",
"activity": [
{
"ec_number": "1.14.14.-",
"activity": "",
"evidence": [
{
"id": "Q8K4D6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8K4D6"
}
]
}
]
},
{
"uniprot_ac": "Q8N118",
"gene_name": "CYP4X1",
"activity": [
{
"ec_number": "1.14.14.-",
"activity": "",
"evidence": [
{
"id": "Q8N118",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8N118"
}
]
}
]
},
{
"uniprot_ac": "Q8TAV3",
"gene_name": "CYP2W1",
"activity": [
{
"ec_number": "1.14.14.-",
"activity": "",
"evidence": [
{
"id": "Q8TAV3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8TAV3"
}
]
}
]
},
{
"uniprot_ac": "Q91WL5",
"gene_name": "Cyp4a12a",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q91WL5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q91WL5"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "Q91WL5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q91WL5"
}
]
}
]
},
{
"uniprot_ac": "Q91X77",
"gene_name": "Cyp2c50",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q91X77",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q91X77"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "Q91X77",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q91X77"
}
]
}
]
},
{
"uniprot_ac": "Q96SQ9",
"gene_name": "CYP2S1",
"activity": [
{
"ec_number": "1.14.14.-",
"activity": "",
"evidence": [
{
"id": "Q96SQ9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96SQ9"
}
]
},
{
"ec_number": "4.2.1.152",
"activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.",
"evidence": [
{
"id": "Q96SQ9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96SQ9"
}
]
},
{
"ec_number": "5.3.99.5",
"activity": "prostaglandin H2 = thromboxane A2.",
"evidence": [
{
"id": "Q96SQ9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96SQ9"
}
]
}
]
},
{
"uniprot_ac": "Q9D816",
"gene_name": "Cyp2c55",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q9D816",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9D816"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "Q9D816",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9D816"
}
]
}
]
},
{
"uniprot_ac": "Q9DBX6",
"gene_name": "Cyp2s1",
"activity": [
{
"ec_number": "1.14.14.-",
"activity": "",
"evidence": [
{
"id": "Q9DBX6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9DBX6"
}
]
},
{
"ec_number": "4.2.1.152",
"activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.",
"evidence": [
{
"id": "Q9DBX6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9DBX6"
}
]
},
{
"ec_number": "5.3.99.5",
"activity": "prostaglandin H2 = thromboxane A2.",
"evidence": [
{
"id": "Q9DBX6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9DBX6"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q9DBX6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9DBX6"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "Q9DBX6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9DBX6"
}
]
}
]
},
{
"uniprot_ac": "Q9EQW4",
"gene_name": "Cyp3a44",
"activity": [
{
"ec_number": "1.14.14.-",
"activity": "",
"evidence": [
{
"id": "Q9EQW4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9EQW4"
}
]
}
]
},
{
"uniprot_ac": "Q9HB55",
"gene_name": "CYP3A43",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q9HB55",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9HB55"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "Q9HB55",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9HB55"
}
]
}
]
},
{
"uniprot_ac": "Q9HBI6",
"gene_name": "CYP4F11",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q9HBI6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9HBI6"
}
]
},
{
"ec_number": "1.14.14.80",
"activity": "O2 + octadecanoate + reduced [NADPH--hemoprotein reductase] = 18-hydroxyoctadecanoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q9HBI6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9HBI6"
}
]
},
{
"ec_number": "1.14.14.78",
"activity": "O2 + phylloquinone + reduced [NADPH--hemoprotein reductase] = H(+) + H2O + omega-hydroxyphylloquinone + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q9HBI6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9HBI6"
}
]
},
{
"ec_number": "1.14.14.79",
"activity": "(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate + O2 + reduced [NADPH--hemoprotein reductase] = 22-hydroxy-(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q9HBI6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9HBI6"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "Q9HBI6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9HBI6"
}
]
}
]
},
{
"uniprot_ac": "Q9HCS2",
"gene_name": "CYP4F12",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q9HCS2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9HCS2"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "Q9HCS2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9HCS2"
}
]
}
]
},
{
"uniprot_ac": "Q9JMA7",
"gene_name": "Cyp3a41a",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q9JMA7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9JMA7"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "Q9JMA7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9JMA7"
}
]
}
]
},
{
"uniprot_ac": "Q9NR63",
"gene_name": "CYP26B1",
"activity": [
{
"ec_number": "1.14.13.-",
"activity": "",
"evidence": [
{
"id": "Q9NR63",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9NR63"
}
]
}
]
},
{
"uniprot_ac": "Q9QXF7",
"gene_name": "CYP2J4",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q9QXF7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9QXF7"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "Q9QXF7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9QXF7"
}
]
}
]
},
{
"uniprot_ac": "Q9WV19",
"gene_name": "Cyp2g1",
"activity": [
{
"ec_number": "1.14.14.1",
"activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q9WV19",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WV19"
}
]
},
{
"ec_number": "1.14.14.1",
"activity": "",
"evidence": [
{
"id": "Q9WV19",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WV19"
}
]
}
]
},
{
"uniprot_ac": "Q9WVK8",
"gene_name": "Cyp46a1",
"activity": [
{
"ec_number": "1.14.14.25",
"activity": "cholesterol + O2 + reduced [NADPH--hemoprotein reductase] = (24S)-hydroxycholesterol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q9WVK8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WVK8"
}
]
},
{
"ec_number": "1.14.14.25",
"activity": "",
"evidence": [
{
"id": "Q9WVK8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WVK8"
}
]
}
]
},
{
"uniprot_ac": "Q9Y6A2",
"gene_name": "CYP46A1",
"activity": [
{
"ec_number": "1.14.14.25",
"activity": "cholesterol + O2 + reduced [NADPH--hemoprotein reductase] = (24S)-hydroxycholesterol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].",
"evidence": [
{
"id": "Q9Y6A2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y6A2"
}
]
},
{
"ec_number": "1.14.14.25",
"activity": "",
"evidence": [
{
"id": "Q9Y6A2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y6A2"
}
]
}
]
}
],
"biomarkers": [
{
"assessed_biomarker_entity": "Cytochrome P450 3A4 (CYP3A4)",
"biomarker_id": "A0015",
"evidence": [
{
"id": "GLY_000625",
"database": "GlyGen",
"url": "https://data.glygen.org/GLY_000625"
},
{
"id": "32758877",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/32758877"
},
{
"id": "29109094",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/29109094"
}
],
"instances": [
{
"best_biomarker_type": "response",
"status": "increased CYP3A4 level",
"disease": {
"disease_id": "DOID:0080600",
"recommended_name": {
"id": "DOID:0080600",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0080600",
"name": "COVID-19",
"description": "A Coronavirus infection that is characterized by fever, cough and shortness of breath and that has_material_basis_in SARS-CoV-2."
},
"synonyms": [
{
"id": "DOID:0080600",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0080600",
"name": "2019 Novel Coronavirus (2019-nCoV)",
"description": ""
},
{
"id": "DOID:0080600",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0080600",
"name": "2019-nCoV infection",
"description": ""
},
{
"id": "DOID:0080600",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0080600",
"name": "Wuhan coronavirus infection",
"description": ""
},
{
"id": "DOID:0080600",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0080600",
"name": "Wuhan seafood market pneumonia virus infection",
"description": ""
},
{
"id": "DOID:0080600",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0080600",
"name": "COVID19",
"description": ""
},
{
"id": "DOID:0080600",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0080600",
"name": "SARS-CoV-2 infection",
"description": ""
}
]
},
"tissue": {
"name": "blood",
"namespace": "UBERON",
"id": "0000178",
"url": "http://purl.obolibrary.org/obo/UBERON_0000178"
},
"evidence": [
{
"id": "GLY_000625",
"database": "GlyGen",
"url": "https://data.glygen.org/GLY_000625"
},
{
"id": "32758877",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/32758877"
}
]
},
{
"best_biomarker_type": "prognostic",
"status": "decreased CYP3A4 level",
"disease": {
"disease_id": "DOID:3571",
"recommended_name": {
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "liver cancer",
"description": "A hepatobiliary system cancer that is located_in the liver."
},
"synonyms": [
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Ca liver - primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Resectable malignant neoplasm of Liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant hepato-biliary neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant tumor of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "non-resectable primary hepatic malignant neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary liver cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "resectable malignant neoplasm of the liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, not specified as primary or secondary",
"description": ""
}
]
},
"tissue": {
"name": "blood",
"namespace": "UBERON",
"id": "0000178",
"url": "http://purl.obolibrary.org/obo/UBERON_0000178"
},
"evidence": [
{
"id": "GLY_000625",
"database": "GlyGen",
"url": "https://data.glygen.org/GLY_000625"
},
{
"id": "29109094",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/29109094"
}
]
}
]
}
],
"synthesized_glycans": [],
"cluster_types": [
{
"name": "isoformset.uniprotkb",
"label": "Isoforms"
},
{
"name": "homologset.mgi",
"label": "MGI Homologs"
}
],
"sequence_features": {
"n_linked_sites": [],
"o_linked_sites": [],
"snv_sites": [],
"glycation_sites": [],
"phosphorylation_sites": [
116,
119,
134,
259,
264,
420,
478
],
"sequon_annotation_sites": [
{
"start_pos": 361,
"end_pos": 363
},
{
"start_pos": 462,
"end_pos": 464
}
]
},
"section_stats": [
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 7
},
{
"field": "total_sites",
"count": 7
}
],
"sort_fields": [
"start_pos",
"end_pos",
"kinase_uniprot_canonical_ac",
"kinase_gene_name",
"residue",
"comment",
"site_lbl"
]
},
{
"table_id": "snv",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv_non_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "publication",
"table_stats": [
{
"field": "total",
"count": 238
}
],
"sort_fields": [
"title",
"journal",
"date",
"authors"
]
}
]
}