{ "uniprot_canonical_ac": "P08603-1", "uniprot_ac": "P08603", "uniprot_id": "CFAH_HUMAN", "mass": { "chemical_mass": 139096.0, "monoisotopic_mass": 139096.0 }, "refseq": { "ac": "NP_000177", "name": "complement factor H isoform a precursor", "summary": "This gene is a member of the Regulator of Complement Activation (RCA) gene cluster and encodes a protein with twenty short consensus repeat (SCR) domains. This protein is secreted into the bloodstream and has an essential role in the regulation of complement activation, restricting this innate defense mechanism to microbial infections. Mutations in this gene have been associated with hemolytic-uremic syndrome (HUS) and chronic hypocomplementemic nephropathy. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Oct 2011].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000177" }, "gene_names": [ { "name": "CFH", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P08603", "id": "P08603" }, { "name": "AHUS1; AMBP1; ARMD4; ARMS1; CFHL3; FH; FHL1; HF; HF1; HF2; HUS", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000177", "id": "NP_000177" }, { "name": "CFH", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000177", "id": "NP_000177" }, { "name": "HF1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P08603", "id": "P08603" }, { "name": "HF2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P08603", "id": "P08603" }, { "name": "HF", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P08603", "id": "P08603" } ], "protein_names": [ { "name": "Complement factor H", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P08603" }, { "name": "H factor 1 (complement); H factor 2 (complement); beta-1H; age-related maculopathy susceptibility 1; beta-1-H-globulin; factor H-like 1; adrenomedullin binding protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000177", "id": "NP_000177" }, { "name": "H factor 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P08603" }, { "name": "complement factor H isoform a precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000177", "id": "NP_000177" } ], "function": [ { "annotation": "(Microbial infection) In the mosquito midgut, binds to the surface of parasite P.falciparum gametocytes and protects the parasite from alternative complement pathway-mediated elimination.", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603#function" }, { "database": "PubMed", "id": "23332154", "url": "https://glygen.org/publication/PubMed/23332154" } ] }, { "annotation": "Complement factor H attenuates TNF-alpha-induced inflammation by upregulating EIF3C in rheumatoid arthritis. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000177", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000177" }, { "database": "PubMed", "id": "37996918", "url": "https://glygen.org/publication/PubMed/37996918" } ] }, { "annotation": "Glycoprotein that plays an essential role in maintaining a well-balanced immune response by modulating complement activation. Acts as a soluble inhibitor of complement, where its binding to self markers such as glycan structures prevents complement activation and amplification on cell surfaces (PubMed:21285368, PubMed:25402769). Accelerates the decay of the complement alternative pathway (AP) C3 convertase C3bBb, thus preventing local formation of more C3b, the central player of the complement amplification loop (PubMed:19503104, PubMed:26700768). As a cofactor of the serine protease factor I, CFH also regulates proteolytic degradation of already-deposited C3b (PubMed:23332154, PubMed:18252712, PubMed:28671664). In addition, mediates several cellular responses through interaction with specific receptors. For example, interacts with CR3/ITGAM receptor and thereby mediates the adhesion of human neutrophils to different pathogens. In turn, these pathogens are phagocytosed and destroyed (PubMed:9558116, PubMed:20008295).", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603#function" }, { "database": "PubMed", "id": "23332154", "url": "https://glygen.org/publication/PubMed/23332154" }, { "database": "PubMed", "id": "26700768", "url": "https://glygen.org/publication/PubMed/26700768" }, { "database": "PubMed", "id": "21285368", "url": "https://glygen.org/publication/PubMed/21285368" }, { "database": "PubMed", "id": "9558116", "url": "https://glygen.org/publication/PubMed/9558116" }, { "database": "PubMed", "id": "19503104", "url": "https://glygen.org/publication/PubMed/19503104" }, { "database": "PubMed", "id": "28671664", "url": "https://glygen.org/publication/PubMed/28671664" }, { "database": "PubMed", "id": "20008295", "url": "https://glygen.org/publication/PubMed/20008295" }, { "database": "PubMed", "id": "25402769", "url": "https://glygen.org/publication/PubMed/25402769" }, { "database": "PubMed", "id": "18252712", "url": "https://glygen.org/publication/PubMed/18252712" } ] }, { "annotation": "Identification of complement factor H variants that predispose to pre-eclampsia: A genetic and functional study.", "evidence": [ { "database": "RefSeq", "id": "NP_000177", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000177" }, { "database": "PubMed", "id": "37156755", "url": "https://glygen.org/publication/PubMed/37156755" } ] }, { "annotation": "Mesangial C3 Deposition, Complement-Associated Variant, and Disease Progression in IgA Nephropathy.", "evidence": [ { "database": "RefSeq", "id": "NP_000177", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000177" }, { "database": "PubMed", "id": "37651123", "url": "https://glygen.org/publication/PubMed/37651123" } ] }, { "annotation": "This gene is a member of the Regulator of Complement Activation (RCA) gene cluster and encodes a protein with twenty short consensus repeat (SCR) domains. This protein is secreted into the bloodstream and has an essential role in the regulation of complement activation, restricting this innate defense mechanism to microbial infections. Mutations in this gene have been associated with hemolytic-uremic syndrome (HUS) and chronic hypocomplementemic nephropathy. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Oct 2011].", "evidence": [ { "database": "RefSeq", "id": "NP_000177", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000177" } ] } ], "disease": [ { "disease_id": "DOID:0060746", "recommended_name": { "id": "DOID:0060746", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060746", "name": "basal laminar drusen", "description": "A retinal drusen characterized by yellow-white deposits (drusen) that accumulate beneath the retinal pigment epithelium on Bruch membrane and that has_material_basis_in mutations in the CFH gene on chromosome 1q31.3." }, "synonyms": [ { "id": "DOID:0060746", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060746", "name": "cuticular drusen", "description": "" }, { "id": "DOID:0060746", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060746", "name": "drusen of bruch membrane", "description": "" }, { "id": "DOID:0060746", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060746", "name": "early adult-onset grouped drusen", "description": "" }, { "id": "MONDO:0007472", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007472", "name": "basal laminar drusen", "description": "A retinal drusen characterized by yellow-white deposits (drusen) that accumulate beneath the retinal pigment epithelium on Bruch membrane and that has material basis in mutations in the CFH gene on chromosome 1q31.3." }, { "id": "MONDO:0007472", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007472", "name": "basal laminar drusen", "description": "" }, { "id": "MONDO:0007472", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007472", "name": "cuticular drusen", "description": "" }, { "id": "MONDO:0007472", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007472", "name": "drusen of Bruch membrane", "description": "" }, { "id": "MONDO:0007472", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007472", "name": "early adult-onset grouped drusen", "description": "" }, { "id": "MONDO:0007472", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007472", "name": "drusen, cuticular", "description": "" }, { "id": "MONDO:0007472", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007472", "name": "drusen, early adult-onset, grouped", "description": "" }, { "id": "MIM:126700", "resource": "MIM", "url": "https://www.omim.org/entry/126700", "name": "Basal laminar drusen", "description": "Basal laminar drusen" } ], "evidence": [ { "id": "126700", "database": "MIM", "url": "https://www.omim.org/entry/126700" } ] }, { "disease_id": "DOID:0110017", "recommended_name": { "id": "DOID:0110017", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110017", "name": "age related macular degeneration 4", "description": "An age related macular degeneration conferred by variation in the CFH gene on chromosome 1q31." }, "synonyms": [ { "id": "DOID:0110017", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110017", "name": "ARMD4", "description": "" }, { "id": "MONDO:0012540", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012540", "name": "age related macular degeneration 4", "description": "Any age-related macular degeneration in which the cause of the disease is a mutation in the CFH gene." }, { "id": "MONDO:0012540", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012540", "name": "ARMD4", "description": "" }, { "id": "MONDO:0012540", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012540", "name": "CFH age-related macular degeneration", "description": "" }, { "id": "MONDO:0012540", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012540", "name": "age related macular degeneration type 4", "description": "" }, { "id": "MONDO:0012540", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012540", "name": "age-related macular degeneration caused by mutation in CFH", "description": "" }, { "id": "MONDO:0012540", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012540", "name": "macular Degeneration, age-related, type 4", "description": "" }, { "id": "MONDO:0012540", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012540", "name": "macular degeneration, age-related, 4", "description": "" }, { "id": "MIM:610698", "resource": "MIM", "url": "https://www.omim.org/entry/610698", "name": "Macular degeneration, age-related, 4", "description": "Macular degeneration, age-related, 4" } ], "evidence": [ { "id": "610698", "database": "MIM", "url": "https://www.omim.org/entry/610698" } ] }, { "disease_id": "MONDO:0009335", "recommended_name": { "id": "MONDO:0009335", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009335", "name": "hemolytic uremic syndrome, atypical, susceptibility to, 1", "description": "" }, "synonyms": [ { "id": "MONDO:0009335", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009335", "name": "hemolytic uremic syndrome, atypical, susceptibility to", "description": "" }, { "id": "MONDO:0009335", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009335", "name": "hemolytic uremic syndrome, atypical, susceptibility to, 1", "description": "" }, { "id": "MONDO:0009335", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009335", "name": "hemolytic uremic syndrome, atypical, susceptibility to, type 1", "description": "" }, { "id": "MONDO:0009335", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009335", "name": "AHUS1", "description": "" }, { "id": "MONDO:0009335", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009335", "name": "Ahus, susceptibility to, 1", "description": "" }, { "id": "MONDO:0009335", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009335", "name": "hemolytic uremic syndrome, typical", "description": "" }, { "id": "MONDO:0009335", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009335", "name": "susceptibility to atypical hemolytic uremic syndrome 1", "description": "" }, { "id": "MIM:235400", "resource": "MIM", "url": "https://www.omim.org/entry/235400", "name": "Hemolytic uremic syndrome atypical 1", "description": "Hemolytic uremic syndrome atypical 1" } ], "evidence": [ { "id": "235400", "database": "MIM", "url": "https://www.omim.org/entry/235400" } ] }, { "disease_id": "MONDO:0012350", "recommended_name": { "id": "MONDO:0012350", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012350", "name": "complement factor H deficiency", "description": "" }, "synonyms": [ { "id": "MONDO:0012350", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012350", "name": "complement factor H deficiency", "description": "" }, { "id": "MONDO:0012350", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012350", "name": "CFHD", "description": "" }, { "id": "MONDO:0012350", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012350", "name": "Cfh deficiency", "description": "" }, { "id": "MONDO:0012350", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012350", "name": "factor H deficiency", "description": "" }, { "id": "MIM:609814", "resource": "MIM", "url": "https://www.omim.org/entry/609814", "name": "Complement factor H deficiency", "description": "Complement factor H deficiency" } ], "evidence": [ { "id": "609814", "database": "MIM", "url": "https://www.omim.org/entry/609814" } ] } ], "snv": [ { "evidence": [ { "id": "rs779431195", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779431195" }, { "id": "rs779431195", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779431195" }, { "id": "rs779431195", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs779431195" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 1031, "end_pos": 1031, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->NVA).", "chr_id": "1", "chr_pos": "196742009", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1031", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1283447296", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1283447296" }, { "id": "rs1283447296", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1283447296#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 1031, "end_pos": 1031, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->NVK).", "chr_id": "1", "chr_pos": "196742010", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1031", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs377051240", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs377051240" }, { "id": "rs377051240", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs377051240" }, { "id": "rs377051240", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs377051240#frequency_tab" }, { "id": "rs377051240", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs377051240" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 1031, "end_pos": 1031, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->NVR).", "chr_id": "1", "chr_pos": "196742031", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1031", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1160757371", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1160757371" }, { "id": "rs1160757371", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1160757371" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1036, "end_pos": 1036, "sequence_org": "R", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSR->NST).", "chr_id": "1", "chr_pos": "196742025", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "R1036", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs932614951", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs932614951" }, { "id": "rs932614951", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs932614951#frequency_tab" }, { "id": "rs932614951", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs932614951" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1045, "end_pos": 1045, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DTS->NTS).", "chr_id": "1", "chr_pos": "196743628", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D1045", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1553281990", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1553281990" }, { "id": "rs1553281990", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1553281990" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 1095, "end_pos": 1095, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->KWT).", "chr_id": "1", "chr_pos": "196743603", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N1095", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs768970275", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768970275" }, { "id": "rs768970275", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768970275" }, { "id": "rs768970275", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768970275" }, { "id": "23619168", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23619168" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 1097, "end_pos": 1097, "sequence_org": "T", "sequence_mut": "M", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->NWM).", "chr_id": "1", "chr_pos": "196743608", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1097", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs932614951", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs932614951" }, { "id": "rs932614951", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs932614951#frequency_tab" }, { "id": "rs932614951", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs932614951" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1104, "end_pos": 1104, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DST->NST).", "chr_id": "1", "chr_pos": "196743628", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D1104", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs371642012", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371642012" }, { "id": "rs371642012", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371642012#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 217, "end_pos": 217, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->DGS).", "chr_id": "1", "chr_pos": "196679652", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N217", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs371642012", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371642012" }, { "id": "rs371642012", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371642012#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 217, "end_pos": 217, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->HGS).", "chr_id": "1", "chr_pos": "196679652", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N217", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs775249868", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775249868" }, { "id": "rs775249868", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775249868" }, { "id": "rs775249868", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775249868" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 232, "end_pos": 232, "sequence_org": "R", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NER->NES).", "chr_id": "1", "chr_pos": "196685158", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "R232", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1212645085", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1212645085" }, { "id": "rs1212645085", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1212645085" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 240, "end_pos": 240, "sequence_org": "G", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NMG->NMS).", "chr_id": "1", "chr_pos": "196737588", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "G240", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs937069796", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs937069796" }, { "id": "rs937069796", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs937069796" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 307, "end_pos": 307, "sequence_org": "A", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NTA->NTS).", "chr_id": "1", "chr_pos": "196740747", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A307", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1411081273", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1411081273" }, { "id": "rs1411081273", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1411081273" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 307, "end_pos": 307, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NTA->NTT).", "chr_id": "1", "chr_pos": "196685192", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A307", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs777630835", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777630835" }, { "id": "rs777630835", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777630835" }, { "id": "rs777630835", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs777630835" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 308, "end_pos": 308, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KCT->NCT).", "chr_id": "1", "chr_pos": "196685197", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K308", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1180008280", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1180008280" }, { "id": "rs1180008280", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1180008280#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 39, "end_pos": 39, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DQT->NQT).", "chr_id": "1", "chr_pos": "196673034", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D39", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs749403509", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749403509" }, { "id": "rs749403509", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749403509" }, { "id": "rs749403509", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749403509" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 518, "end_pos": 518, "sequence_org": "R", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NAR->NAT).", "chr_id": "1", "chr_pos": "196747162", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "R518", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs747757010", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747757010" }, { "id": "rs747757010", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747757010" }, { "id": "rs747757010", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747757010" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 531, "end_pos": 531, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->NDA).", "chr_id": "1", "chr_pos": "196715664", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T531", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1167670646", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1167670646" }, { "id": "rs1167670646", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1167670646" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 542, "end_pos": 542, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SNT->NNT).", "chr_id": "1", "chr_pos": "196715698", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S542", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1353831577", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1353831577" }, { "id": "rs1353831577", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1353831577#frequency_tab" }, { "id": "rs1353831577", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1353831577" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 671, "end_pos": 671, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NKI->NKT).", "chr_id": "1", "chr_pos": "196726905", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I671", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs140984162", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs140984162" }, { "id": "rs140984162", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs140984162" }, { "id": "rs140984162", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs140984162#frequency_tab" }, { "id": "rs140984162", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs140984162" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 718, "end_pos": 718, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "1", "chr_pos": "196726857", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N718", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs774287069", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774287069" }, { "id": "rs774287069", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774287069" }, { "id": "rs774287069", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs774287069" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 776, "end_pos": 776, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSN->NSS).", "chr_id": "1", "chr_pos": "196728436", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N776", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs767471170", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767471170" }, { "id": "rs767471170", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767471170" }, { "id": "rs767471170", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs767471170#frequency_tab" }, { "id": "rs767471170", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767471170" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 778, "end_pos": 778, "sequence_org": "R", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NIR->NIT).", "chr_id": "1", "chr_pos": "196728442", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "R778", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs374526857", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374526857" }, { "id": "rs374526857", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374526857" }, { "id": "rs374526857", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs374526857#frequency_tab" }, { "id": "rs374526857", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs374526857" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 802, "end_pos": 802, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "1", "chr_pos": "196728514", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N802", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs770185390", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770185390" }, { "id": "rs770185390", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770185390" }, { "id": "rs770185390", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770185390" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 822, "end_pos": 822, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMT->IMT).", "chr_id": "1", "chr_pos": "196736875", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N822", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs770185390", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770185390" }, { "id": "rs770185390", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770185390" }, { "id": "rs770185390", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770185390" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 822, "end_pos": 822, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMT->SMT).", "chr_id": "1", "chr_pos": "196736875", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N822", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs894673509", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs894673509" }, { "id": "rs894673509", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs894673509#frequency_tab" }, { "id": "rs894673509", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs894673509" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 824, "end_pos": 824, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMT->NMK).", "chr_id": "1", "chr_pos": "196736881", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T824", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1379860048", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1379860048" }, { "id": "rs1379860048", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1379860048" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 834, "end_pos": 834, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KVS->NVS).", "chr_id": "1", "chr_pos": "196736912", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K834", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs114743644", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs114743644" }, { "id": "rs114743644", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs114743644" }, { "id": "rs114743644", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs114743644" }, { "id": "rs114743644", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs114743644#frequency_tab" }, { "id": "rs114743644", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs114743644" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 884, "end_pos": 884, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->NSF).", "chr_id": "1", "chr_pos": "196737529", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.000799", "site_lbl": "S884", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs763377571", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763377571" }, { "id": "rs763377571", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763377571" }, { "id": "rs763377571", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs763377571#frequency_tab" }, { "id": "rs763377571", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763377571" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 884, "end_pos": 884, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->NSP).", "chr_id": "1", "chr_pos": "196737528", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S884", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs114743644", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs114743644" }, { "id": "rs114743644", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs114743644" }, { "id": "rs114743644", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs114743644" }, { "id": "rs114743644", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs114743644#frequency_tab" }, { "id": "rs114743644", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs114743644" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 884, "end_pos": 884, "sequence_org": "S", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->NSY).", "chr_id": "1", "chr_pos": "196737529", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.000799", "site_lbl": "S884", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1316683858", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1316683858" }, { "id": "rs1316683858", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1316683858" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 893, "end_pos": 893, "sequence_org": "H", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (HGT->NGT).", "chr_id": "1", "chr_pos": "196737555", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "H893", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1361345512", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1361345512" }, { "id": "rs1361345512", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1361345512" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 898, "end_pos": 898, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SYT->NYT).", "chr_id": "1", "chr_pos": "196737571", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S898", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1240893783", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1240893783" }, { "id": "rs1240893783", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1240893783" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 911, "end_pos": 911, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "1", "chr_pos": "196737610", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N911", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 1182, "end_pos": 1182, "sequence_org": "R", "sequence_mut": "A", "comment": "About 50% loss of C3b binding.", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" }, { "database": "PubMed", "id": "16601698", "url": "https://glygen.org/publication/PubMed/16601698" } ] }, { "start_pos": 1183, "end_pos": 1183, "sequence_org": "W", "sequence_mut": "L", "comment": "About 40% loss of C3b binding.", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" }, { "database": "PubMed", "id": "16601698", "url": "https://glygen.org/publication/PubMed/16601698" } ] }, { "start_pos": 1186, "end_pos": 1186, "sequence_org": "K", "sequence_mut": "A", "comment": "About 20% loss of C3b binding.", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" }, { "database": "PubMed", "id": "16601698", "url": "https://glygen.org/publication/PubMed/16601698" } ] }, { "start_pos": 1188, "end_pos": 1188, "sequence_org": "K", "sequence_mut": "A", "comment": "About 50% loss of C3b binding.", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" }, { "database": "PubMed", "id": "16601698", "url": "https://glygen.org/publication/PubMed/16601698" } ] }, { "start_pos": 1198, "end_pos": 1198, "sequence_org": "E", "sequence_mut": "A", "comment": "About 30% loss of C3b binding.", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" }, { "database": "PubMed", "id": "16601698", "url": "https://glygen.org/publication/PubMed/16601698" } ] }, { "start_pos": 337, "end_pos": 337, "sequence_org": "H", "sequence_mut": "A", "comment": "About 10% loss of heparin-binding.", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" }, { "database": "PubMed", "id": "17893204", "url": "https://glygen.org/publication/PubMed/17893204" } ] }, { "start_pos": 341, "end_pos": 341, "sequence_org": "R", "sequence_mut": "A", "comment": "About 20% loss of heparin-binding.", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" }, { "database": "PubMed", "id": "17893204", "url": "https://glygen.org/publication/PubMed/17893204" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "75.16", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000000971", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000000971" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "91.44", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000000971", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000000971" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "89.02", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000000971", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000000971" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "58.11", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000000971", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000000971" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "98.01", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000000971", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000000971" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "97.46", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000000971", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000000971" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "71.12", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000000971", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000000971" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "97.1", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000000971", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000000971" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "96.55", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000000971", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000000971" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "83.38", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000000971", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000000971" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "99.63", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000000971", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000000971" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "85.99", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000000971", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000000971" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "90.91", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000000971", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000000971" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P08603", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08603" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P08603", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08603" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P08603", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08603" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P08603", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08603" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P08603", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08603" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P08603", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08603" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P08603", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08603" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P08603", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08603" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P08603", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08603" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P08603", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08603" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P08603", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08603" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P08603", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08603" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "common_name": "Human" } ], "gene": [ { "name": "CFH", "url": "https://www.uniprot.org/uniprot/P08603", "locus": { "chromosome": "1", "start_pos": 100494, "end_pos": 4868, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "LRG_47", "url": "https://www.ensembl.org/id/LRG_47" } ] } } ], "crossref": [ { "id": "ENSG00000000971", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000000971", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00033", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00033", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL4629", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4629", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "CFH", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CFH", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "3075", "url": "https://www.ncbi.nlm.nih.gov/gene/3075", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "722", "url": "https://glyconnect.expasy.org/browser/proteins/722", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "4883", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4883", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P08603", "url": "https://www.ebi.ac.uk/intact/interactors/id:P08603*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000436", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000436", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035976", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035976", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:3075", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3075", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "126700", "url": "http://www.omim.org/entry/126700", "database": "MIM", "categories": [ "Other" ] }, { "id": "134370", "url": "http://www.omim.org/entry/134370", "database": "MIM", "categories": [ "Other" ] }, { "id": "235400", "url": "http://www.omim.org/entry/235400", "database": "MIM", "categories": [ "Other" ] }, { "id": "609814", "url": "http://www.omim.org/entry/609814", "database": "MIM", "categories": [ "Other" ] }, { "id": "610698", "url": "http://www.omim.org/entry/610698", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P08603", "url": "https://www.nextprot.org/entry/NX_P08603", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "5346812at2759", "url": "http://www.orthodb.org/?query=5346812at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR19325", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19325", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR19325:SF563", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19325:SF563", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45785", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45785", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45785:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45785:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45785:SF4", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45785:SF4", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45785:SF7", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45785:SF7", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1HAQ", "url": "https://www.rcsb.org/structure/1HAQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1HCC", "url": "https://www.rcsb.org/structure/1HCC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1HFH", "url": "https://www.rcsb.org/structure/1HFH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1HFI", "url": "https://www.rcsb.org/structure/1HFI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2BZM", "url": "https://www.rcsb.org/structure/2BZM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2G7I", "url": "https://www.rcsb.org/structure/2G7I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2IC4", "url": "https://www.rcsb.org/structure/2IC4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2JGW", "url": "https://www.rcsb.org/structure/2JGW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2JGX", "url": "https://www.rcsb.org/structure/2JGX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2KMS", "url": "https://www.rcsb.org/structure/2KMS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2QFG", "url": "https://www.rcsb.org/structure/2QFG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2QFH", "url": "https://www.rcsb.org/structure/2QFH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2RLP", "url": "https://www.rcsb.org/structure/2RLP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2RLQ", "url": "https://www.rcsb.org/structure/2RLQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2UWN", "url": "https://www.rcsb.org/structure/2UWN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2V8E", "url": "https://www.rcsb.org/structure/2V8E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2W80", "url": "https://www.rcsb.org/structure/2W80", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2W81", "url": "https://www.rcsb.org/structure/2W81", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2WII", "url": "https://www.rcsb.org/structure/2WII", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2XQW", "url": "https://www.rcsb.org/structure/2XQW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3GAU", "url": "https://www.rcsb.org/structure/3GAU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3GAV", "url": "https://www.rcsb.org/structure/3GAV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3GAW", "url": "https://www.rcsb.org/structure/3GAW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KXV", "url": "https://www.rcsb.org/structure/3KXV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KZJ", "url": "https://www.rcsb.org/structure/3KZJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3OXU", "url": "https://www.rcsb.org/structure/3OXU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3R62", "url": "https://www.rcsb.org/structure/3R62", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3RJ3", "url": "https://www.rcsb.org/structure/3RJ3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SW0", "url": "https://www.rcsb.org/structure/3SW0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4AYD", "url": "https://www.rcsb.org/structure/4AYD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4AYE", "url": "https://www.rcsb.org/structure/4AYE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4AYI", "url": "https://www.rcsb.org/structure/4AYI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4AYM", "url": "https://www.rcsb.org/structure/4AYM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4B2R", "url": "https://www.rcsb.org/structure/4B2R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4B2S", "url": "https://www.rcsb.org/structure/4B2S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4J38", "url": "https://www.rcsb.org/structure/4J38", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4K12", "url": "https://www.rcsb.org/structure/4K12", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4ONT", "url": "https://www.rcsb.org/structure/4ONT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4ZH1", "url": "https://www.rcsb.org/structure/4ZH1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5NBQ", "url": "https://www.rcsb.org/structure/5NBQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5O32", "url": "https://www.rcsb.org/structure/5O32", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5O35", "url": "https://www.rcsb.org/structure/5O35", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5WTB", "url": "https://www.rcsb.org/structure/5WTB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ATG", "url": "https://www.rcsb.org/structure/6ATG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ZH1", "url": "https://www.rcsb.org/structure/6ZH1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7WKI", "url": "https://www.rcsb.org/structure/7WKI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7ZJM", "url": "https://www.rcsb.org/structure/7ZJM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00084", "url": "http://pfam.xfam.org/family/PF00084", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P08603", "url": "https://pharos.nih.gov/targets/P08603", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000054493", "url": "https://proconsortium.org/app/entry/PR:000054493", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054494", "url": "https://proconsortium.org/app/entry/PR:000054494", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054495", "url": "https://proconsortium.org/app/entry/PR:000054495", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054496", "url": "https://proconsortium.org/app/entry/PR:000054496", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054497", "url": "https://proconsortium.org/app/entry/PR:000054497", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054498", "url": "https://proconsortium.org/app/entry/PR:000054498", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054499", "url": "https://proconsortium.org/app/entry/PR:000054499", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054500", "url": "https://proconsortium.org/app/entry/PR:000054500", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054501", "url": "https://proconsortium.org/app/entry/PR:000054501", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054502", "url": "https://proconsortium.org/app/entry/PR:000054502", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054503", "url": "https://proconsortium.org/app/entry/PR:000054503", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054504", "url": "https://proconsortium.org/app/entry/PR:000054504", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054505", "url": "https://proconsortium.org/app/entry/PR:000054505", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054506", "url": "https://proconsortium.org/app/entry/PR:000054506", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054507", "url": "https://proconsortium.org/app/entry/PR:000054507", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054508", "url": "https://proconsortium.org/app/entry/PR:000054508", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054509", "url": "https://proconsortium.org/app/entry/PR:000054509", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054510", "url": "https://proconsortium.org/app/entry/PR:000054510", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054511", "url": "https://proconsortium.org/app/entry/PR:000054511", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054512", "url": "https://proconsortium.org/app/entry/PR:000054512", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054513", "url": "https://proconsortium.org/app/entry/PR:000054513", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054514", "url": "https://proconsortium.org/app/entry/PR:000054514", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054515", "url": "https://proconsortium.org/app/entry/PR:000054515", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054516", "url": "https://proconsortium.org/app/entry/PR:000054516", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054517", "url": "https://proconsortium.org/app/entry/PR:000054517", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054518", "url": "https://proconsortium.org/app/entry/PR:000054518", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054519", "url": "https://proconsortium.org/app/entry/PR:000054519", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054520", "url": "https://proconsortium.org/app/entry/PR:000054520", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054521", "url": "https://proconsortium.org/app/entry/PR:000054521", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054522", "url": "https://proconsortium.org/app/entry/PR:000054522", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054523", "url": "https://proconsortium.org/app/entry/PR:000054523", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054524", "url": "https://proconsortium.org/app/entry/PR:000054524", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054525", "url": "https://proconsortium.org/app/entry/PR:000054525", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054526", "url": "https://proconsortium.org/app/entry/PR:000054526", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054527", "url": "https://proconsortium.org/app/entry/PR:000054527", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054528", "url": "https://proconsortium.org/app/entry/PR:000054528", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054529", "url": "https://proconsortium.org/app/entry/PR:000054529", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054530", "url": "https://proconsortium.org/app/entry/PR:000054530", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054531", "url": "https://proconsortium.org/app/entry/PR:000054531", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054532", "url": "https://proconsortium.org/app/entry/PR:000054532", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054533", "url": "https://proconsortium.org/app/entry/PR:000054533", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054534", "url": "https://proconsortium.org/app/entry/PR:000054534", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054535", "url": "https://proconsortium.org/app/entry/PR:000054535", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054536", "url": "https://proconsortium.org/app/entry/PR:000054536", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054537", "url": "https://proconsortium.org/app/entry/PR:000054537", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054538", "url": "https://proconsortium.org/app/entry/PR:000054538", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054539", "url": "https://proconsortium.org/app/entry/PR:000054539", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054540", "url": "https://proconsortium.org/app/entry/PR:000054540", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054541", "url": "https://proconsortium.org/app/entry/PR:000054541", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054542", "url": "https://proconsortium.org/app/entry/PR:000054542", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054543", "url": "https://proconsortium.org/app/entry/PR:000054543", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054544", "url": "https://proconsortium.org/app/entry/PR:000054544", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054545", "url": "https://proconsortium.org/app/entry/PR:000054545", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054546", "url": "https://proconsortium.org/app/entry/PR:000054546", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054547", "url": "https://proconsortium.org/app/entry/PR:000054547", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P08603", "url": "http://purl.obolibrary.org/obo/PR_P08603", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000177", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000177", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P08603", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "A0A0D9SG88", "url": "https://www.uniprot.org/uniprot/A0A0D9SG88", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0D9SG88-1", "url": "https://www.uniprot.org/uniprot/A0A0D9SG88-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SI55", "url": "https://www.uniprot.org/uniprot/A0A8Q3SI55", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SI55-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3SI55-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SI73", "url": "https://www.uniprot.org/uniprot/A0A8Q3SI73", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SI73-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3SI73-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SI76", "url": "https://www.uniprot.org/uniprot/A0A8Q3SI76", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SI76-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3SI76-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SI78", "url": "https://www.uniprot.org/uniprot/A0A8Q3SI78", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SI78-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3SI78-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SI99", "url": "https://www.uniprot.org/uniprot/A0A8Q3SI99", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SI99-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3SI99-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SIB6", "url": "https://www.uniprot.org/uniprot/A0A8Q3SIB6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SIB6-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3SIB6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SIC3", "url": "https://www.uniprot.org/uniprot/A0A8Q3SIC3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SIC3-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3SIC3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SID7", "url": "https://www.uniprot.org/uniprot/A0A8Q3SID7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SID7-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3SID7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SID8", "url": "https://www.uniprot.org/uniprot/A0A8Q3SID8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SID8-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3SID8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SIE0", "url": "https://www.uniprot.org/uniprot/A0A8Q3SIE0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SIE0-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3SIE0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SIE8", "url": "https://www.uniprot.org/uniprot/A0A8Q3SIE8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SIE8-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3SIE8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SJ41", "url": "https://www.uniprot.org/uniprot/A0A8Q3SJ41", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SJ41-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3SJ41-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3WKW2", "url": "https://www.uniprot.org/uniprot/A0A8Q3WKW2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3WKW2-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3WKW2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3WKW3", "url": "https://www.uniprot.org/uniprot/A0A8Q3WKW3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3WKW3-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3WKW3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3WKW6", "url": "https://www.uniprot.org/uniprot/A0A8Q3WKW6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3WKW6-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3WKW6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3WKW7", "url": "https://www.uniprot.org/uniprot/A0A8Q3WKW7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3WKW7-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3WKW7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3WKX0", "url": "https://www.uniprot.org/uniprot/A0A8Q3WKX0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3WKX0-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3WKX0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3WKX4", "url": "https://www.uniprot.org/uniprot/A0A8Q3WKX4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3WKX4-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3WKX4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3WL05", "url": "https://www.uniprot.org/uniprot/A0A8Q3WL05", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3WL05-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3WL05-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3WLF7", "url": "https://www.uniprot.org/uniprot/A0A8Q3WLF7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3WLF7-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3WLF7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3WLY2", "url": "https://www.uniprot.org/uniprot/A0A8Q3WLY2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3WLY2-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3WLY2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3WM65", "url": "https://www.uniprot.org/uniprot/A0A8Q3WM65", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3WM65-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3WM65-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3WM71", "url": "https://www.uniprot.org/uniprot/A0A8Q3WM71", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3WM71-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3WM71-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P08603-1", "url": "https://www.uniprot.org/uniprot/P08603-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P08603-2", "url": "https://www.uniprot.org/uniprot/P08603-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5TFM2", "url": "https://www.uniprot.org/uniprot/Q5TFM2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5TFM2-1", "url": "https://www.uniprot.org/uniprot/Q5TFM2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR", "length": 1231, "header": "sp|P08603-1|CFAH_HUMAN Isoform 1 of Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=1 SV=4 CANONICAL=P08603-1" }, "isoforms": [ { "isoform_ac": "A0A0D9SG88-1", "url": "", "sequence": { "sequence": "MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSFTL", "length": 449, "header": "tr|A0A0D9SG88-1|A0A0D9SG88_HUMAN Computationally mapped isoform of Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=1 SV=1 CANONICAL=P08603-1" }, "locus": { "chromosome": "1", "start_pos": 196701328, "end_pos": 196652118, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000630130.2", "url": "https://www.ensembl.org/id/ENST00000630130.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000487250.1", "url": "https://www.ensembl.org/id/ENSP00000487250.1" } ] } }, { "isoform_ac": "A0A8Q3SI55-1", "url": "", "sequence": { "sequence": "MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQIVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSFTL", "length": 388, "header": "tr|A0A8Q3SI55-1|A0A8Q3SI55_HUMAN Computationally mapped isoform of Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=4 SV=1 CANONICAL=P08603-1" }, "locus": { "chromosome": "1", "start_pos": 196701328, "end_pos": 196652118, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000695968.1", "url": "https://www.ensembl.org/id/ENST00000695968.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512295.1", "url": "https://www.ensembl.org/id/ENSP00000512295.1" } ] } }, { "isoform_ac": "A0A8Q3SI73-1", "url": "", "sequence": { "sequence": "MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVD", "length": 207, "header": "tr|A0A8Q3SI73-1|CFAH_HUMAN Computationally mapped isoform of Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=1 SV=1 CANONICAL=P08603-1" }, "locus": { "chromosome": "1", "start_pos": 196678946, "end_pos": 196652118, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000696031.1", "url": "https://www.ensembl.org/id/ENST00000696031.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512340.1", "url": "https://www.ensembl.org/id/ENSP00000512340.1" } ] } }, { "isoform_ac": "A0A8Q3SI76-1", "url": "", "sequence": { "sequence": "MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSFTL", "length": 424, "header": "tr|A0A8Q3SI76-1|A0A8Q3SI76_HUMAN Computationally mapped isoform of Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=4 SV=1 CANONICAL=P08603-1" }, "locus": { "chromosome": "1", "start_pos": 196701328, "end_pos": 196652118, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000696030.1", "url": "https://www.ensembl.org/id/ENST00000696030.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512339.1", "url": "https://www.ensembl.org/id/ENSP00000512339.1" } ] } }, { "isoform_ac": "A0A8Q3SI78-1", "url": "", "sequence": { "sequence": "MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEG", "length": 928, "header": "tr|A0A8Q3SI78-1|A0A8Q3SI78_HUMAN Computationally mapped isoform of Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=1 SV=1 CANONICAL=P08603-1" }, "locus": { "chromosome": "1", "start_pos": 196737662, "end_pos": 196652118, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000695969.1", "url": "https://www.ensembl.org/id/ENST00000695969.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512296.1", "url": "https://www.ensembl.org/id/ENSP00000512296.1" } ] } }, { "isoform_ac": "A0A8Q3SI99-1", "url": "", "sequence": { "sequence": "MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCVDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR", "length": 1229, "header": "tr|A0A8Q3SI99-1|A0A8Q3SI99_HUMAN Computationally mapped isoform of Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=1 SV=1 CANONICAL=P08603-1" }, "locus": { "chromosome": "1", "start_pos": 196747310, "end_pos": 196652118, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000696027.1", "url": "https://www.ensembl.org/id/ENST00000696027.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512336.1", "url": "https://www.ensembl.org/id/ENSP00000512336.1" } ] } }, { "isoform_ac": "A0A8Q3SIB6-1", "url": "", "sequence": { "sequence": "MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEETDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR", "length": 1173, "header": "tr|A0A8Q3SIB6-1|A0A8Q3SIB6_HUMAN Computationally mapped isoform of Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=1 SV=1 CANONICAL=P08603-1" }, "locus": { "chromosome": "1", "start_pos": 196747310, "end_pos": 196652118, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000695970.1", "url": "https://www.ensembl.org/id/ENST00000695970.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512297.1", "url": "https://www.ensembl.org/id/ENSP00000512297.1" } ] } }, { "isoform_ac": "A0A8Q3SIC3-1", "url": "", "sequence": { "sequence": "MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEETDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR", "length": 1207, "header": "tr|A0A8Q3SIC3-1|A0A8Q3SIC3_HUMAN Computationally mapped isoform of Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=1 SV=1 CANONICAL=P08603-1" }, "locus": { "chromosome": "1", "start_pos": 196747310, "end_pos": 196652118, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000696028.1", "url": "https://www.ensembl.org/id/ENST00000696028.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512337.1", "url": "https://www.ensembl.org/id/ENSP00000512337.1" } ] } }, { "isoform_ac": "A0A8Q3SID7-1", "url": "", "sequence": { "sequence": "MVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSFTL", "length": 386, "header": "tr|A0A8Q3SID7-1|A0A8Q3SID7_HUMAN Computationally mapped isoform of Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=4 SV=1 CANONICAL=P08603-1" }, "locus": { "chromosome": "1", "start_pos": 196701328, "end_pos": 196673109, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000695987.1", "url": "https://www.ensembl.org/id/ENST00000695987.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512312.1", "url": "https://www.ensembl.org/id/ENSP00000512312.1" } ] } }, { "isoform_ac": "A0A8Q3SID8-1", "url": "", "sequence": { "sequence": "MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCINCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR", "length": 1229, "header": "tr|A0A8Q3SID8-1|A0A8Q3SID8_HUMAN Computationally mapped isoform of Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=1 SV=1 CANONICAL=P08603-1" }, "locus": { "chromosome": "1", "start_pos": 196747310, "end_pos": 196652118, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000696029.1", "url": "https://www.ensembl.org/id/ENST00000696029.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512338.1", "url": "https://www.ensembl.org/id/ENSP00000512338.1" } ] } }, { "isoform_ac": "A0A8Q3SIE0-1", "url": "", "sequence": { "sequence": "MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTYIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR", "length": 1224, "header": "tr|A0A8Q3SIE0-1|A0A8Q3SIE0_HUMAN Computationally mapped isoform of Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=1 SV=1 CANONICAL=P08603-1" }, "locus": { "chromosome": "1", "start_pos": 196747310, "end_pos": 196652118, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000695971.1", "url": "https://www.ensembl.org/id/ENST00000695971.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512298.1", "url": "https://www.ensembl.org/id/ENSP00000512298.1" } ] } }, { "isoform_ac": "A0A8Q3SIE8-1", "url": "", "sequence": { "sequence": "MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYGKMRTS", "length": 571, "header": "tr|A0A8Q3SIE8-1|A0A8Q3SIE8_HUMAN Computationally mapped isoform of Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=4 SV=1 CANONICAL=P08603-1" }, "locus": { "chromosome": "1", "start_pos": 196725139, "end_pos": 196652118, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000696026.1", "url": "https://www.ensembl.org/id/ENST00000696026.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512335.1", "url": "https://www.ensembl.org/id/ENSP00000512335.1" } ] } }, { "isoform_ac": "A0A8Q3SJ41-1", "url": "", "sequence": { "sequence": "MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCLTCQTVISMEKKLRTNVLKVLELMGLQLQNA", "length": 775, "header": "tr|A0A8Q3SJ41-1|A0A8Q3SJ41_HUMAN Computationally mapped isoform of Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=4 SV=1 CANONICAL=P08603-1" }, "locus": { "chromosome": "1", "start_pos": 196740756, "end_pos": 196652118, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000695972.1", "url": "https://www.ensembl.org/id/ENST00000695972.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512299.1", "url": "https://www.ensembl.org/id/ENSP00000512299.1" } ] } }, { "isoform_ac": "A0A8Q3WKW2-1", "url": "", "sequence": { "sequence": "MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSKAVLTFSTQPCLQQRNHFWSQKKSQALPSELLIEGHPSPA", "length": 486, "header": "tr|A0A8Q3WKW2-1|A0A8Q3WKW2_HUMAN Computationally mapped isoform of Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=4 SV=1 CANONICAL=P08603-1" }, "locus": { "chromosome": "1", "start_pos": 196701362, "end_pos": 196652118, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000695978.1", "url": "https://www.ensembl.org/id/ENST00000695978.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512304.1", "url": "https://www.ensembl.org/id/ENSP00000512304.1" } ] } }, { "isoform_ac": "A0A8Q3WKW3-1", "url": "", "sequence": { "sequence": "MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTELN", "length": 1196, "header": "tr|A0A8Q3WKW3-1|A0A8Q3WKW3_HUMAN Computationally mapped isoform of Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=1 SV=1 CANONICAL=P08603-1" }, "locus": { "chromosome": "1", "start_pos": 196752079, "end_pos": 196652118, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000695981.1", "url": "https://www.ensembl.org/id/ENST00000695981.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512306.1", "url": "https://www.ensembl.org/id/ENSP00000512306.1" } ] } }, { "isoform_ac": "A0A8Q3WKW6-1", "url": "", "sequence": { "sequence": "MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKVFLL", "length": 628, "header": "tr|A0A8Q3WKW6-1|A0A8Q3WKW6_HUMAN Computationally mapped isoform of Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=4 SV=1 CANONICAL=P08603-1" }, "locus": { "chromosome": "1", "start_pos": 196726466, "end_pos": 196652118, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000695975.1", "url": "https://www.ensembl.org/id/ENST00000695975.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512302.1", "url": "https://www.ensembl.org/id/ENSP00000512302.1" } ] } }, { "isoform_ac": "A0A8Q3WKW7-1", "url": "", "sequence": { "sequence": "MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR", "length": 1172, "header": "tr|A0A8Q3WKW7-1|A0A8Q3WKW7_HUMAN Computationally mapped isoform of Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=1 SV=1 CANONICAL=P08603-1" }, "locus": { "chromosome": "1", "start_pos": 196747310, "end_pos": 196652118, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000695974.1", "url": "https://www.ensembl.org/id/ENST00000695974.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512301.1", "url": "https://www.ensembl.org/id/ENSP00000512301.1" } ] } }, { "isoform_ac": "A0A8Q3WKX0-1", "url": "", "sequence": { "sequence": "MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYDGPNAVLLHGYIA", "length": 578, "header": "tr|A0A8Q3WKX0-1|A0A8Q3WKX0_HUMAN Computationally mapped isoform of Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=4 SV=1 CANONICAL=P08603-1" }, "locus": { "chromosome": "1", "start_pos": 196720344, "end_pos": 196652118, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000695973.1", "url": "https://www.ensembl.org/id/ENST00000695973.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512300.1", "url": "https://www.ensembl.org/id/ENSP00000512300.1" } ] } }, { "isoform_ac": "A0A8Q3WKX4-1", "url": "", "sequence": { "sequence": "MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQTIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR", "length": 567, "header": "tr|A0A8Q3WKX4-1|A0A8Q3WKX4_HUMAN Computationally mapped isoform of Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=1 SV=1 CANONICAL=P08603-1" }, "locus": { "chromosome": "1", "start_pos": 196747310, "end_pos": 196652118, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000695984.1", "url": "https://www.ensembl.org/id/ENST00000695984.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512309.1", "url": "https://www.ensembl.org/id/ENSP00000512309.1" } ] } }, { "isoform_ac": "A0A8Q3WL05-1", "url": "", "sequence": { "sequence": "MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTYIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSFTL", "length": 442, "header": "tr|A0A8Q3WL05-1|CFAH_HUMAN Computationally mapped isoform of Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=1 SV=1 CANONICAL=P08603-1" }, "locus": { "chromosome": "1", "start_pos": 196701328, "end_pos": 196652118, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000695979.1", "url": "https://www.ensembl.org/id/ENST00000695979.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512305.1", "url": "https://www.ensembl.org/id/ENSP00000512305.1" } ] } }, { "isoform_ac": "A0A8Q3WLF7-1", "url": "", "sequence": { "sequence": "MVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR", "length": 1168, "header": "tr|A0A8Q3WLF7-1|A0A8Q3WLF7_HUMAN Computationally mapped isoform of Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=1 SV=1 CANONICAL=P08603-1" }, "locus": { "chromosome": "1", "start_pos": 196747310, "end_pos": 196673109, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000695976.1", "url": "https://www.ensembl.org/id/ENST00000695976.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512303.1", "url": "https://www.ensembl.org/id/ENSP00000512303.1" } ] } }, { "isoform_ac": "A0A8Q3WLY2-1", "url": "", "sequence": { "sequence": "MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEKQIVSVYLALKMPYPWERRRMC", "length": 976, "header": "tr|A0A8Q3WLY2-1|A0A8Q3WLY2_HUMAN Computationally mapped isoform of Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=1 SV=1 CANONICAL=P08603-1" }, "locus": { "chromosome": "1", "start_pos": 196741940, "end_pos": 196652118, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000695983.1", "url": "https://www.ensembl.org/id/ENST00000695983.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512308.1", "url": "https://www.ensembl.org/id/ENSP00000512308.1" } ] } }, { "isoform_ac": "A0A8Q3WM65-1", "url": "", "sequence": { "sequence": "MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGNPKVFRKYQNHGGQKYGLRLEERET", "length": 142, "header": "tr|A0A8Q3WM65-1|A0A8Q3WM65_HUMAN Computationally mapped isoform of Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=4 SV=1 CANONICAL=P08603-1" }, "locus": { "chromosome": "1", "start_pos": 196675525, "end_pos": 196652118, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000695986.1", "url": "https://www.ensembl.org/id/ENST00000695986.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512311.1", "url": "https://www.ensembl.org/id/ENSP00000512311.1" } ] } }, { "isoform_ac": "A0A8Q3WM71-1", "url": "", "sequence": { "sequence": "MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSKYTTLKS", "length": 453, "header": "tr|A0A8Q3WM71-1|A0A8Q3WM71_HUMAN Computationally mapped isoform of Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=4 SV=1 CANONICAL=P08603-1" }, "locus": { "chromosome": "1", "start_pos": 196690262, "end_pos": 196652118, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000696023.1", "url": "https://www.ensembl.org/id/ENST00000696023.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512334.1", "url": "https://www.ensembl.org/id/ENSP00000512334.1" } ] } }, { "isoform_ac": "P08603-1", "url": "", "sequence": { "sequence": "MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR", "length": 1231, "header": "sp|P08603-1|CFAH_HUMAN Isoform 1 of Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=1 SV=4 CANONICAL=P08603-1" }, "locus": {} }, { "isoform_ac": "P08603-2", "url": "", "sequence": { "sequence": "MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSFTL", "length": 449, "header": "sp|P08603-2|CFAH_HUMAN Isoform 2 of Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=1 SV=4 CANONICAL=P08603-1" }, "locus": {} }, { "isoform_ac": "Q5TFM2-1", "url": "", "sequence": { "sequence": "MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSFTL", "length": 385, "header": "tr|Q5TFM2-1|Q5TFM2_HUMAN Computationally mapped isoform of Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=1 SV=1 CANONICAL=P08603-1" }, "locus": { "chromosome": "1", "start_pos": 196701328, "end_pos": 196652118, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000359637.3", "url": "https://www.ensembl.org/id/ENST00000359637.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000352658.2", "url": "https://www.ensembl.org/id/ENSP00000352658.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G00875VP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1029, "start_aa": "Asn", "end_pos": 1029, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1029", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1029, "start_aa": "Asn", "end_pos": 1029, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1029", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P08603@N1029", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N1029" } ] }, { "glytoucan_ac": "G04909DG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1029, "start_aa": "Asn", "end_pos": 1029, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1029", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1029, "start_aa": "Asn", "end_pos": 1029, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1029", "evidence": [ { "id": "P08603@N1029", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N1029" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1029, "start_aa": "Asn", "end_pos": 1029, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1029", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1029, "start_aa": "Asn", "end_pos": 1029, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1029", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1029, "start_aa": "Asn", "end_pos": 1029, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1029", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1029, "start_aa": "Asn", "end_pos": 1029, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1029", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1029, "start_aa": "Asn", "end_pos": 1029, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1029", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1029, "start_aa": "Asn", "end_pos": 1029, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1029", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G27126ED", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1029, "start_aa": "Asn", "end_pos": 1029, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1029", "evidence": [ { "id": "P08603@N1029", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N1029" } ] }, { "glytoucan_ac": "G31118FR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1029, "start_aa": "Asn", "end_pos": 1029, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1029", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1029, "start_aa": "Asn", "end_pos": 1029, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1029", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1029, "start_aa": "Asn", "end_pos": 1029, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1029", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" }, { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G47737VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1029, "start_aa": "Asn", "end_pos": 1029, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1029", "evidence": [ { "id": "P08603@N1029", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N1029" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1029, "start_aa": "Asn", "end_pos": 1029, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1029", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1029, "start_aa": "Asn", "end_pos": 1029, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1029", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G51941GC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1029, "start_aa": "Asn", "end_pos": 1029, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1029", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1029, "start_aa": "Asn", "end_pos": 1029, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1029", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P08603@N1029", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N1029" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1029, "start_aa": "Asn", "end_pos": 1029, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1029", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1029, "start_aa": "Asn", "end_pos": 1029, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1029", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1029, "start_aa": "Asn", "end_pos": 1029, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1029", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1029, "start_aa": "Asn", "end_pos": 1029, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1029", "evidence": [ { "id": "P08603@N1029", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N1029" } ] }, { "glytoucan_ac": "G93860XO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1029, "start_aa": "Asn", "end_pos": 1029, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1029", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1029, "start_aa": "Asn", "end_pos": 1029, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1029", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "P08603", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08603#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" }, { "id": "19139490", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1095, "start_aa": "Asn", "end_pos": 1095, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1095", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G04909DG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1095, "start_aa": "Asn", "end_pos": 1095, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1095", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1095, "start_aa": "Asn", "end_pos": 1095, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1095", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1095, "start_aa": "Asn", "end_pos": 1095, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1095", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1095, "start_aa": "Asn", "end_pos": 1095, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1095", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1095, "start_aa": "Asn", "end_pos": 1095, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1095", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1095, "start_aa": "Asn", "end_pos": 1095, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1095", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G31118FR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1095, "start_aa": "Asn", "end_pos": 1095, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1095", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1095, "start_aa": "Asn", "end_pos": 1095, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1095", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1095, "start_aa": "Asn", "end_pos": 1095, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1095", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1095, "start_aa": "Asn", "end_pos": 1095, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1095", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G46902YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1095, "start_aa": "Asn", "end_pos": 1095, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1095", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1095, "start_aa": "Asn", "end_pos": 1095, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1095", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1095, "start_aa": "Asn", "end_pos": 1095, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1095", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1095, "start_aa": "Asn", "end_pos": 1095, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1095", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1095, "start_aa": "Asn", "end_pos": 1095, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1095", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G75221WP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1095, "start_aa": "Asn", "end_pos": 1095, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1095", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1095, "start_aa": "Asn", "end_pos": 1095, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1095", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G78644BR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1095, "start_aa": "Asn", "end_pos": 1095, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1095", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1095, "start_aa": "Asn", "end_pos": 1095, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1095", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1095, "start_aa": "Asn", "end_pos": 1095, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1095", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G93860XO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1095, "start_aa": "Asn", "end_pos": 1095, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1095", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 1095, "start_aa": "Asn", "end_pos": 1095, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1095", "evidence": [ { "id": "P08603", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08603#ptm_processing" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 217, "start_aa": "Asn", "end_pos": 217, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn217", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P08603@N217", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N217" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 217, "start_aa": "Asn", "end_pos": 217, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn217", "evidence": [ { "id": "P08603@N217", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N217" } ] }, { "glytoucan_ac": "G37881RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 217, "start_aa": "Asn", "end_pos": 217, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn217", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G43089EG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 217, "start_aa": "Asn", "end_pos": 217, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn217", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G47737VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 217, "start_aa": "Asn", "end_pos": 217, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn217", "evidence": [ { "id": "P08603@N217", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N217" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 217, "start_aa": "Asn", "end_pos": 217, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn217", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 217, "start_aa": "Asn", "end_pos": 217, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn217", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 217, "start_aa": "Asn", "end_pos": 217, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn217", "evidence": [ { "id": "P08603@N217", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N217" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "Complex", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (complex) asparagine Complex", "start_pos": 217, "start_aa": "Asn", "end_pos": 217, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn217", "evidence": [ { "id": "P08603", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08603#ptm_processing" }, { "id": "19139490", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 529, "start_aa": "Asn", "end_pos": 529, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn529", "evidence": [ { "id": "P08603@N529", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N529" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 529, "start_aa": "Asn", "end_pos": 529, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn529", "evidence": [ { "id": "P08603@N529", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N529" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 529, "start_aa": "Asn", "end_pos": 529, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn529", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 529, "start_aa": "Asn", "end_pos": 529, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn529", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 529, "start_aa": "Asn", "end_pos": 529, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn529", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G31118FR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 529, "start_aa": "Asn", "end_pos": 529, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn529", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 529, "start_aa": "Asn", "end_pos": 529, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn529", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 529, "start_aa": "Asn", "end_pos": 529, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn529", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 529, "start_aa": "Asn", "end_pos": 529, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn529", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 529, "start_aa": "Asn", "end_pos": 529, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn529", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 529, "start_aa": "Asn", "end_pos": 529, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn529", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G78644BR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 529, "start_aa": "Asn", "end_pos": 529, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn529", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 529, "start_aa": "Asn", "end_pos": 529, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn529", "evidence": [ { "id": "P08603@N529", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N529" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 529, "start_aa": "Asn", "end_pos": 529, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn529", "evidence": [ { "id": "P08603", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08603#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "2963625", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2963625" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 718, "start_aa": "Asn", "end_pos": 718, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn718", "evidence": [ { "id": "P08603@N718", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N718" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 718, "start_aa": "Asn", "end_pos": 718, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn718", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 718, "start_aa": "Asn", "end_pos": 718, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn718", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 718, "start_aa": "Asn", "end_pos": 718, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn718", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G31118FR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 718, "start_aa": "Asn", "end_pos": 718, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn718", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 718, "start_aa": "Asn", "end_pos": 718, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn718", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 718, "start_aa": "Asn", "end_pos": 718, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn718", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 718, "start_aa": "Asn", "end_pos": 718, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn718", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G78644BR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 718, "start_aa": "Asn", "end_pos": 718, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn718", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 718, "start_aa": "Asn", "end_pos": 718, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn718", "evidence": [ { "id": "P08603", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08603#ptm_processing" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "G04909DG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 802, "start_aa": "Asn", "end_pos": 802, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn802", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 802, "start_aa": "Asn", "end_pos": 802, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn802", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 802, "start_aa": "Asn", "end_pos": 802, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn802", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "G37399XV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 802, "start_aa": "Asn", "end_pos": 802, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn802", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 802, "start_aa": "Asn", "end_pos": 802, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn802", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "G57818FI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 802, "start_aa": "Asn", "end_pos": 802, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn802", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "G75221WP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 802, "start_aa": "Asn", "end_pos": 802, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn802", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 802, "start_aa": "Asn", "end_pos": 802, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn802", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 802, "start_aa": "Asn", "end_pos": 802, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn802", "evidence": [ { "id": "P08603", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08603#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 822, "start_aa": "Asn", "end_pos": 822, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn822", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G04909DG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 822, "start_aa": "Asn", "end_pos": 822, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn822", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 822, "start_aa": "Asn", "end_pos": 822, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn822", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 822, "start_aa": "Asn", "end_pos": 822, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn822", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 822, "start_aa": "Asn", "end_pos": 822, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn822", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 822, "start_aa": "Asn", "end_pos": 822, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn822", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 822, "start_aa": "Asn", "end_pos": 822, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn822", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 822, "start_aa": "Asn", "end_pos": 822, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn822", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G51941GC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 822, "start_aa": "Asn", "end_pos": 822, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn822", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "G75221WP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 822, "start_aa": "Asn", "end_pos": 822, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn822", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "G85740DB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 822, "start_aa": "Asn", "end_pos": 822, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn822", "evidence": [ { "id": "P08603@N822", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N822" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 822, "start_aa": "Asn", "end_pos": 822, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn822", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G93860XO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 822, "start_aa": "Asn", "end_pos": 822, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn822", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 822, "start_aa": "Asn", "end_pos": 822, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn822", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" }, { "id": "P08603", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08603#ptm_processing" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G00875VP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P08603@N882", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N882" } ] }, { "glytoucan_ac": "G04909DG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "G05933EN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "P08603@N882", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N882" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P08603@N882", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N882" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G07799LX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "P08603@N882", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N882" } ] }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "P08603@N882", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N882" } ] }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "P08603@N882", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N882" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G25418HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G27126ED", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "P08603@N882", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N882" } ] }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P08603@N882", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N882" } ] }, { "glytoucan_ac": "G31118FR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "P08603@N882", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N882" } ] }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" }, { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G43669FQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "P08603@N882", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N882" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G47737VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "P08603@N882", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N882" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G51941GC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P08603@N882", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N882" } ] }, { "glytoucan_ac": "G60923RB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "P08603@N882", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N882" } ] }, { "glytoucan_ac": "G66163OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G71146HJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G75221WP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G78644BR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P08603@N882", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N882" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P08603@N882", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N882" } ] }, { "glytoucan_ac": "G89205CJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G93860XO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P08603@N882", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N882" } ] }, { "glytoucan_ac": "G95865ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P08603@N882", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N882" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "P08603", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08603#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/14760718" }, { "id": "19139490", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P08603@N911", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N911" } ] }, { "glytoucan_ac": "G04909DG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P08603@N911", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N911" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G07799LX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "P08603@N911", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N911" } ] }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "P08603@N911", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N911" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11911BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G12341GU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "P08603@N911", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N911" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G24084IV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P08603@N911", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N911" } ] }, { "glytoucan_ac": "G31118FR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "P08603@N911", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N911" } ] }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" }, { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" } ] }, { "glytoucan_ac": "G43005HM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "P08603@N911", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N911" } ] }, { "glytoucan_ac": "G43669FQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "P08603@N911", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N911" } ] }, { "glytoucan_ac": "G46524LG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G46902YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G47737VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "P08603@N911", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N911" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G51941GC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P08603@N911", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N911" } ] }, { "glytoucan_ac": "G60923RB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "P08603@N911", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N911" } ] }, { "glytoucan_ac": "G66163OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G78644BR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G80223IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "P08603@N911", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N911" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "P08603@N911", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N911" } ] }, { "glytoucan_ac": "G89098OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G93860XO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "P08603", "database": "UniCarbKB", "url": "" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "P08603@N911", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P08603@N911" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "Complex", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (complex) asparagine Complex", "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "P08603", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08603#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "17591618", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17591618" }, { "id": "19139490", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Decay accelerating activity of complement receptor type 1 (CD35). Two active sites are required for dissociating C5 convertases.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Krych-Goldberg M, Hauhart RE, Subramanian VB, Yurcisin BM 2nd, Crimmins DL, Hourcade DE, Atkinson JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "10531307", "url": "https://glygen.org/publication/PubMed/10531307" } ] }, { "title": "Complement factor H gene mutation associated with autosomal recessive atypical hemolytic uremic syndrome.", "journal": "American journal of human genetics", "date": "1999", "authors": "Ying L, Katz Y, Schlesinger M, Carmi R, Shalev H, Haider N, Beck G, Sheffield VC, Landau D", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "10577907", "url": "https://glygen.org/publication/PubMed/10577907" } ] }, { "title": "Control of the amplification convertase of complement by the plasma protein beta1H.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1976", "authors": "Weiler JM, Daha MR, Austen KF, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "1067618", "url": "https://glygen.org/publication/PubMed/1067618" } ] }, { "title": "Complement factor H gene mutation associated with autosomal recessive atypical hemolytic uremic syndrome.", "journal": "American journal of human genetics", "date": "2000", "authors": "Buddles MR, Donne RL, Richards A, Goodship J, Goodship TH", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "10762557", "url": "https://glygen.org/publication/PubMed/10762557" } ] }, { "title": "Molecular basis for factor H and FHL-1 deficiency in an Italian family.", "journal": "Immunogenetics", "date": "2000", "authors": "S\u00e1nchez-Corral P, Bellavia D, Amico L, Brai M, Rodr\u00edguez de C\u00f3rdoba S", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "10803850", "url": "https://glygen.org/publication/PubMed/10803850" } ] }, { "title": "The molecular basis of familial hemolytic uremic syndrome: mutation analysis of factor H gene reveals a hot spot in short consensus repeat 20.", "journal": "Journal of the American Society of Nephrology : JASN", "date": "2001", "authors": "Caprioli J, Bettinaglio P, Zipfel PF, Amadei B, Daina E, Gamba S, Skerka C, Marziliano N, Remuzzi G, Noris M", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "11158219", "url": "https://glygen.org/publication/PubMed/11158219" } ] }, { "title": "Clustering of missense mutations in the C-terminal region of factor H in atypical hemolytic uremic syndrome.", "journal": "American journal of human genetics", "date": "2001", "authors": "Perez-Caballero D, Gonzalez-Rubio C, Gallardo ME, Vera M, Lopez-Trascasa M, Rodriguez de Cordoba S, Sanchez-Corral P", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "11170895", "url": "https://glygen.org/publication/PubMed/11170895" } ] }, { "title": "Factor H mutations in hemolytic uremic syndrome cluster in exons 18-20, a domain important for host cell recognition.", "journal": "American journal of human genetics", "date": "2001", "authors": "Richards A, Buddles MR, Donne RL, Kaplan BS, Kirk E, Venning MC, Tielemans CL, Goodship JA, Goodship TH", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "11170896", "url": "https://glygen.org/publication/PubMed/11170896" } ] }, { "title": "Decay-accelerating factor (DAF), complement receptor 1 (CR1), and factor H dissociate the complement AP C3 convertase (C3bBb) via sites on the type A domain of Bb.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Hourcade DE, Mitchell L, Kuttner-Kondo LA, Atkinson JP, Medof ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "11694537", "url": "https://glygen.org/publication/PubMed/11694537" } ] }, { "title": "Molecular modelling of the C-terminal domains of factor H of human complement: a correlation between haemolytic uraemic syndrome and a predicted heparin binding site.", "journal": "Journal of molecular biology", "date": "2002", "authors": "Perkins SJ, Goodship TH", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "11851332", "url": "https://glygen.org/publication/PubMed/11851332" } ] }, { "title": "Inactivation of C3a and C5a octapeptides by carboxypeptidase R and carboxypeptidase N.", "journal": "Microbiology and immunology", "date": "2002", "authors": "Campbell WD, Lazoura E, Okada N, Okada H", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "11939578", "url": "https://glygen.org/publication/PubMed/11939578" } ] }, { "title": "Combined kidney and liver transplantation for familial haemolytic uraemic syndrome.", "journal": "Lancet (London, England)", "date": "2002", "authors": "Remuzzi G, Ruggenenti P, Codazzi D, Noris M, Caprioli J, Locatelli G, Gridelli B", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "12020532", "url": "https://glygen.org/publication/PubMed/12020532" } ] }, { "title": "Role of membrane cofactor protein (CD46) in regulation of C4b and C3b deposited on cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2002", "authors": "Barilla-LaBarca ML, Liszewski MK, Lambris JD, Hourcade D, Atkinson JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "12055245", "url": "https://glygen.org/publication/PubMed/12055245" } ] }, { "title": "Haemolytic uraemic syndrome and mutations of the factor H gene: a registry-based study of German speaking countries.", "journal": "Journal of medical genetics", "date": "2003", "authors": "Neumann HP, Salzmann M, Bohnert-Iwan B, Mannuelian T, Skerka C, Lenk D, Bender BU, Cybulla M, Riegler P, Konigsrainer A, Neyer U, Bock A, Widmer U, Male DA, Franke G, Zipfel PF", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "12960213", "url": "https://glygen.org/publication/PubMed/12960213" } ] }, { "title": "Factor I-dependent inactivation of human complement C4b of the classical pathway by C3b/C4b receptor (CR1, CD35) and membrane cofactor protein (MCP, CD46).", "journal": "Journal of biochemistry", "date": "1992", "authors": "Masaki T, Matsumoto M, Nakanishi I, Yasuda R, Seya T", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "1386357", "url": "https://glygen.org/publication/PubMed/1386357" } ] }, { "title": "Complement factor H mutations and gene polymorphisms in haemolytic uraemic syndrome: the C-257T, the A2089G and the G2881T polymorphisms are strongly associated with the disease.", "journal": "Human molecular genetics", "date": "2003", "authors": "Caprioli J, Castelletti F, Bucchioni S, Bettinaglio P, Bresin E, Pianetti G, Gamba S, Brioschi S, Daina E, Remuzzi G, Noris M", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "14583443", "url": "https://glygen.org/publication/PubMed/14583443" } ] }, { "title": "Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.", "journal": "Proteomics", "date": "2004", "authors": "Bunkenborg J, Pilch BJ, Podtelejnikov AV, Wisniewski JR", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603#ptm_processing" }, { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "14760718", "url": "https://glygen.org/publication/PubMed/14760718" } ] }, { "title": "Heterozygous and homozygous factor h deficiencies associated with hemolytic uremic syndrome or membranoproliferative glomerulonephritis: report and genetic analysis of 16 cases.", "journal": "Journal of the American Society of Nephrology : JASN", "date": "2004", "authors": "Dragon-Durey MA, Fremeaux-Bacchi V, Loirat C, Blouin J, Niaudet P, Deschenes G, Coppo P, Herman Fridman W, Weiss L", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "14978182", "url": "https://glygen.org/publication/PubMed/14978182" } ] }, { "title": "Solution structure of the fifth repeat of factor H: a second example of the complement control protein module.", "journal": "Biochemistry", "date": "1992", "authors": "Barlow PN, Norman DG, Steinkasserer A, Horne TJ, Pearce J, Driscoll PC, Sim RB, Campbell ID", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "1533152", "url": "https://glygen.org/publication/PubMed/1533152" } ] }, { "title": "Complement factor H variant increases the risk of age-related macular degeneration.", "journal": "Science", "date": "2005", "authors": "Haines Jonathan L, Hauser Michael A, Schmidt Silke, Scott William K, Olson Lana M, Gallins Paul, Spencer Kylee L, Kwan Shu Ying, Noureddine Maher, Gilbert John R, Schnetz-Boutaud Nathalie, Agarwal Anita, Postel Eric A, Pericak-Vance Margaret A", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "15761120", "url": "https://glygen.org/publication/PubMed/15761120" } ] }, { "title": "Complement factor H polymorphism and age-related macular degeneration.", "journal": "Science", "date": "2005", "authors": "Edwards Albert O, Ritter Robert, Abel Kenneth J, Manning Alisa, Panhuysen Carolien, Farrer Lindsay A", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "15761121", "url": "https://glygen.org/publication/PubMed/15761121" } ] }, { "title": "Complement factor H polymorphism in age-related macular degeneration.", "journal": "Science", "date": "2005", "authors": "Klein Robert J, Zeiss Caroline, Chew Emily Y, Tsai Jen-Yue, Sackler Richard S, Haynes Chad, Henning Alice K, SanGiovanni John Paul, Mane Shrikant M, Mayne Susan T, Bracken Michael B, Ferris Frederick L, Ott Jurg, Barnstable Colin, Hoh Josephine", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "15761122", "url": "https://glygen.org/publication/PubMed/15761122" } ] }, { "title": "A common haplotype in the complement regulatory gene factor H (HF1/CFH) predisposes individuals to age-related macular degeneration.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Hageman GS, Anderson DH, Johnson LV, Hancox LS, Taiber AJ, Hardisty LI, Hageman JL, Stockman HA, Borchardt JD, Gehrs KM, Smith RJ, Silvestri G, Russell SR, Klaver CC, Barbazetto I, Chang S, Yannuzzi LA, Barile GR, Merriam JC, Smith RT, Olsh AK, Bergeron J, Zernant J, Merriam JE, Gold B, Dean M, Allikmets R", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "15870199", "url": "https://glygen.org/publication/PubMed/15870199" } ] }, { "title": "Strong association of the Y402H variant in complement factor H at 1q32 with susceptibility to age-related macular degeneration.", "journal": "American journal of human genetics", "date": "2005", "authors": "Zareparsi S, Branham KE, Li M, Shah S, Klein RJ, Ott J, Hoh J, Abecasis GR, Swaroop A", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "15895326", "url": "https://glygen.org/publication/PubMed/15895326" } ] }, { "title": "Insights into the human CD59 complement binding interface toward engineering new therapeutics.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Huang Y, Smith CA, Song H, Morgan BP, Abagyan R, Tomlinson S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "16079145", "url": "https://glygen.org/publication/PubMed/16079145" } ] }, { "title": "Binding of complement factor H to endothelial cells is mediated by the carboxy-terminal glycosaminoglycan binding site.", "journal": "The American journal of pathology", "date": "2005", "authors": "Jokiranta TS, Cheng ZZ, Seeberger H, Jozsi M, Heinen S, Noris M, Remuzzi G, Ormsby R, Gordon DL, Meri S, Hellwage J, Zipfel PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "16192651", "url": "https://glygen.org/publication/PubMed/16192651" } ] }, { "title": "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.", "journal": "Journal of proteome research", "date": "2005", "authors": "Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603#ptm_processing" }, { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "title": "Structure of complement factor H carboxyl-terminus reveals molecular basis of atypical haemolytic uremic syndrome.", "journal": "The EMBO journal", "date": "2006", "authors": "Jokiranta TS, Jaakola VP, Lehtinen MJ, Parepalo M, Meri S, Goldman A", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "16601698", "url": "https://glygen.org/publication/PubMed/16601698" } ] }, { "title": "Deletion of Lys224 in regulatory domain 4 of Factor H reveals a novel pathomechanism for dense deposit disease (MPGN II).", "journal": "Kidney international", "date": "2006", "authors": "Licht C, Heinen S, Jozsi M, Loschmann I, Saunders RE, Perkins SJ, Waldherr R, Skerka C, Kirschfink M, Hoppe B, Zipfel PF", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "16612335", "url": "https://glygen.org/publication/PubMed/16612335" } ] }, { "title": "Levels of expression of complement regulatory proteins CD46, CD55 and CD59 on resting and activated human peripheral blood leucocytes.", "journal": "Immunology", "date": "2006", "authors": "Christmas SE, de la Mata Espinosa CT, Halliday D, Buxton CA, Cummerson JA, Johnson PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "16999828", "url": "https://glygen.org/publication/PubMed/16999828" } ] }, { "title": "West Nile virus nonstructural protein NS1 inhibits complement activation by binding the regulatory protein factor H.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2006", "authors": "Chung Kyung Min, Liszewski M Kathryn, Nybakken Grant, Davis Alan E, Townsend R Reid, Fremont Daved H, Atkinson John P, Diamond Michael S", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "17132743", "url": "https://glygen.org/publication/PubMed/17132743" } ] }, { "title": "Decay-accelerating factor must bind both components of the complement alternative pathway C3 convertase to mediate efficient decay.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Harris CL, Pettigrew DM, Lea SM, Morgan BP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "17182573", "url": "https://glygen.org/publication/PubMed/17182573" } ] }, { "title": "Structure shows that a glycosaminoglycan and protein recognition site in factor H is perturbed by age-related macular degeneration-linked single nucleotide polymorphism.", "journal": "J. Biol. Chem.", "date": "2007", "authors": "Herbert Andrew P, Deakin Jon A, Schmidt Christoph Q, Blaum B\u00e4rbel S, Egan Claire, Ferreira Viviana P, Pangburn Michael K, Lyon Malcolm, Uhr\u00edn Dusan, Barlow Paul N", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "17360715", "url": "https://glygen.org/publication/PubMed/17360715" } ] }, { "title": "Crystal structure of CD59: implications for molecular recognition of the complement proteins C8 and C9 in the membrane-attack complex.", "journal": "Acta crystallographica. Section D, Biological crystallography", "date": "2007", "authors": "Huang Y, Fedarovich A, Tomlinson S, Davies C", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "17505110", "url": "https://glygen.org/publication/PubMed/17505110" } ] }, { "title": "Site-specific N-glycan characterization of human complement factor H.", "journal": "Glycobiology", "date": "2007", "authors": "Fenaille F, Le Mignon M, Groseil C, Ramon C, Riande S, Siret L, Bihoreau N", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603#ptm_processing" }, { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" }, { "database": "UniCarbKB", "id": "P08603", "url": "" } ], "reference": [ { "type": "PubMed", "id": "17591618", "url": "https://glygen.org/publication/PubMed/17591618" } ] }, { "title": "Structural basis for complement factor H linked age-related macular degeneration.", "journal": "The Journal of experimental medicine", "date": "2007", "authors": "Prosser BE, Johnson S, Roversi P, Herbert AP, Blaum BS, Tyrrell J, Jowitt TA, Clark SJ, Tarelli E, Uhrin D, Barlow PN, Sim RB, Day AJ, Lea SM", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "17893204", "url": "https://glygen.org/publication/PubMed/17893204" } ] }, { "title": "The regulatory SCR-1/5 and cell surface-binding SCR-16/20 fragments of factor H reveal partially folded-back solution structures and different self-associative properties.", "journal": "J. Mol. Biol.", "date": "2008", "authors": "Okemefuna Azubuike I, Gilbert Hannah E, Griggs Kim M, Ormsby Rebecca J, Gordon David L, Perkins Stephen J", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "18005991", "url": "https://glygen.org/publication/PubMed/18005991" } ] }, { "title": "Basal laminar drusen caused by compound heterozygous variants in the CFH gene.", "journal": "American journal of human genetics", "date": "2008", "authors": "Boon CJ, Klevering BJ, Hoyng CB, Zonneveld-Vrieling MN, Nabuurs SB, Blokland E, Cremers FP, den Hollander AI", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "18252232", "url": "https://glygen.org/publication/PubMed/18252232" } ] }, { "title": "Structure of the N-terminal region of complement factor H and conformational implications of disease-linked sequence variations.", "journal": "The Journal of biological chemistry", "date": "2008-04-04", "authors": "Hocking Henry G, Herbert Andrew P, Kavanagh David, Soares Dinesh C, Ferreira Viviana P, Pangburn Michael K, Uhr\u00edn Dusan, Barlow Paul N", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "18252712", "url": "https://glygen.org/publication/PubMed/18252712" } ] }, { "title": "Cloning of the 1.4-kb mRNA species of human complement factor H reveals a novel member of the short consensus repeat family related to the carboxy terminal of the classical 150-kDa molecule.", "journal": "J. Immunol.", "date": "1991", "authors": "Estaller C, Koistinen V, Schwaeble W, Dierich M P, Weiss E H", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "1826708", "url": "https://glygen.org/publication/PubMed/1826708" } ] }, { "title": "Three-dimensional structure of a complement control protein module in solution.", "journal": "J. Mol. Biol.", "date": "1991", "authors": "Norman D G, Barlow P N, Baron M, Day A J, Sim R B, Campbell I D", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "1829116", "url": "https://glygen.org/publication/PubMed/1829116" } ] }, { "title": "The Staphylococcus aureus protein Sbi acts as a complement inhibitor and forms a tripartite complex with host complement Factor H and C3b.", "journal": "PLoS Pathog.", "date": "2008", "authors": "Haupt Katrin, Reuter Michael, van den Elsen Jean, Burman Julia, H\u00e4lbich Steffi, Richter Julia, Skerka Christine, Zipfel Peter F", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "19112495", "url": "https://glygen.org/publication/PubMed/19112495" } ] }, { "title": "A strategy for precise and large scale identification of core fucosylated glycoproteins.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603#ptm_processing" }, { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "19139490", "url": "https://glygen.org/publication/PubMed/19139490" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603#ptm_processing" }, { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "Neisseria meningitidis recruits factor H using protein mimicry of host carbohydrates.", "journal": "Nature", "date": "2009", "authors": "Schneider Muriel C, Prosser Beverly E, Caesar Joseph J E, Kugelberg Elisabeth, Li Su, Zhang Qian, Quoraishi Sadik, Lovett Janet E, Deane Janet E, Sim Robert B, Roversi Pietro, Johnson Steven, Tang Christoph M, Lea Susan M", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "19225461", "url": "https://glygen.org/publication/PubMed/19225461" } ] }, { "title": "Structure of complement fragment C3b-factor H and implications for host protection by complement regulators.", "journal": "Nature immunology", "date": "2009-07", "authors": "Wu Jin, Wu You-Qiang, Ricklin Daniel, Janssen Bert J C, Lambris John D, Gros Piet", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "19503104", "url": "https://glygen.org/publication/PubMed/19503104" } ] }, { "title": "Electrostatic interactions contribute to the folded-back conformation of wild type human factor H.", "journal": "J. Mol. Biol.", "date": "2009", "authors": "Okemefuna Azubuike I, Nan Ruodan, Gor Jayesh, Perkins Stephen J", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "19505476", "url": "https://glygen.org/publication/PubMed/19505476" } ] }, { "title": "The central portion of factor H (modules 10-15) is compact and contains a structurally deviant CCP module.", "journal": "J. Mol. Biol.", "date": "2010", "authors": "Schmidt Christoph Q, Herbert Andrew P, Mertens Haydyn D T, Guariento Mara, Soares Dinesh C, Uhrin Dusan, Rowe Arthur J, Svergun Dmitri I, Barlow Paul N", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "19835885", "url": "https://glygen.org/publication/PubMed/19835885" } ] }, { "title": "Enrichment of glycopeptides for glycan structure and attachment site identification.", "journal": "Nature methods", "date": "2009", "authors": "Nilsson J, Ruetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603#ptm_processing" }, { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" }, { "database": "UniCarbKB", "id": "P08603", "url": "" }, { "database": "GlyConnect", "id": "722", "url": "https://glyconnect.expasy.org/browser/proteins/722" } ], "reference": [ { "type": "PubMed", "id": "19838169", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "title": "Factor H and factor H-related protein 1 bind to human neutrophils via complement receptor 3, mediate attachment to Candida albicans, and enhance neutrophil antimicrobial activity.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2010-01-15", "authors": "Losse Josephine, Zipfel Peter F, J\u00f3zsi Mih\u00e1ly", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "20008295", "url": "https://glygen.org/publication/PubMed/20008295" } ] }, { "title": "Both domain 19 and domain 20 of factor H are involved in binding to complement C3b and C3d.", "journal": "Mol. Immunol.", "date": "2010", "authors": "Bhattacharjee Arnab, Lehtinen Markus J, Kajander Tommi, Goldman Adrian, Jokiranta T Sakari", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "20378178", "url": "https://glygen.org/publication/PubMed/20378178" } ] }, { "title": "Mutations in alternative pathway complement proteins in American patients with atypical hemolytic uremic syndrome.", "journal": "Human mutation", "date": "2010", "authors": "Maga TK, Nishimura CJ, Weaver AE, Frees KL, Smith RJ", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "20513133", "url": "https://glygen.org/publication/PubMed/20513133" } ] }, { "title": "Dual interaction of factor H with C3d and glycosaminoglycans in host-nonhost discrimination by complement.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011-02-15", "authors": "Kajander Tommi, Lehtinen Markus J, Hyv\u00e4rinen Satu, Bhattacharjee Arnab, Leung Elisa, Isenman David E, Meri Seppo, Goldman Adrian, Jokiranta T Sakari", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "21285368", "url": "https://glygen.org/publication/PubMed/21285368" } ] }, { "title": "Differential regulation of complement factor H and C3 production in human umbilical vein endothelial cells by IFN-gamma and IL-1.", "journal": "J. Immunol.", "date": "1990", "authors": "Brooimans R A, van der Ark A A, Buurman W A, van Es L A, Daha M R", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "2139673", "url": "https://glygen.org/publication/PubMed/2139673" } ] }, { "title": "Unique structure of iC3b resolved at a resolution of 24 A by 3D-electron microscopy.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Alcorlo M, Martinez-Barricarte R, Fernandez FJ, Rodriguez-Gallego C, Round A, Vega MC, Harris CL, de Cordoba SR, Llorca O", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "21788512", "url": "https://glygen.org/publication/PubMed/21788512" } ] }, { "title": "A rare penetrant mutation in CFH confers high risk of age-related macular degeneration.", "journal": "Nature genetics", "date": "2011", "authors": "Raychaudhuri S, Iartchouk O, Chin K, Tan PL, Tai AK, Ripke S, Gowrisankar S, Vemuri S, Montgomery K, Yu Y, Reynolds R, Zack DJ, Campochiaro B, Campochiaro P, Katsanis N, Daly MJ, Seddon JM", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "22019782", "url": "https://glygen.org/publication/PubMed/22019782" } ] }, { "title": "Quantitative detection of single amino acid polymorphisms by targeted proteomics.", "journal": "Journal of molecular cell biology", "date": "2011", "authors": "Su ZD, Sun L, Yu DX, Li RX, Li HX, Yu ZJ, Sheng QH, Lin X, Zeng R, Wu JR", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "22028381", "url": "https://glygen.org/publication/PubMed/22028381" } ] }, { "title": "Cigarette smoking strongly modifies the association of complement factor H variant and the risk of lung cancer.", "journal": "Cancer epidemiology", "date": "2012", "authors": "Zhang Z, Yu D, Yuan J, Guo Y, Wang H, Zhang X", "evidence": [ { "database": "Entrez", "id": "3075", "url": "https://www.ncbi.nlm.nih.gov/gene/3075" } ], "reference": [ { "type": "PubMed", "id": "22197220", "url": "https://glygen.org/publication/PubMed/22197220" } ] }, { "title": "Structural analysis of the C-terminal region (modules 18-20) of complement regulator factor H (FH).", "journal": "PLoS ONE", "date": "2012", "authors": "Morgan Hugh P, Mertens Haydyn D T, Guariento Mara, Schmidt Christoph Q, Soares Dinesh C, Svergun Dmitri I, Herbert Andrew P, Barlow Paul N, Hannan Jonathan P", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "22389686", "url": "https://glygen.org/publication/PubMed/22389686" } ] }, { "title": "Thrombin generates previously unidentified C5 products that support the terminal complement activation pathway.", "journal": "Blood", "date": "2012", "authors": "Krisinger MJ, Goebeler V, Lu Z, Meixner SC, Myles T, Pryzdial EL, Conway EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "22802338", "url": "https://glygen.org/publication/PubMed/22802338" } ] }, { "title": "Solution structure of CCP modules 10-12 illuminates functional architecture of the complement regulator, factor H.", "journal": "J. Mol. Biol.", "date": "2012", "authors": "Makou Elisavet, Mertens Haydyn D T, Maciejewski Mateusz, Soares Dinesh C, Matis Ilias, Schmidt Christoph Q, Herbert Andrew P, Svergun Dmitri I, Barlow Paul N", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "23017427", "url": "https://glygen.org/publication/PubMed/23017427" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "Design and evaluation of meningococcal vaccines through structure-based modification of host and pathogen molecules.", "journal": "PLoS Pathog.", "date": "2012", "authors": "Johnson Steven, Tan Lionel, van der Veen Stijn, Caesar Joseph, Goicoechea De Jorge Elena, Harding Rachel J, Bai Xilian, Exley Rachel M, Ward Philip N, Ruivo Nicola, Trivedi Kaushali, Cumber Elspeth, Jones Rhian, Newham Luke, Staunton David, Ufret-Vincenty Rafael, Borrow Ray, Pickering Matthew C, Lea Susan M, Tang Christoph M", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "23133374", "url": "https://glygen.org/publication/PubMed/23133374" } ] }, { "title": "Glycerol-3-phosphate dehydrogenase 2 is a novel factor H-, factor H-like protein 1-, and plasminogen-binding surface protein of Candida albicans.", "journal": "J. Infect. Dis.", "date": "2013", "authors": "Luo Shanshan, Hoffmann Ralf, Skerka Christine, Zipfel Peter F", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "23204165", "url": "https://glygen.org/publication/PubMed/23204165" } ] }, { "title": "Malaria parasites co-opt human factor H to prevent complement-mediated lysis in the mosquito midgut.", "journal": "Cell host & microbe", "date": "2013-01-16", "authors": "Simon Nina, Lasonder Edwin, Scheuermayer Matthias, Kuehn Andrea, Tews Sabrina, Fischer Rainer, Zipfel Peter F, Skerka Christine, Pradel Gabriele", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "23332154", "url": "https://glygen.org/publication/PubMed/23332154" } ] }, { "title": "Dimerization of complement factor H-related proteins modulates complement activation in vivo.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Goicoechea de Jorge E, Caesar JJ, Malik TH, Patel M, Colledge M, Johnson S, Hakobyan S, Morgan BP, Harris CL, Pickering MC, Lea SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "23487775", "url": "https://glygen.org/publication/PubMed/23487775" } ] }, { "title": "Integrative genomic characterization of oral squamous cell carcinoma identifies frequent somatic drivers.", "journal": "Cancer discovery", "date": "2013", "authors": "Pickering CR, Zhang J, Yoo SY, Bengtsson L, Moorthy S, Neskey DM, Zhao M, Ortega Alves MV, Chang K, Drummond J, Cortez E, Xie TX, Zhang D, Chung W, Issa JP, Zweidler-McKay PA, Wu X, El-Naggar AK, Weinstein JN, Wang J, Muzny DM, Gibbs RA, Wheeler DA, Myers JN, Frederick MJ", "evidence": [ { "database": "dbSNP", "id": "rs768970275", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768970275" } ], "reference": [ { "type": "PubMed", "id": "23619168", "url": "https://glygen.org/publication/PubMed/23619168" } ] }, { "title": "Structural basis for complement evasion by Lyme disease pathogen Borrelia burgdorferi.", "journal": "J. Biol. Chem.", "date": "2013", "authors": "Bhattacharjee Arnab, Oeemig Jesper S, Kolodziejczyk Robert, Meri Taru, Kajander Tommi, Lehtinen Markus J, Iwa\u00ef Hideo, Jokiranta T Sakari, Goldman Adrian", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "23658013", "url": "https://glygen.org/publication/PubMed/23658013" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "Endogenous association of decay-accelerating factor (DAF) with C4b and C3b on cell membranes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1986", "authors": "Kinoshita T, Medof ME, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2420889", "url": "https://glygen.org/publication/PubMed/2420889" } ] }, { "title": "Computational framework for identification of intact glycopeptides in complex samples.", "journal": "Analytical chemistry", "date": "2014", "authors": "Mayampurath A, Yu CY, Song E, Balan J, Mechref Y, Tang H", "evidence": [ { "database": "UniCarbKB", "id": "P08603", "url": "" }, { "database": "GlyConnect", "id": "722", "url": "https://glyconnect.expasy.org/browser/proteins/722" } ], "reference": [ { "type": "PubMed", "id": "24279413", "url": "https://glygen.org/publication/PubMed/24279413" } ] }, { "title": "Selective glycopeptide profiling by acetone enrichment and LC/MS.", "journal": "Journal of proteomics", "date": "2014", "authors": "Takakura D, Harazono A, Hashii N, Kawasaki N", "evidence": [ { "database": "GlyConnect", "id": "722", "url": "https://glyconnect.expasy.org/browser/proteins/722" } ], "reference": [ { "type": "PubMed", "id": "24530628", "url": "https://glygen.org/publication/PubMed/24530628" } ] }, { "title": "SC5b-7, SC5b-8 and SC5b-9 complexes of complement: ultrastructure and localization of the S-protein (vitronectin) within the macromolecules.", "journal": "European journal of immunology", "date": "1989", "authors": "Preissner KP, Podack ER, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2465906", "url": "https://glygen.org/publication/PubMed/2465906" } ] }, { "title": "Complement S-protein (vitronectin) is associated with cytolytic membrane-bound C5b-9 complexes.", "journal": "Clinical and experimental immunology", "date": "1988", "authors": "Bhakdi S, Kaflein R, Halstensen TS, Hugo F, Preissner KT, Mollnes TE", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2466593", "url": "https://glygen.org/publication/PubMed/2466593" } ] }, { "title": "Functional properties of membrane cofactor protein of complement.", "journal": "The Biochemical journal", "date": "1989", "authors": "Seya T, Atkinson JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2481448", "url": "https://glygen.org/publication/PubMed/2481448" } ] }, { "title": "Complement factor H, vitronectin, and opticin are tyrosine-sulfated proteins of the retinal pigment epithelium.", "journal": "PloS one", "date": "2014", "authors": "Kanan Y, Siefert JC, Kinter M, Al-Ubaidi MR", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "25136834", "url": "https://glygen.org/publication/PubMed/25136834" } ] }, { "title": "Protein and site specificity of fucosylation in liver-secreted glycoproteins.", "journal": "Journal of proteome research", "date": "2014", "authors": "Pompach P, Ashline DJ, Brnakova Z, Benicky J, Sanda M, Goldman R", "evidence": [ { "database": "GlyConnect", "id": "722", "url": "https://glyconnect.expasy.org/browser/proteins/722" } ], "reference": [ { "type": "PubMed", "id": "25265424", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "title": "Structural determinants of host specificity of complement Factor H recruitment by Streptococcus pneumoniae.", "journal": "Biochem. J.", "date": "2015", "authors": "Achila David, Liu Aizhuo, Banerjee Rahul, Li Yue, Martinez-Hackert Erik, Zhang Jing-Ren, Yan Honggao", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "25330773", "url": "https://glygen.org/publication/PubMed/25330773" } ] }, { "title": "Structural basis for sialic acid-mediated self-recognition by complement factor H.", "journal": "Nature chemical biology", "date": "2015-01", "authors": "Blaum B\u00e4rbel S, Hannan Jonathan P, Herbert Andrew P, Kavanagh David, Uhr\u00edn Du\u0161an, Stehle Thilo", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "25402769", "url": "https://glygen.org/publication/PubMed/25402769" } ] }, { "title": "Recruitment of Factor H as a Novel Complement Evasion Strategy for Blood-Stage Plasmodium falciparum Infection.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2016-02-01", "authors": "Kennedy Alexander T, Schmidt Christoph Q, Thompson Jennifer K, Weiss Greta E, Taechalertpaisarn Tana, Gilson Paul R, Barlow Paul N, Crabb Brendan S, Cowman Alan F, Tham Wai-Hong", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "26700768", "url": "https://glygen.org/publication/PubMed/26700768" } ] }, { "title": "Staphylococcus aureus SdrE captures complement factor H's C-terminus via a novel 'close, dock, lock and latch' mechanism for complement evasion.", "journal": "Biochem. J.", "date": "2017", "authors": "Zhang Yingjie, Wu Minhao, Hang Tianrong, Wang Chengliang, Yang Ye, Pan Weimin, Zang Jianye, Zhang Min, Zhang Xuan", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "28258151", "url": "https://glygen.org/publication/PubMed/28258151" } ] }, { "title": "Regulator-dependent mechanisms of C3b processing by factor I allow differentiation of immune responses.", "journal": "Nature structural & molecular biology", "date": "2017", "authors": "Xue X, Wu J, Ricklin D, Forneris F, Di Crescenzio P, Schmidt CQ, Granneman J, Sharp TH, Lambris JD, Gros P", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "28671664", "url": "https://glygen.org/publication/PubMed/28671664" } ] }, { "title": "Crystal structure of a tripartite complex between C3dg, C-terminal domains of factor H and OspE of Borrelia burgdorferi.", "journal": "PLoS ONE", "date": "2017", "authors": "Kolodziejczyk Robert, Mikula Kornelia M, Kotila Tommi, Postis Vincent L G, Jokiranta T Sakari, Goldman Adrian, Meri Taru", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "29190743", "url": "https://glygen.org/publication/PubMed/29190743" } ] }, { "title": "Regulation of the amplification C3 convertase of human complement by an inhibitory protein isolated from human erythrocyte membrane.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1979", "authors": "Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "293688", "url": "https://glygen.org/publication/PubMed/293688" } ] }, { "title": "Modulation of the classical pathway C3 convertase by plasma proteins C4 binding protein and C3b inactivator.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1979", "authors": "Gigli I, Fujita T, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "293746", "url": "https://glygen.org/publication/PubMed/293746" } ] }, { "title": "Structural analysis of human complement protein H: homology with C4b binding protein, beta 2-glycoprotein I, and the Ba fragment of B2.", "journal": "J. Immunol.", "date": "1986", "authors": "Kristensen T, Wetsel R A, Tack B F", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "2937845", "url": "https://glygen.org/publication/PubMed/2937845" } ] }, { "title": "Large-scale intact glycopeptide identification by Mascot database search.", "journal": "Scientific reports", "date": "2018", "authors": "Bollineni RC, Koehler CJ, Gislefoss RE, Anonsen JH, Thiede B", "evidence": [ { "database": "GlyConnect", "id": "722", "url": "https://glyconnect.expasy.org/browser/proteins/722" } ], "reference": [ { "type": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "title": "Human complement factor H: isolation of cDNA clones and partial cDNA sequence of the 38-kDa tryptic fragment containing the binding site for C3b.", "journal": "Eur. J. Immunol.", "date": "1986", "authors": "Schulz T F, Schw\u00e4ble W, Stanley K K, Weiss E, Dierich M P", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "2946589", "url": "https://glygen.org/publication/PubMed/2946589" } ] }, { "title": "Human complement factor I: analysis of cDNA-derived primary structure and assignment of its gene to chromosome 4.", "journal": "The Journal of biological chemistry", "date": "1987", "authors": "Goldberger G, Bruns GA, Rits M, Edge MD, Kwiatkowski DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2956252", "url": "https://glygen.org/publication/PubMed/2956252" } ] }, { "title": "The complete amino acid sequence of human complement factor H.", "journal": "The Biochemical journal", "date": "1988", "authors": "Ripoche J, Day AJ, Harris TJ, Sim RB", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603#ptm_processing" }, { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "2963625", "url": "https://glygen.org/publication/PubMed/2963625" } ] }, { "title": "Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and alpha-1B-Glycoprotein.", "journal": "Analytical chemistry", "date": "2018", "authors": "Sun S, Hu Y, Jia L, Eshghi ST, Liu Y, Shah P, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P08603", "url": "" }, { "database": "GlyConnect", "id": "722", "url": "https://glyconnect.expasy.org/browser/proteins/722" } ], "reference": [ { "type": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "title": "Synthesis and regulation of complement protein factor H in human skin fibroblasts.", "journal": "J. Immunol.", "date": "1988", "authors": "Katz Y, Strunk R C", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "2968404", "url": "https://glygen.org/publication/PubMed/2968404" } ] }, { "title": "Identification of the C3b receptor-binding domain in third component of complement.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Becherer JD, Lambris JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2971659", "url": "https://glygen.org/publication/PubMed/2971659" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "GlyConnect", "id": "722", "url": "https://glyconnect.expasy.org/browser/proteins/722" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Human complement C3b inactivator: isolation, characterization, and demonstration of an absolute requirement for the serum protein beta1H for cleavage of C3b and C4b in solution.", "journal": "The Journal of experimental medicine", "date": "1977", "authors": "Pangburn MK, Schreiber RD, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "301546", "url": "https://glygen.org/publication/PubMed/301546" } ] }, { "title": "Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes.", "journal": "Journal of proteome research", "date": "2020", "authors": "Zhu J, Lin YH, Dingess KA, Mank M, Stahl B, Heck AJR", "evidence": [ { "database": "GlyConnect", "id": "722", "url": "https://glyconnect.expasy.org/browser/proteins/722" } ], "reference": [ { "type": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "title": "Estrogen promotes innate immune evasion of Candida albicans through inactivation of the alternative complement system.", "journal": "Cell Rep.", "date": "2022", "authors": "Kumwenda Pizga, Cottier Fabien, Hendry Alexandra C, Kneafsey Davey, Keevan Ben, Gallagher Hannah, Tsai Hung-Ji, Hall Rebecca A", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "34986357", "url": "https://glygen.org/publication/PubMed/34986357" } ] }, { "title": "Identification of complement factor H variants that predispose to pre-eclampsia: A genetic and functional study.", "journal": "BJOG : an international journal of obstetrics and gynaecology", "date": "2023-11", "authors": "Lokki A Inkeri, Ren Zhen, Triebwasser Michael, Daly Emma, , Perola Markus, Auro Kirsi, Burwick Richard, Salmon Jane E, Daly Mark, Laivuori Hannele, Atkinson John P, Java Anuja, Meri Seppo", "evidence": [ { "database": "RefSeq", "id": "NP_000177", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000177" } ], "reference": [ { "type": "PubMed", "id": "37156755", "url": "https://glygen.org/publication/PubMed/37156755" } ] }, { "title": "Mesangial C3 Deposition, Complement-Associated Variant, and Disease Progression in IgA Nephropathy.", "journal": "Clinical journal of the American Society of Nephrology : CJASN", "date": "2023-08-31", "authors": "Kang Yuqi, Xu Boyang, Shi Sufang, Zhou Xujie, Chen Pei, Liu Lijun, Li Yebei, Leng Yueqi, Lv Jicheng, Zhu Li, Zhang Hong", "evidence": [ { "database": "RefSeq", "id": "NP_000177", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000177" } ], "reference": [ { "type": "PubMed", "id": "37651123", "url": "https://glygen.org/publication/PubMed/37651123" } ] }, { "title": "Complement factor H attenuates TNF-\u03b1-induced inflammation by upregulating EIF3C in rheumatoid arthritis.", "journal": "Journal of translational medicine", "date": "2023-11-23", "authors": "Jia Yimeng, Feng Bin, Ji Xin, Tian Xinping, Zhao Lidan, Zhou Jiaxin, Zhang Wen, Li Mengtao, Fei Yunyun, Wu Xunyao", "evidence": [ { "database": "RefSeq", "id": "NP_000177", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000177" } ], "reference": [ { "type": "PubMed", "id": "37996918", "url": "https://glygen.org/publication/PubMed/37996918" } ] }, { "title": "C3 nephritic factor protects bound C3bBb from cleavage by factor I and human erythrocytes.", "journal": "Molecular immunology", "date": "1985", "authors": "Mold C, Medof ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "3848661", "url": "https://glygen.org/publication/PubMed/3848661" } ] }, { "title": "Anaphylatoxin inactivator of human plasma: its isolation and characterization as a carboxypeptidase.", "journal": "The Journal of clinical investigation", "date": "1970", "authors": "Bokisch VA, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "4098172", "url": "https://glygen.org/publication/PubMed/4098172" } ] }, { "title": "Generation of three different fragments of bound C3 with purified factor I or serum. I. Requirements for factor H vs CR1 cofactor activity.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1982", "authors": "Ross GD, Lambris JD, Cain JA, Newman SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6214588", "url": "https://glygen.org/publication/PubMed/6214588" } ] }, { "title": "Purification and structural studies on the complement-system control protein beta 1H (Factor H).", "journal": "Biochem. J.", "date": "1982", "authors": "Sim R B, DiScipio R G", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "6215918", "url": "https://glygen.org/publication/PubMed/6215918" } ] }, { "title": "Kinetic and thermodynamic analysis of the control of C3b by the complement regulatory proteins factors H and I.", "journal": "Biochemistry", "date": "1983", "authors": "Pangburn MK, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6219696", "url": "https://glygen.org/publication/PubMed/6219696" } ] }, { "title": "Visualization of human C4b-binding protein and its complexes with vitamin K-dependent protein S and complement protein C4b.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1983", "authors": "Dahlback B, Smith CA, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6222381", "url": "https://glygen.org/publication/PubMed/6222381" } ] }, { "title": "Identification of a 145,000 Mr membrane protein as the C3d receptor (CR2) of human B lymphocytes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1984", "authors": "Weis JJ, Tedder TF, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6230668", "url": "https://glygen.org/publication/PubMed/6230668" } ] }, { "title": "Inhibition of complement activation on the surface of cells after incorporation of decay-accelerating factor (DAF) into their membranes.", "journal": "The Journal of experimental medicine", "date": "1984", "authors": "Medof ME, Kinoshita T, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6238120", "url": "https://glygen.org/publication/PubMed/6238120" } ] }, { "title": "Characterization of the interaction of human C4b-binding protein with physiological ligands.", "journal": "The Journal of biological chemistry", "date": "1984", "authors": "Ziccardi RJ, Dahlback B, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6334079", "url": "https://glygen.org/publication/PubMed/6334079" } ] }, { "title": "Biosynthesis of the complement components and the regulatory proteins of the alternative complement pathway by human peripheral blood monocytes.", "journal": "J. Exp. Med.", "date": "1980", "authors": "Whaley K", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "6444659", "url": "https://glygen.org/publication/PubMed/6444659" } ] }, { "title": "High molecular weight complex in human plasma between vitamin K-dependent protein S and complement component C4b-binding protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1981", "authors": "Dahlback B, Stenflo J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6454142", "url": "https://glygen.org/publication/PubMed/6454142" } ] }, { "title": "Physiologic inactivation of fluid phase C3b: isolation and structural analysis of C3c, C3d,g (alpha 2D), and C3g.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1984", "authors": "Davis AE 3rd, Harrison RA, Lachmann PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6607952", "url": "https://glygen.org/publication/PubMed/6607952" } ] }, { "title": "Human C4-binding protein. I. Isolation and characterization.", "journal": "The Journal of experimental medicine", "date": "1978", "authors": "Scharfstein J, Ferreira A, Gigli I, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "670886", "url": "https://glygen.org/publication/PubMed/670886" } ] }, { "title": "The human complement system: assembly of the classical pathway C3 convertase.", "journal": "The Biochemical journal", "date": "1980", "authors": "Kerr MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6906228", "url": "https://glygen.org/publication/PubMed/6906228" } ] }, { "title": "Human C4-binding protein. II. Role in proteolysis of C4b by C3b-inactivator.", "journal": "The Journal of experimental medicine", "date": "1978", "authors": "Fujita T, Gigli I, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "702059", "url": "https://glygen.org/publication/PubMed/702059" } ] }, { "title": "Cleavage of C4b by C3b inactivator: production of a nicked form of C4b, C4b', as an intermediate cleavage product of C4b by C3b inactivator.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1980", "authors": "Nagasawa S, Ichihara C, Stroud RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "7391570", "url": "https://glygen.org/publication/PubMed/7391570" } ] }, { "title": "Complement inhibition by human vitronectin involves non-heparin binding domains.", "journal": "Clinical and experimental immunology", "date": "1995", "authors": "Sheehan M, Morris CA, Pussell BA, Charlesworth JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "7542572", "url": "https://glygen.org/publication/PubMed/7542572" } ] }, { "title": "Interaction of C1-inhibitor with the C1r and C1s subcomponents in human C1.", "journal": "Biochimica et biophysica acta", "date": "1979", "authors": "Arlaud GJ, Reboul A, Sim RB, Colomb MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "760802", "url": "https://glygen.org/publication/PubMed/760802" } ] }, { "title": "Interaction of 125I-labelled complement subcomponents C-1r and C-1s with protease inhibitors in plasma.", "journal": "FEBS letters", "date": "1979", "authors": "Sim RB, Reboul A, Arlaud GJ, Villiers CL, Colomb MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "761607", "url": "https://glygen.org/publication/PubMed/761607" } ] }, { "title": "Functional dissection of the CD21/CD19/TAPA-1/Leu-13 complex of B lymphocytes.", "journal": "The Journal of experimental medicine", "date": "1993", "authors": "Matsumoto AK, Martin DR, Carter RH, Klickstein LB, Ahearn JM, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "7690834", "url": "https://glygen.org/publication/PubMed/7690834" } ] }, { "title": "Interactions of soluble CD59 with the terminal complement complexes. CD59 and C9 compete for a nascent epitope on C8.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1993", "authors": "Lehto T, Meri S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "7691959", "url": "https://glygen.org/publication/PubMed/7691959" } ] }, { "title": "Solution structure of a pair of complement modules by nuclear magnetic resonance.", "journal": "J. Mol. Biol.", "date": "1993", "authors": "Barlow P N, Steinkasserer A, Norman D G, Kieffer B, Wiles A P, Sim R B, Campbell I D", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "8331663", "url": "https://glygen.org/publication/PubMed/8331663" } ] }, { "title": "Clusterin, the human apolipoprotein and complement inhibitor, binds to complement C7, C8 beta, and the b domain of C9.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1993", "authors": "Tschopp J, Chonn A, Hertig S, French LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "8345200", "url": "https://glygen.org/publication/PubMed/8345200" } ] }, { "title": "Covalent binding properties of the human complement protein C4 and hydrolysis rate of the internal thioester upon activation.", "journal": "Protein science : a publication of the Protein Society", "date": "1993", "authors": "Sepp A, Dodds AW, Anderson MJ, Campbell RD, Willis AC, Law SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "8495193", "url": "https://glygen.org/publication/PubMed/8495193" } ] }, { "title": "Localization of classical and alternative pathway regulatory activity within the decay-accelerating factor.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1996", "authors": "Brodbeck WG, Liu D, Sperry J, Mold C, Medof ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "8786315", "url": "https://glygen.org/publication/PubMed/8786315" } ] }, { "title": "Binding of human and rat CD59 to the terminal complement complexes.", "journal": "Immunology", "date": "1997", "authors": "Lehto T, Morgan BP, Meri S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "9038722", "url": "https://glygen.org/publication/PubMed/9038722" } ] }, { "title": "Human factor H deficiency. Mutations in framework cysteine residues and block in H protein secretion and intracellular catabolism.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Ault BH, Schmidt BZ, Fowler NL, Kashtan CE, Ahmed AE, Vogt BA, Colten HR", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "9312129", "url": "https://glygen.org/publication/PubMed/9312129" } ] }, { "title": "Genetic studies into inherited and sporadic hemolytic uremic syndrome.", "journal": "Kidney international", "date": "1998", "authors": "Warwicker P, Goodship TH, Donne RL, Pirson Y, Nicholls A, Ward RM, Turnpenny P, Goodship JA", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "9551389", "url": "https://glygen.org/publication/PubMed/9551389" } ] }, { "title": "Human polymorphonuclear leukocytes adhere to complement factor H through an interaction that involves alphaMbeta2 (CD11b/CD18).", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1998-04-15", "authors": "DiScipio R G, Daffern P J, Schraufst\u00e4tter I U, Sriramarao P", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "reference": [ { "type": "PubMed", "id": "9558116", "url": "https://glygen.org/publication/PubMed/9558116" } ] }, { "title": "Alternative pathway of complement: recruitment of precursor properdin by the labile C3/C5 convertase and the potentiation of the pathway.", "journal": "The Journal of experimental medicine", "date": "1976", "authors": "Medicus RG, Gotze O, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "978134", "url": "https://glygen.org/publication/PubMed/978134" } ] } ], "pathway": [ { "id": "hsa:3075", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3075", "resource": "KEGG Pathway" }, { "id": "R-HSA-977606", "name": "Regulation of Complement cascade", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606", "resource": "Reactome", "description": "Regulation of Complement cascade" } ], "orthologs": [ { "uniprot_canonical_ac": "E9Q8B5-1", "protein_name": "Complement factor H-related 4", "gene_name": "Cfhr4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGFCSMLLLSNILLTAWLSTAKGEVKSCEFPQFKYGRLYYEEILRPNFPVSIGNKYSYKCDNGFSPPSGIFWDYLRCTVQGWEPEVPCVRKCVFHYVENGQSAYWEKIYVQGQSLKVQCYNGYSLQNGQDTMTCTENGWSPPPKCIRIKTCSVSDIEIENGFFSESFRTYALNRETSYRCKQGYVTNTGETSGSITCLQNGWSPQPSCIKSCERPVFENSVTKNNSTWFKLNDKLDYECLIGYENEYKHTKGSITCTYYGWSDTPSCYEIECSVPILDRKLVVSPRKEKYRVGDLLEFSCRSGHRVGPDSVQCYHFGWSPSFPTCKAGQVASCAQPPEIPNGEINGAKRVEYSHGEVVGYDCKPRFLLKGPNKIQCVDGMWTTLPVCVEEERTCGDIPELEHGSVKFSVPPYHHGDSVEFTCAETFTMIGLGSVFCLSGKWTQLPKCVATDQLEKCRVLKSTDIEAIKPKRKEFQHNSTMYYKCRDKQEYEHSICINGKWNPEPNCIRKISCPPPPQIPNTQVIETTVKYLDGEKLSVLCQDNYLTQDPEEMMCKDGRWQSLPHCIEKIPCSQPPTIEHGSIKLPRTSEKRRKSIEFSSHEHGTTFSYVCDDGFRIPEENGVACYMGKWSTPPRCVGLPCGPPPSIPLGTVSLELESYQHGEEVTYHCSTGFGIDGPALIKCEGGKWSDPPKCIKTDCDILPTIENAIIRGKNKKSYRTGEQVTVRCQSPYQMNGSDTVTCINGRWIGKPVCKDSRGKCGPPPPIDNGDITSLSLPEYEPFSSVDYQCQKYYLLKGKKTITCRNGKWSEPPTCLHACIIPENIMEARKIILKWRHTKNIYSHSGEDIEFECKYGYHKARGSPPFRTKCISGTINYPICE", "length": 879 }, "evidence": [ { "id": "45923117", "url": "http://www.informatics.jax.org/homology/45923117", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "G3V9R2-1", "protein_name": "Complement factor H", "gene_name": "Cfh", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MRLSARIIWLILWTVCVAEDCKGPPPRENSEILSGSWSEQLYSEGTQATYKCRPGYRTLGTIVKVCKNGEWVPSNPSRICRKRPCGHPGDTPFGSFRLAVGSEFEFGAKVVYTCDEGYQLLGEIDYRECDADGWTNDIPICEVVKCLPVTELENGRIVSGAAEPDQEYYFGQVVRFECNSGFKIEGQKEMHCSENGLWSNEKPQCVEISCLPPRVENGDGIYLKPVYKENERFQYKCKQGFVYKERGDAVCTGSGWNPQPSCEEMTCLTPYIPNGIYTPHRIKHRIDDEIRYECKNGFYPATRSPVSKCTITGWIPAPRCSLKPCDFPQFKHGRLYYEESRRPYFPVPIGKEYSYYCDNGFTTPSQSYWDYLRCTVNGWEPEVPCLRQCIFHYVEYGESLYWQRRYIEGQSAKVQCHSGYSLPNGQDTILCTENGWSPPPKCVRIKTCSVSDIEIENGFFSESDYTYALNRKTRYRCKQGYVTNTGEISGIITCLQDGWSPRPSCIKSCDMPVFENAMTKNNNTWFKLNDKLDYECHIGYENEYKHTKGSITCTYDGWSSTPSCYERECSIPLLHQDLVVFPREVKYKVGDSLSFSCRSGHRVGADLVQCYHFGWSPNFPTCEGQVKSCDQPLEIPNGEIKGTKKVEYSHGDVVEYDCKPRFLLKGPNKIQCVDGKWTTLPICVEYERTCGDLPALEHGSVQLSVPPYHHGDSVEFTCAETFTMIGHAVVFCISGRWTELPQCVATDQLEKCKAPKSTGIDAIHPNKNEFNHNFSVSYRCRQKQEYEHSICINGRWDPEPNCTRNEKRFCPPPPQIPNAQVIETTVKYLDGEKVSVLCQDGYLTQGPEEMVCKHGRWQSLPRCTEKIPCSQPPKIEHGSIKSPRSSEERDLIESSSYEHGTTFSYVCDDGFRISEENRVTCNMGKWSSLPRCVGIPCGPPPSIPLGIVSHELESYQYGEEVTYNCSEGFGIDGPAFIKCVGGQWSEPPKCIKTDCDNLPTFEIAKPTEKKKKSYRSGEQVTFRCPPPYRMDGSDIVTCVNTKWIGQPVCKDNSCVNPPHVPNATILTRHKTKYPSGDKVRYDCNKPFELFGEVEVMCQNGIWTEPPKCKDSTGKCGPPPPIDNGDITSLSLPVYAPLSSVEYQCQNYYLLKGNKIVTCRNGKWSQPPTCLHACVIPEDIMEKHNIVLRWRENAKIYSQSGENIEFMCKPGYRKFRGSPPFRTKCIEGHINYPTCV", "length": 1235 }, "evidence": [ { "id": "45923117", "url": "http://www.informatics.jax.org/homology/45923117", "database": "MGI" }, { "id": "45923124", "url": "http://www.informatics.jax.org/homology/45923124", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P06909-1", "protein_name": "Complement factor H", "gene_name": "Cfh", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRLSARIIWLILWTVCAAEDCKGPPPRENSEILSGSWSEQLYPEGTQATYKCRPGYRTLGTIVKVCKNGKWVASNPSRICRKKPCGHPGDTPFGSFRLAVGSQFEFGAKVVYTCDDGYQLLGEIDYRECGADGWINDIPLCEVVKCLPVTELENGRIVSGAAETDQEYYFGQVVRFECNSGFKIEGHKEIHCSENGLWSNEKPRCVEILCTPPRVENGDGINVKPVYKENERYHYKCKHGYVPKERGDAVCTGSGWSSQPFCEEKRCSPPYILNGIYTPHRIIHRSDDEIRYECNYGFYPVTGSTVSKCTPTGWIPVPRCTLKPCEFPQFKYGRLYYEESLRPNFPVSIGNKYSYKCDNGFSPPSGYSWDYLRCTAQGWEPEVPCVRKCVFHYVENGDSAYWEKVYVQGQSLKVQCYNGYSLQNGQDTMTCTENGWSPPPKCIRIKTCSASDIHIDNGFLSESSSIYALNRETSYRCKQGYVTNTGEISGSITCLQNGWSPQPSCIKSCDMPVFENSITKNTRTWFKLNDKLDYECLVGFENEYKHTKGSITCTYYGWSDTPSCYERECSVPTLDRKLVVSPRKEKYRVGDLLEFSCHSGHRVGPDSVQCYHFGWSPGFPTCKGQVASCAPPLEILNGEINGAKKVEYSHGEVVKYDCKPRFLLKGPNKIQCVDGNWTTLPVCIEEERTCGDIPELEHGSAKCSVPPYHHGDSVEFICEENFTMIGHGSVSCISGKWTQLPKCVATDQLEKCRVLKSTGIEAIKPKLTEFTHNSTMDYKCRDKQEYERSICINGKWDPEPNCTSKTSCPPPPQIPNTQVIETTVKYLDGEKLSVLCQDNYLTQDSEEMVCKDGRWQSLPRCIEKIPCSQPPTIEHGSINLPRSSEERRDSIESSSHEHGTTFSYVCDDGFRIPEENRITCYMGKWSTPPRCVGLPCGPPPSIPLGTVSLELESYQHGEEVTYHCSTGFGIDGPAFIICEGGKWSDPPKCIKTDCDVLPTVKNAIIRGKSKKSYRTGEQVTFRCQSPYQMNGSDTVTCVNSRWIGQPVCKDNSCVDPPHVPNATIVTRTKNKYLHGDRVRYECNKPLELFGQVEVMCENGIWTEKPKCRDSTGKCGPPPPIDNGDITSLSLPVYEPLSSVEYQCQKYYLLKGKKTITCRNGKWSEPPTCLHACVIPENIMESHNIILKWRHTEKIYSHSGEDIEFGCKYGYYKARDSPPFRTKCINGTINYPTCV", "length": 1234 }, "evidence": [ { "id": "45923124", "url": "http://www.informatics.jax.org/homology/45923124", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "pmid": "" }, { "name": "blood microparticle", "id": "GO:0072562", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072562", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "pmid": "" }, { "name": "serine-type endopeptidase complex", "id": "GO:1905370", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905370", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "pmid": "" }, { "name": "symbiont cell surface", "id": "GO:0106139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0106139", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "proteolysis", "id": "GO:0006508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006508", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "pmid": "" }, { "name": "regulation of complement activation", "id": "GO:0030449", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030449", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "pmid": "" }, { "name": "complement activation", "id": "GO:0006956", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006956", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "pmid": "" }, { "name": "complement activation, alternative pathway", "id": "GO:0006957", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006957", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "pmid": "" }, { "name": "regulation of complement-dependent cytotoxicity", "id": "GO:1903659", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903659", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "pmid": "" }, { "name": "regulation of complement activation, alternative pathway", "id": "GO:0030451", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030451", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "heparin binding", "id": "GO:0008201", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008201", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "pmid": "" }, { "name": "heparan sulfate proteoglycan binding", "id": "GO:0043395", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043395", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "pmid": "" }, { "name": "complement component C3b binding", "id": "GO:0001851", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001851", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "complement factor H N-glycosylated 1 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-1029 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P08603-1, Asn-1029, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054493", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054493" } ] }, { "name": "complement factor H N-glycosylated 2 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-1029 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G04909DG. Example: UniProtKB:P08603-1, Asn-1029, MOD:00160~GNO:G04909DG. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054494", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054494" } ] }, { "name": "complement factor H N-glycosylated 3 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-1029 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G08146BT. Example: UniProtKB:P08603-1, Asn-1029, MOD:00160~GNO:G08146BT. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054495", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054495" } ] }, { "name": "complement factor H N-glycosylated 4 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-1029 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan composition is represented by GlyTouCan:G08293MJ. Example: UniProtKB:P08603-1, Asn-1029, MOD:00160~GNO:G08293MJ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054496", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054496" } ] }, { "name": "complement factor H N-glycosylated 5 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-1029 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G42358LZ. Example: UniProtKB:P08603-1, Asn-1029, MOD:00160~GNO:G42358LZ. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054497", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054497" } ] }, { "name": "complement factor H N-glycosylated 6 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-1029 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G51941GC. Example: UniProtKB:P08603-1, Asn-1029, MOD:00160~GNO:G51941GC. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054498", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054498" } ] }, { "name": "complement factor H N-glycosylated 7 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-1029 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P08603-1, Asn-1029, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054499", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054499" } ] }, { "name": "complement factor H N-glycosylated 8 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-1029 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G93860XO. Example: UniProtKB:P08603-1, Asn-1029, MOD:00160~GNO:G93860XO. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054500", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054500" } ] }, { "name": "complement factor H N-glycosylated 9 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-1095 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P08603-1, Asn-1095, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054501", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054501" } ] }, { "name": "complement factor H N-glycosylated 10 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-1095 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G04909DG. Example: UniProtKB:P08603-1, Asn-1095, MOD:00160~GNO:G04909DG. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054502", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054502" } ] }, { "name": "complement factor H N-glycosylated 11 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-1095 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G08146BT. Example: UniProtKB:P08603-1, Asn-1095, MOD:00160~GNO:G08146BT. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054503", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054503" } ] }, { "name": "complement factor H N-glycosylated 12 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-1095 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G42358LZ. Example: UniProtKB:P08603-1, Asn-1095, MOD:00160~GNO:G42358LZ. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054504", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054504" } ] }, { "name": "complement factor H N-glycosylated 13 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-1095 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G75221WP. Example: UniProtKB:P08603-1, Asn-1095, MOD:00160~GNO:G75221WP. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054505", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054505" } ] }, { "name": "complement factor H N-glycosylated 14 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-1095 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G93860XO. Example: UniProtKB:P08603-1, Asn-1095, MOD:00160~GNO:G93860XO. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054506", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054506" } ] }, { "name": "complement factor H N-glycosylated 15 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-217 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P08603-1, Asn-217, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054507", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054507" } ] }, { "name": "complement factor H N-glycosylated 16 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-802 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G04909DG. Example: UniProtKB:P08603-1, Asn-802, MOD:00160~GNO:G04909DG. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054508", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054508" } ] }, { "name": "complement factor H N-glycosylated 17 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-802 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G08146BT. Example: UniProtKB:P08603-1, Asn-802, MOD:00160~GNO:G08146BT. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054509", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054509" } ] }, { "name": "complement factor H N-glycosylated 18 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-802 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G22140GZ. Example: UniProtKB:P08603-1, Asn-802, MOD:00160~GNO:G22140GZ. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054510", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054510" } ] }, { "name": "complement factor H N-glycosylated 19 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-802 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan composition is represented by GlyTouCan:G37399XV. Example: UniProtKB:P08603-1, Asn-802, MOD:00160~GNO:G37399XV. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054511", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054511" } ] }, { "name": "complement factor H N-glycosylated 20 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-802 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G42358LZ. Example: UniProtKB:P08603-1, Asn-802, MOD:00160~GNO:G42358LZ. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054512", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054512" } ] }, { "name": "complement factor H N-glycosylated 21 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-802 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G57818FI. Example: UniProtKB:P08603-1, Asn-802, MOD:00160~GNO:G57818FI. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054513", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054513" } ] }, { "name": "complement factor H N-glycosylated 22 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-802 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G75221WP. Example: UniProtKB:P08603-1, Asn-802, MOD:00160~GNO:G75221WP. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054514", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054514" } ] }, { "name": "complement factor H N-glycosylated 23 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-822 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P08603-1, Asn-822, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054515", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054515" } ] }, { "name": "complement factor H N-glycosylated 24 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-822 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G04909DG. Example: UniProtKB:P08603-1, Asn-822, MOD:00160~GNO:G04909DG. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054516", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054516" } ] }, { "name": "complement factor H N-glycosylated 25 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-822 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan composition is represented by GlyTouCan:G06247RL. Example: UniProtKB:P08603-1, Asn-822, MOD:00160~GNO:G06247RL. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054517", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054517" } ] }, { "name": "complement factor H N-glycosylated 26 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-822 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G08146BT. Example: UniProtKB:P08603-1, Asn-822, MOD:00160~GNO:G08146BT. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054518", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054518" } ] }, { "name": "complement factor H N-glycosylated 27 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-822 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G42358LZ. Example: UniProtKB:P08603-1, Asn-822, MOD:00160~GNO:G42358LZ. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054519", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054519" } ] }, { "name": "complement factor H N-glycosylated 28 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-822 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G51941GC. Example: UniProtKB:P08603-1, Asn-822, MOD:00160~GNO:G51941GC. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054520", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054520" } ] }, { "name": "complement factor H N-glycosylated 29 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-822 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G75221WP. Example: UniProtKB:P08603-1, Asn-822, MOD:00160~GNO:G75221WP. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054521", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054521" } ] }, { "name": "complement factor H N-glycosylated 30 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-822 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan composition is represented by GlyTouCan:G88374WZ. Example: UniProtKB:P08603-1, Asn-822, MOD:00160~GNO:G88374WZ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054522", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054522" } ] }, { "name": "complement factor H N-glycosylated 31 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-822 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G93860XO. Example: UniProtKB:P08603-1, Asn-822, MOD:00160~GNO:G93860XO. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054523", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054523" } ] }, { "name": "complement factor H N-glycosylated 32 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-882 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P08603-1, Asn-882, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054524", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054524" } ] }, { "name": "complement factor H N-glycosylated 33 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-882 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G04909DG. Example: UniProtKB:P08603-1, Asn-882, MOD:00160~GNO:G04909DG. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054525", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054525" } ] }, { "name": "complement factor H N-glycosylated 34 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-882 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan composition is represented by GlyTouCan:G06247RL. Example: UniProtKB:P08603-1, Asn-882, MOD:00160~GNO:G06247RL. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054526", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054526" } ] }, { "name": "complement factor H N-glycosylated 35 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-882 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G08146BT. Example: UniProtKB:P08603-1, Asn-882, MOD:00160~GNO:G08146BT. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054527", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054527" } ] }, { "name": "complement factor H N-glycosylated 36 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-882 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G22140GZ. Example: UniProtKB:P08603-1, Asn-882, MOD:00160~GNO:G22140GZ. [PRO:DNx, PMID:19838169]", "evidence": [ { "id": "PR:000054528", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054528" } ] }, { "name": "complement factor H N-glycosylated 37 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-882 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan composition is represented by GlyTouCan:G27947YN. Example: UniProtKB:P08603-1, Asn-882, MOD:00160~GNO:G27947YN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054529", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054529" } ] }, { "name": "complement factor H N-glycosylated 38 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-882 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G42358LZ. Example: UniProtKB:P08603-1, Asn-882, MOD:00160~GNO:G42358LZ. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054530", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054530" } ] }, { "name": "complement factor H N-glycosylated 39 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-882 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G51941GC. Example: UniProtKB:P08603-1, Asn-882, MOD:00160~GNO:G51941GC. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054531", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054531" } ] }, { "name": "complement factor H N-glycosylated 40 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-882 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P08603-1, Asn-882, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054532", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054532" } ] }, { "name": "complement factor H N-glycosylated 41 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-882 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G75221WP. Example: UniProtKB:P08603-1, Asn-882, MOD:00160~GNO:G75221WP. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054533", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054533" } ] }, { "name": "complement factor H N-glycosylated 42 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-882 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan composition is represented by GlyTouCan:G85144OK. Example: UniProtKB:P08603-1, Asn-882, MOD:00160~GNO:G85144OK. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054534", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054534" } ] }, { "name": "complement factor H N-glycosylated 43 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-882 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan composition is represented by GlyTouCan:G88374WZ. Example: UniProtKB:P08603-1, Asn-882, MOD:00160~GNO:G88374WZ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054535", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054535" } ] }, { "name": "complement factor H N-glycosylated 44 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-882 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G93860XO. Example: UniProtKB:P08603-1, Asn-882, MOD:00160~GNO:G93860XO. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054536", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054536" } ] }, { "name": "complement factor H N-glycosylated 45 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-882 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan composition is represented by GlyTouCan:G94917XT. Example: UniProtKB:P08603-1, Asn-882, MOD:00160~GNO:G94917XT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054537", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054537" } ] }, { "name": "complement factor H N-glycosylated 46 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-882 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan composition is represented by GlyTouCan:G95865ZB. Example: UniProtKB:P08603-1, Asn-882, MOD:00160~GNO:G95865ZB. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054538", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054538" } ] }, { "name": "complement factor H N-glycosylated 47 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-911 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P08603-1, Asn-911, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054539", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054539" } ] }, { "name": "complement factor H N-glycosylated 48 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-911 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G04909DG. Example: UniProtKB:P08603-1, Asn-911, MOD:00160~GNO:G04909DG. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054540", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054540" } ] }, { "name": "complement factor H N-glycosylated 49 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-911 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan composition is represented by GlyTouCan:G06247RL. Example: UniProtKB:P08603-1, Asn-911, MOD:00160~GNO:G06247RL. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054541", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054541" } ] }, { "name": "complement factor H N-glycosylated 50 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-911 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G08146BT. Example: UniProtKB:P08603-1, Asn-911, MOD:00160~GNO:G08146BT. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054542", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054542" } ] }, { "name": "complement factor H N-glycosylated 51 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-911 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan composition is represented by GlyTouCan:G27947YN. Example: UniProtKB:P08603-1, Asn-911, MOD:00160~GNO:G27947YN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054543", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054543" } ] }, { "name": "complement factor H N-glycosylated 52 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-911 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G42358LZ. Example: UniProtKB:P08603-1, Asn-911, MOD:00160~GNO:G42358LZ. [PRO:DNx, PMID:17591618, PMID:24279413]", "evidence": [ { "id": "PR:000054544", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054544" } ] }, { "name": "complement factor H N-glycosylated 53 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-911 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G51941GC. Example: UniProtKB:P08603-1, Asn-911, MOD:00160~GNO:G51941GC. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054545", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054545" } ] }, { "name": "complement factor H N-glycosylated 54 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-911 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P08603-1, Asn-911, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054546", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054546" } ] }, { "name": "complement factor H N-glycosylated 55 (human)", "definition": "A complement factor H (human) that has been N-glycosylated at the residue equivalent to Asn-911 of the amino acid sequence represented by UniProtKB:P08603-1, in which the glycan structure is represented by GlyTouCan:G93860XO. Example: UniProtKB:P08603-1, Asn-911, MOD:00160~GNO:G93860XO. [PRO:DNx, PMID:17591618]", "evidence": [ { "id": "PR:000054547", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054547" } ] } ], "site_annotation": [ { "start_pos": 1029, "end_pos": 1031, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1095, "end_pos": 1097, "annotation": "n_glycosylation_sequon" }, { "start_pos": 217, "end_pos": 219, "annotation": "n_glycosylation_sequon" }, { "start_pos": 529, "end_pos": 531, "annotation": "n_glycosylation_sequon" }, { "start_pos": 718, "end_pos": 720, "annotation": "n_glycosylation_sequon" }, { "start_pos": 802, "end_pos": 804, "annotation": "n_glycosylation_sequon" }, { "start_pos": 822, "end_pos": 824, "annotation": "n_glycosylation_sequon" }, { "start_pos": 882, "end_pos": 884, "annotation": "n_glycosylation_sequon" }, { "start_pos": 911, "end_pos": 913, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Sulfated on tyrosine residues.", "evidence": [ { "database": "UniProtKB", "id": "P08603", "url": "https://www.uniprot.org/uniprot/P08603" }, { "database": "PubMed", "id": "25136834", "url": "https://glygen.org/publication/PubMed/25136834" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 217, 529, 718, 802, 822, 882, 911, 1029, 1095 ], "o_linked_sites": [], "snv_sites": [ 39, 217, 232, 240, 307, 308, 518, 531, 542, 671, 718, 776, 778, 802, 822, 824, 834, 884, 893, 898, 911, 1031, 1036, 1045, 1095, 1097, 1104 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 1029, "end_pos": 1031 }, { "start_pos": 1095, "end_pos": 1097 }, { "start_pos": 217, "end_pos": 219 }, { "start_pos": 529, "end_pos": 531 }, { "start_pos": 718, "end_pos": 720 }, { "start_pos": 802, "end_pos": 804 }, { "start_pos": 822, "end_pos": 824 }, { "start_pos": 882, "end_pos": 884 }, { "start_pos": 911, "end_pos": 913 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 202 }, { "field": "total_sites", "count": 9 }, { "field": "n_linked_glycans", "count": 66 }, { "field": "n_linked_glycan_sites", "count": 18 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 9 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 9 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 193 }, { "field": "total_sites", "count": 9 }, { "field": "n_linked_glycans", "count": 66 }, { "field": "n_linked_glycan_sites", "count": 9 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 34 }, { "field": "total_sites", "count": 27 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 34 }, { "field": "total_sites", "count": 27 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 130 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }