{
"uniprot_canonical_ac": "P08263-1",
"uniprot_ac": "P08263",
"uniprot_id": "GSTA1_HUMAN",
"mass": {
"chemical_mass": 25631.0,
"monoisotopic_mass": 25631.0
},
"refseq": {
"ac": "NP_665683",
"name": "glutathione S-transferase A1 isoform 1",
"summary": "This gene encodes a member of a family of enzymes that function to add glutathione to target electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. This action is an important step in detoxification of these compounds. This subfamily of enzymes has a particular role in protecting cells from reactive oxygen species and the products of peroxidation. Polymorphisms in this gene influence the ability of individuals to metabolize different drugs. This gene is located in a cluster of similar genes and pseudogenes on chromosome 6. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016].",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_665683"
},
"gene_names": [
{
"name": "GSTA1",
"resource": "UniProtKB",
"type": "recommended",
"url": "https://www.uniprot.org/uniprot/P08263",
"id": "P08263"
},
{
"name": "GST-epsilon; GST2; GSTA1-1; GTH1",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_665683",
"id": "NP_665683"
},
{
"name": "GSTA1",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_665683",
"id": "NP_665683"
}
],
"protein_names": [
{
"name": "Glutathione S-transferase A1",
"resource": "UniProtKB",
"type": "recommended",
"url": "",
"id": "P08263"
},
{
"name": "1.11.1.-",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P08263"
},
{
"name": "13-hydroperoxyoctadecadienoate peroxidase",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P08263"
},
{
"name": "2.5.1.18",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P08263"
},
{
"name": "5.3.3.-",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P08263"
},
{
"name": "Androst-5-ene-3,17-dione isomerase",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P08263"
},
{
"name": "GST HA subunit 1",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P08263"
},
{
"name": "GST class-alpha member 1",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P08263"
},
{
"name": "GST-epsilon",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P08263"
},
{
"name": "GSTA1-1",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P08263"
},
{
"name": "GTH1",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P08263"
},
{
"name": "glutathione S-transferase A1 isoform 1",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_665683",
"id": "NP_665683"
},
{
"name": "glutathione S-transferase A1; glutathione S-alkyltransferase A1; glutathione S-aryltransferase A1; S-(hydroxyalkyl)glutathione lyase A1; glutathione S-transferase 2; glutathione S-transferase Ha subunit 1; GST HA subunit 1; GST class-alpha member 1; testicular tissue protein Li 80; androst-5-ene-3,17-dione isomerase; 13-hydroperoxyoctadecadienoate peroxidase",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_665683",
"id": "NP_665683"
}
],
"function": [
{
"annotation": "Comparison of the tissue expressions of glutathione S transferase isoenzymes among patients with morphea and healthy controls: A preliminary study.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_665683",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_665683"
},
{
"database": "PubMed",
"id": "33002252",
"url": "https://glygen.org/publication/PubMed/33002252"
}
]
},
{
"annotation": "Glutathione S-transferase that catalyzes the nucleophilic attack of the sulfur atom of glutathione on the electrophilic groups of a wide range of exogenous and endogenous compounds (Probable). Involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2) (PubMed:9084911). It also catalyzes the isomerization of D5-androstene-3,17-dione (AD) into D4-androstene-3,17-dione and may therefore play an important role in hormone biosynthesis (PubMed:11152686). Through its glutathione-dependent peroxidase activity toward the fatty acid hydroperoxide (13S)-hydroperoxy-(9Z,11E)-octadecadienoate/13-HPODE it is also involved in the metabolism of oxidized linoleic acid (PubMed:16624487).",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263#function"
},
{
"database": "PubMed",
"id": "11152686",
"url": "https://glygen.org/publication/PubMed/11152686"
},
{
"database": "PubMed",
"id": "16624487",
"url": "https://glygen.org/publication/PubMed/16624487"
},
{
"database": "PubMed",
"id": "20606271",
"url": "https://glygen.org/publication/PubMed/20606271"
},
{
"database": "PubMed",
"id": "9084911",
"url": "https://glygen.org/publication/PubMed/9084911"
}
]
},
{
"annotation": "Influence of Glutathione-S-Transferase A1*B Allele on the Metabolism of the Aromatase Inhibitor, Exemestane, in Human Liver Cytosols and in Patients Treated With Exemestane.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_665683",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_665683"
},
{
"database": "PubMed",
"id": "35793834",
"url": "https://glygen.org/publication/PubMed/35793834"
}
]
},
{
"annotation": "Population pharmacokinetic analysis of intravenous busulfan: GSTA1 genotype is not a predictive factor of initial dose in Chinese adult patients undergoing hematopoietic stem cell transplantation.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_665683",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_665683"
},
{
"database": "PubMed",
"id": "31834435",
"url": "https://glygen.org/publication/PubMed/31834435"
}
]
},
{
"annotation": "The Interaction of Human Glutathione Transferase GSTA1-1 with Reactive Dyes. Publication Status: Online-Only",
"evidence": [
{
"database": "RefSeq",
"id": "NP_665683",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_665683"
},
{
"database": "PubMed",
"id": "33924269",
"url": "https://glygen.org/publication/PubMed/33924269"
}
]
},
{
"annotation": "The analysis of GSTA1 promoter genetic and functional diversity of human populations. Publication Status: Online-Only",
"evidence": [
{
"database": "RefSeq",
"id": "NP_665683",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_665683"
},
{
"database": "PubMed",
"id": "33658540",
"url": "https://glygen.org/publication/PubMed/33658540"
}
]
},
{
"annotation": "This gene encodes a member of a family of enzymes that function to add glutathione to target electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. This action is an important step in detoxification of these compounds. This subfamily of enzymes has a particular role in protecting cells from reactive oxygen species and the products of peroxidation. Polymorphisms in this gene influence the ability of individuals to metabolize different drugs. This gene is located in a cluster of similar genes and pseudogenes on chromosome 6. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016].",
"evidence": [
{
"database": "RefSeq",
"id": "NP_665683",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_665683"
}
]
}
],
"disease": [],
"snv": [],
"mutagenesis": [
{
"start_pos": 216,
"end_pos": 216,
"sequence_org": "A",
"sequence_mut": "H",
"comment": "Confers ability to hydrolyze S-glutathionyl benzoate to glutathione and benzoic acid.",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
},
{
"database": "PubMed",
"id": "15333749",
"url": "https://glygen.org/publication/PubMed/15333749"
}
]
},
{
"start_pos": 71,
"end_pos": 71,
"sequence_org": "I",
"sequence_mut": "A",
"comment": "No significant effect on enzyme activity. Reduces protein stability.",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
},
{
"database": "PubMed",
"id": "20606271",
"url": "https://glygen.org/publication/PubMed/20606271"
}
]
},
{
"start_pos": 71,
"end_pos": 71,
"sequence_org": "I",
"sequence_mut": "V",
"comment": "No significant effect on enzyme activity. Reduces protein stability.",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
},
{
"database": "PubMed",
"id": "20606271",
"url": "https://glygen.org/publication/PubMed/20606271"
}
]
},
{
"start_pos": 9,
"end_pos": 9,
"sequence_org": "Y",
"sequence_mut": "F",
"comment": "Decreased isomerase activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
},
{
"database": "PubMed",
"id": "11152686",
"url": "https://glygen.org/publication/PubMed/11152686"
}
]
}
],
"expression_tissue": [
{
"tissue": {
"name": "Adult mammalian kidney",
"namespace": "UBERON",
"id": "0000082",
"url": "http://purl.obolibrary.org/obo/UBERON_0000082"
},
"score": "97.7",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000243955",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000243955"
}
]
},
{
"tissue": {
"name": "Oral cavity",
"namespace": "UBERON",
"id": "0000167",
"url": "http://purl.obolibrary.org/obo/UBERON_0000167"
},
"score": "83.61",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000243955",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000243955"
}
]
},
{
"tissue": {
"name": "Stomach",
"namespace": "UBERON",
"id": "0000945",
"url": "http://purl.obolibrary.org/obo/UBERON_0000945"
},
"score": "89.75",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000243955",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000243955"
}
]
},
{
"tissue": {
"name": "Uterus",
"namespace": "UBERON",
"id": "0000995",
"url": "http://purl.obolibrary.org/obo/UBERON_0000995"
},
"score": "49.96",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000243955",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000243955"
}
]
},
{
"tissue": {
"name": "Esophagus",
"namespace": "UBERON",
"id": "0001043",
"url": "http://purl.obolibrary.org/obo/UBERON_0001043"
},
"score": "53.65",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000243955",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000243955"
}
]
},
{
"tissue": {
"name": "Rectum",
"namespace": "UBERON",
"id": "0001052",
"url": "http://purl.obolibrary.org/obo/UBERON_0001052"
},
"score": "77.9",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000243955",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000243955"
}
]
},
{
"tissue": {
"name": "Colon",
"namespace": "UBERON",
"id": "0001155",
"url": "http://purl.obolibrary.org/obo/UBERON_0001155"
},
"score": "63.02",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000243955",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000243955"
}
]
},
{
"tissue": {
"name": "Urinary bladder",
"namespace": "UBERON",
"id": "0001255",
"url": "http://purl.obolibrary.org/obo/UBERON_0001255"
},
"score": "68.54",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000243955",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000243955"
}
]
},
{
"tissue": {
"name": "Thyroid gland",
"namespace": "UBERON",
"id": "0002046",
"url": "http://purl.obolibrary.org/obo/UBERON_0002046"
},
"score": "50.54",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000243955",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000243955"
}
]
},
{
"tissue": {
"name": "Lung",
"namespace": "UBERON",
"id": "0002048",
"url": "http://purl.obolibrary.org/obo/UBERON_0002048"
},
"score": "67.79",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000243955",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000243955"
}
]
},
{
"tissue": {
"name": "Liver",
"namespace": "UBERON",
"id": "0002107",
"url": "http://purl.obolibrary.org/obo/UBERON_0002107"
},
"score": "97.65",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000243955",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000243955"
}
]
},
{
"tissue": {
"name": "Prostate gland",
"namespace": "UBERON",
"id": "0002367",
"url": "http://purl.obolibrary.org/obo/UBERON_0002367"
},
"score": "81.58",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000243955",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000243955"
}
]
},
{
"tissue": {
"name": "Thoracic mammary gland",
"namespace": "UBERON",
"id": "0005200",
"url": "http://purl.obolibrary.org/obo/UBERON_0005200"
},
"score": "69.12",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000243955",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000243955"
}
]
}
],
"expression_disease": [
{
"significant": "Yes",
"trend": "down",
"name": "Prostate cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10283",
"evidence": [
{
"database": "BioXpress",
"id": "P08263",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08263"
}
],
"disease": [
{
"disease_id": "DOID:10283",
"recommended_name": {
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer",
"description": "A male reproductive organ cancer that is located_in the prostate."
},
"synonyms": [
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "NGP - new growth of prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "malignant tumor of the prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "tumor of the prostate",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, type 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "HPC9",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "EHBP1 familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "familial prostate cancer caused by mutation in EHBP1",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, type 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "HPC12",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, type 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "HPC5",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, type 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, susceptibility to, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "HPC3",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, type 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, susceptibility to, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "HPC4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, on chromosome 7",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "MSMB familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "familial prostate cancer caused by mutation in MSMB",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, type 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "HPC13",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, type 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "HPC8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "predisposing for prostate cancer",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, type 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "HPC6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "HPC10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate carcinoma",
"description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate carcinoma",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, somatic",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, hereditary",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "HPC7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer aggressiveness",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "RNASEL familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "familial prostate cancer caused by mutation in RNASEL",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, type 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "HPC1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "Prca1",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "HPC11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "HPC14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "HPC15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "HPCX1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer susceptibility, X-linked",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "HPCX2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MIM:611868",
"resource": "MIM",
"url": "https://www.omim.org/entry/611868",
"name": "Prostate cancer, hereditary, 12",
"description": "Prostate cancer, hereditary, 12"
},
{
"id": "MIM:611928",
"resource": "MIM",
"url": "https://www.omim.org/entry/611928",
"name": "Prostate cancer, hereditary, 13",
"description": "Prostate cancer, hereditary, 13"
},
{
"id": "MIM:176807",
"resource": "MIM",
"url": "https://www.omim.org/entry/176807",
"name": "Prostate cancer",
"description": "Prostate cancer"
},
{
"id": "MIM:601518",
"resource": "MIM",
"url": "https://www.omim.org/entry/601518",
"name": "Prostate cancer, hereditary, 1",
"description": "Prostate cancer, hereditary, 1"
},
{
"id": "MIM:611955",
"resource": "MIM",
"url": "https://www.omim.org/entry/611955",
"name": "Prostate cancer, hereditary, 11",
"description": "Prostate cancer, hereditary, 11"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Stomach cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10534",
"evidence": [
{
"database": "BioXpress",
"id": "P08263",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08263"
}
],
"disease": [
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Urinary bladder cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11054",
"evidence": [
{
"database": "BioXpress",
"id": "P08263",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08263"
}
],
"disease": [
{
"disease_id": "DOID:11054",
"recommended_name": {
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "urinary bladder cancer",
"description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
},
"synonyms": [
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "bladder cancer",
"description": ""
},
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": "A primary or metastatic malignant neoplasm involving the bladder."
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "bladder cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "cancer of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumour",
"description": ""
},
{
"id": "MIM:109800",
"resource": "MIM",
"url": "https://www.omim.org/entry/109800",
"name": "Bladder cancer",
"description": "Bladder cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Head and neck cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11934",
"evidence": [
{
"database": "BioXpress",
"id": "P08263",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08263"
}
],
"disease": [
{
"disease_id": "DOID:11934",
"recommended_name": {
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck cancer",
"description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx."
},
"synonyms": [
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck tumours",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head/neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "tumor of head and neck",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Lung cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1324",
"evidence": [
{
"database": "BioXpress",
"id": "P08263",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08263"
}
],
"disease": [
{
"disease_id": "DOID:1324",
"recommended_name": {
"id": "DOID:1324",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1324",
"name": "lung cancer",
"description": "A respiratory system cancer that is located_in the lung."
},
"synonyms": [
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "LNCR1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "LNCR3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "adenocarcinoma of lung, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "LNCR4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "LNCR5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": "A malignant neoplasm involving the lung."
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "cancer of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung neoplasm",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumor",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumour",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "Nonsmall cell lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "alveolar cell carcinoma",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung neoplasm",
"description": ""
},
{
"id": "MIM:211980",
"resource": "MIM",
"url": "https://www.omim.org/entry/211980",
"name": "Lung cancer",
"description": "Lung cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Breast cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1612",
"evidence": [
{
"database": "BioXpress",
"id": "P08263",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08263"
}
],
"disease": [
{
"disease_id": "DOID:1612",
"recommended_name": {
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast cancer",
"description": "A thoracic cancer that originates in the mammary gland."
},
"synonyms": [
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant neoplasm of breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant tumor of the breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary cancer",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "primary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, lobular, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of the breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial Male",
"description": ""
},
{
"id": "MIM:114480",
"resource": "MIM",
"url": "https://www.omim.org/entry/114480",
"name": "Breast cancer",
"description": "Breast cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Thyroid cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1781",
"evidence": [
{
"database": "BioXpress",
"id": "P08263",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08263"
}
],
"disease": [
{
"disease_id": "DOID:1781",
"recommended_name": {
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid cancer",
"description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage."
},
"synonyms": [
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid gland cancer",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "Thyroid gland neoplasm",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant tumour of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Kidney cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:263",
"evidence": [
{
"database": "BioXpress",
"id": "P08263",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08263"
}
],
"disease": [
{
"disease_id": "DOID:263",
"recommended_name": {
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "kidney cancer",
"description": "A urinary system cancer that is located_in the kidney."
},
"synonyms": [
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant neoplasm of kidney except pelvis",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant tumour of kidney",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "renal cancer",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Liver cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:3571",
"evidence": [
{
"database": "BioXpress",
"id": "P08263",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08263"
}
],
"disease": [
{
"disease_id": "DOID:3571",
"recommended_name": {
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "liver cancer",
"description": "A hepatobiliary system cancer that is located_in the liver."
},
"synonyms": [
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Ca liver - primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Resectable malignant neoplasm of Liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant hepato-biliary neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant tumor of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "non-resectable primary hepatic malignant neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary liver cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "resectable malignant neoplasm of the liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, not specified as primary or secondary",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Uterine cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:363",
"evidence": [
{
"database": "BioXpress",
"id": "P08263",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08263"
}
],
"disease": [
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "down",
"name": "Esophageal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:5041",
"evidence": [
{
"database": "BioXpress",
"id": "P08263",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08263"
}
],
"disease": [
{
"disease_id": "DOID:5041",
"recommended_name": {
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophageal cancer",
"description": "A gastrointestinal system cancer that is located_in the esophagus."
},
"synonyms": [
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophagus cancer",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Distal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Proximal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of the middle Third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": "A primary or metastatic malignant neoplasm involving the esophagus."
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "oesophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the middle third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of abdominal oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the middle third of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Aerodigestive tract cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Escc, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "gastric cardia adenocarcinoma, susceptibility to",
"description": ""
},
{
"id": "MIM:133239",
"resource": "MIM",
"url": "https://www.omim.org/entry/133239",
"name": "Esophageal cancer",
"description": "Esophageal cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Colorectal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:9256",
"evidence": [
{
"database": "BioXpress",
"id": "P08263",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08263"
}
],
"disease": [
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
}
]
}
],
"species": [
{
"name": "Homo sapiens",
"taxid": 9606,
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"common_name": "Human"
}
],
"gene": [
{
"name": "GSTA1",
"url": "https://www.uniprot.org/uniprot/P08263",
"locus": {
"chromosome": "6",
"start_pos": 52791371,
"end_pos": 52803860,
"strand": "+",
"evidence": [
{
"database": "Ensembl Gene",
"id": "ENSG00000243955",
"url": "https://www.ensembl.org/id/ENSG00000243955"
}
]
}
}
],
"crossref": [
{
"id": "ENSG00000243955",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000243955",
"database": "Bgee",
"categories": [
"Gene Expression"
]
},
{
"id": "2.5.1.18",
"url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.5.1.18&UniProtAcc=P08263",
"database": "BRENDA",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "cd03077",
"url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03077",
"database": "CDD",
"categories": [
"Protein Classification"
]
},
{
"id": "cd03208",
"url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03208",
"database": "CDD",
"categories": [
"Protein Classification"
]
},
{
"id": "CHEMBL3409",
"url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3409",
"database": "ChEMBL",
"categories": [
"Other"
]
},
{
"id": "GSTA1",
"url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=GSTA1",
"database": "GeneCards",
"categories": [
"Gene Annotation",
"Organism-specific"
]
},
{
"id": "2938",
"url": "https://www.ncbi.nlm.nih.gov/gene/2938",
"database": "GeneID",
"categories": [
"Genome Annotation"
]
},
{
"id": "4626",
"url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4626",
"database": "HGNC",
"categories": [
"Organism-specific"
]
},
{
"id": "P08263",
"url": "https://www.ebi.ac.uk/intact/interactors/id:P08263*",
"database": "IntAct",
"categories": [
"Other"
]
},
{
"id": "IPR003080",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR003080",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR004045",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR004045",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR004046",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR004046",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR010987",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR010987",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR036249",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR036249",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR036282",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR036282",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR040079",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR040079",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "hsa:2938",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2938",
"database": "KEGG Pathway",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "138359",
"url": "http://www.omim.org/entry/138359",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "NX_P08263",
"url": "https://www.nextprot.org/entry/NX_P08263",
"database": "neXtProt",
"categories": [
"Protein",
"Organism-specific"
]
},
{
"id": "NEMIIVL",
"url": "https://omabrowser.org/oma/group/NEMIIVL/",
"database": "OMA",
"categories": [
"Protein Classification"
]
},
{
"id": "3412208at2759",
"url": "http://www.orthodb.org/?query=3412208at2759",
"database": "OrthoDB",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR11571",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11571",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR11571:SF157",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11571:SF157",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "1GSD",
"url": "https://www.rcsb.org/structure/1GSD",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1GSE",
"url": "https://www.rcsb.org/structure/1GSE",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1GSF",
"url": "https://www.rcsb.org/structure/1GSF",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1GUH",
"url": "https://www.rcsb.org/structure/1GUH",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1K3L",
"url": "https://www.rcsb.org/structure/1K3L",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1K3O",
"url": "https://www.rcsb.org/structure/1K3O",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1K3Y",
"url": "https://www.rcsb.org/structure/1K3Y",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1LBK",
"url": "https://www.rcsb.org/structure/1LBK",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1PKW",
"url": "https://www.rcsb.org/structure/1PKW",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1PKZ",
"url": "https://www.rcsb.org/structure/1PKZ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1PL1",
"url": "https://www.rcsb.org/structure/1PL1",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1PL2",
"url": "https://www.rcsb.org/structure/1PL2",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1USB",
"url": "https://www.rcsb.org/structure/1USB",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1XWG",
"url": "https://www.rcsb.org/structure/1XWG",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1YDK",
"url": "https://www.rcsb.org/structure/1YDK",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2R3X",
"url": "https://www.rcsb.org/structure/2R3X",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2R6K",
"url": "https://www.rcsb.org/structure/2R6K",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3I69",
"url": "https://www.rcsb.org/structure/3I69",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3I6A",
"url": "https://www.rcsb.org/structure/3I6A",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3IK9",
"url": "https://www.rcsb.org/structure/3IK9",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3KTL",
"url": "https://www.rcsb.org/structure/3KTL",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3L0H",
"url": "https://www.rcsb.org/structure/3L0H",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3Q74",
"url": "https://www.rcsb.org/structure/3Q74",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3U6V",
"url": "https://www.rcsb.org/structure/3U6V",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3ZFB",
"url": "https://www.rcsb.org/structure/3ZFB",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3ZFL",
"url": "https://www.rcsb.org/structure/3ZFL",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4HJ2",
"url": "https://www.rcsb.org/structure/4HJ2",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5JCU",
"url": "https://www.rcsb.org/structure/5JCU",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5LCZ",
"url": "https://www.rcsb.org/structure/5LCZ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5LD0",
"url": "https://www.rcsb.org/structure/5LD0",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6ATO",
"url": "https://www.rcsb.org/structure/6ATO",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6ATP",
"url": "https://www.rcsb.org/structure/6ATP",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6ATQ",
"url": "https://www.rcsb.org/structure/6ATQ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6ATR",
"url": "https://www.rcsb.org/structure/6ATR",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6YAW",
"url": "https://www.rcsb.org/structure/6YAW",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7BIB",
"url": "https://www.rcsb.org/structure/7BIB",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7BIC",
"url": "https://www.rcsb.org/structure/7BIC",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8BHC",
"url": "https://www.rcsb.org/structure/8BHC",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8BHE",
"url": "https://www.rcsb.org/structure/8BHE",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "PF00043",
"url": "http://pfam.xfam.org/family/PF00043",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "PF02798",
"url": "http://pfam.xfam.org/family/PF02798",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "P08263",
"url": "https://pharos.nih.gov/targets/P08263",
"database": "PHAROS",
"categories": [
"Organism-specific"
]
},
{
"id": "PR_P08263",
"url": "http://purl.obolibrary.org/obo/PR_P08263",
"database": "PRO",
"categories": [
"Protein"
]
},
{
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "NP_665683",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_665683",
"database": "RefSeq",
"categories": [
"Protein"
]
},
{
"id": "16437",
"url": "https://www.rhea-db.org/rhea/16437",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "43936",
"url": "https://www.rhea-db.org/rhea/43936",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "48888",
"url": "https://www.rhea-db.org/rhea/48888",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "50796",
"url": "https://www.rhea-db.org/rhea/50796",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "50804",
"url": "https://www.rhea-db.org/rhea/50804",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P08263-1",
"url": "https://www.uniprot.org/uniprot/P08263-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
}
],
"sequence": {
"sequence": "MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAKLALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEEARKIFRF",
"length": 222,
"header": "sp|P08263-1|GSTA1_HUMAN Isoform 1 of Glutathione S-transferase A1 OS=Homo sapiens OX=9606 GN=GSTA1 PE=1 SV=3 CANONICAL=P08263-1"
},
"isoforms": [
{
"isoform_ac": "P08263-1",
"url": "",
"sequence": {
"sequence": "MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAKLALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEEARKIFRF",
"length": 222,
"header": "sp|P08263-1|GSTA1_HUMAN Isoform 1 of Glutathione S-transferase A1 OS=Homo sapiens OX=9606 GN=GSTA1 PE=1 SV=3 CANONICAL=P08263-1"
},
"locus": {
"chromosome": "6",
"start_pos": 52799267,
"end_pos": 52791861,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000334575.6",
"url": "https://www.ensembl.org/id/ENST00000334575.6"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000335620.5",
"url": "https://www.ensembl.org/id/ENSP00000335620.5"
}
]
}
}
],
"glycosylation": [],
"phosphorylation": [
{
"start_pos": 142,
"end_pos": 142,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P08263",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08263"
},
{
"database": "PubMed",
"id": "20166139",
"url": "https://glygen.org/publication/PubMed/20166139"
}
],
"site_lbl": "Ser142"
},
{
"start_pos": 202,
"end_pos": 202,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P08263",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08263"
},
{
"database": "PubMed",
"id": "20166139",
"url": "https://glygen.org/publication/PubMed/20166139"
}
],
"site_lbl": "Ser202"
},
{
"start_pos": 37,
"end_pos": 37,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P08263",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08263"
},
{
"database": "PubMed",
"id": "20166139",
"url": "https://glygen.org/publication/PubMed/20166139"
}
],
"site_lbl": "Ser37"
}
],
"glycation": [],
"keywords": [
"enzyme"
],
"publication": [
{
"title": "Human glutathione transferase A4-4 crystal structures and mutagenesis reveal the basis of high catalytic efficiency with toxic lipid peroxidation products.",
"journal": "Journal of molecular biology",
"date": "1999",
"authors": "Bruns CM, Hubatsch I, Ridderstrom M, Mannervik B, Tainer JA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "10329152",
"url": "https://glygen.org/publication/PubMed/10329152"
}
]
},
{
"title": "Transport of monoglucuronosyl and bisglucuronosyl bilirubin by recombinant human and rat multidrug resistance protein 2.",
"journal": "Hepatology (Baltimore, Md.)",
"date": "1999",
"authors": "Kamisako T, Leier I, Cui Y, Konig J, Buchholz U, Hummel-Eisenbeiss J, Keppler D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "10421658",
"url": "https://glygen.org/publication/PubMed/10421658"
}
]
},
{
"title": "An asparagine-phenylalanine substitution accounts for catalytic differences between hGSTM3-3 and other human class mu glutathione S-transferases.",
"journal": "Biochemistry",
"date": "1999",
"authors": "Patskovsky YV, Patskovska LN, Listowsky I",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "10587441",
"url": "https://glygen.org/publication/PubMed/10587441"
}
]
},
{
"title": "Initial-rate kinetics of the flavin reductase reaction catalysed by human biliverdin-IXbeta reductase (BVR-B).",
"journal": "The Biochemical journal",
"date": "2000",
"authors": "Cunningham O, Gore MG, Mantle TJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "10620517",
"url": "https://glygen.org/publication/PubMed/10620517"
}
]
},
{
"title": "A novel human organic anion transporting polypeptide localized to the basolateral hepatocyte membrane.",
"journal": "American journal of physiology. Gastrointestinal and liver physiology",
"date": "2000",
"authors": "Konig J, Cui Y, Nies AT, Keppler D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "10644574",
"url": "https://glygen.org/publication/PubMed/10644574"
}
]
},
{
"title": "Structures of recombinant human and mouse NAD(P)H:quinone oxidoreductases: species comparison and structural changes with substrate binding and release.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2000",
"authors": "Faig M, Bianchet MA, Talalay P, Chen S, Winski S, Ross D, Amzel LM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "10706635",
"url": "https://glygen.org/publication/PubMed/10706635"
}
]
},
{
"title": "Inhibition of the 26S proteasome induces expression of GLCLC, the catalytic subunit for gamma-glutamylcysteine synthetase.",
"journal": "Biochemical and biophysical research communications",
"date": "2000",
"authors": "Sekhar KR, Soltaninassab SR, Borrelli MJ, Xu ZQ, Meredith MJ, Domann FE, Freeman ML",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "10733945",
"url": "https://glygen.org/publication/PubMed/10733945"
}
]
},
{
"title": "Identification, characterization, and crystal structure of the Omega class glutathione transferases.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Board PG, Coggan M, Chelvanayagam G, Easteal S, Jermiin LS, Schulte GK, Danley DE, Hoth LR, Griffor MC, Kamath AV, Rosner MH, Chrunyk BA, Perregaux DE, Gabel CA, Geoghegan KF, Pandit J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "10783391",
"url": "https://glygen.org/publication/PubMed/10783391"
}
]
},
{
"title": "Transcription factor Nrf2 coordinately regulates a group of oxidative stress-inducible genes in macrophages.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Ishii T, Itoh K, Takahashi S, Sato H, Yanagawa T, Katoh Y, Bannai S, Yamamoto M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "10821856",
"url": "https://glygen.org/publication/PubMed/10821856"
}
]
},
{
"title": "Multidrug-resistance protein 5 is a multispecific organic anion transporter able to transport nucleotide analogs.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2000",
"authors": "Wijnholds J, Mol CA, van Deemter L, de Haas M, Scheffer GL, Baas F, Beijnen JH, Scheper RJ, Hatse S, De Clercq E, Balzarini J, Borst P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "10840050",
"url": "https://glygen.org/publication/PubMed/10840050"
}
]
},
{
"title": "Recent advances in bilirubin metabolism research: the molecular mechanism of hepatocyte bilirubin transport and its clinical relevance.",
"journal": "Journal of gastroenterology",
"date": "2000",
"authors": "Kamisako T, Kobayashi Y, Takeuchi K, Ishihara T, Higuchi K, Tanaka Y, Gabazza EC, Adachi Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "11023036",
"url": "https://glygen.org/publication/PubMed/11023036"
}
]
},
{
"title": "Hepatic uptake of bilirubin and its conjugates by the human organic anion transporter SLC21A6.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Cui Y, Konig J, Leier I, Buchholz U, Keppler D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "11134001",
"url": "https://glygen.org/publication/PubMed/11134001"
}
]
},
{
"title": "The role of glutathione in the isomerization of delta 5-androstene-3,17-dione catalyzed by human glutathione transferase A1-1.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Pettersson PL, Mannervik B",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"reference": [
{
"type": "PubMed",
"id": "11152686",
"url": "https://glygen.org/publication/PubMed/11152686"
}
]
},
{
"title": "The Cap'n'Collar basic leucine zipper transcription factor Nrf2 (NF-E2 p45-related factor 2) controls both constitutive and inducible expression of intestinal detoxification and glutathione biosynthetic enzymes.",
"journal": "Cancer research",
"date": "2001",
"authors": "McMahon M, Itoh K, Yamamoto M, Chanas SA, Henderson CJ, McLellan LI, Wolf CR, Cavin C, Hayes JD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "11309284",
"url": "https://glygen.org/publication/PubMed/11309284"
}
]
},
{
"title": "Crystal structure of maleylacetoacetate isomerase/glutathione transferase zeta reveals the molecular basis for its remarkable catalytic promiscuity.",
"journal": "Biochemistry",
"date": "2001",
"authors": "Polekhina G, Board PG, Blackburn AC, Parker MW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "11327815",
"url": "https://glygen.org/publication/PubMed/11327815"
}
]
},
{
"title": "Affinity of human serum albumin for bilirubin varies with albumin concentration and buffer composition: results of a novel ultrafiltration method.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Weisiger RA, Ostrow JD, Koehler RK, Webster CC, Mukerjee P, Pascolo L, Tiribelli C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "11397817",
"url": "https://glygen.org/publication/PubMed/11397817"
}
]
},
{
"title": "The albumin binding of unconjugated bilirubin in serum.",
"journal": "Clinical biochemistry",
"date": "1975",
"authors": "Griffiths WC, Diamond I, Dextraze P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "1157293",
"url": "https://glygen.org/publication/PubMed/1157293"
}
]
},
{
"title": "The 3-D structure of microsomal glutathione transferase 1 at 6 A resolution as determined by electron crystallography of p22(1)2(1) crystals.",
"journal": "Biochimica et biophysica acta",
"date": "2002",
"authors": "Holm PJ, Morgenstern R, Hebert H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "11904223",
"url": "https://glygen.org/publication/PubMed/11904223"
}
]
},
{
"title": "The human glutathione transferase alpha locus: genomic organization of the gene cluster and functional characterization of the genetic polymorphism in the hGSTA1 promoter.",
"journal": "Pharmacogenetics",
"date": "2002",
"authors": "Morel F, Rauch C, Coles B, Le Ferrec E, Guillouzo A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "12042665",
"url": "https://glygen.org/publication/PubMed/12042665"
}
]
},
{
"title": "1.3-A resolution structure of human glutathione S-transferase with S-hexyl glutathione bound reveals possible extended ligandin binding site.",
"journal": "Proteins",
"date": "2002",
"authors": "Le Trong I, Stenkamp RE, Ibarra C, Atkins WM, Adman ET",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
},
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "12211029",
"url": "https://glygen.org/publication/PubMed/12211029"
}
]
},
{
"title": "Identification of Nrf2-regulated genes induced by the chemopreventive agent sulforaphane by oligonucleotide microarray.",
"journal": "Cancer research",
"date": "2002",
"authors": "Thimmulappa RK, Mai KH, Srisuma S, Kensler TW, Yamamoto M, Biswal S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "12234984",
"url": "https://glygen.org/publication/PubMed/12234984"
}
]
},
{
"title": "Electrophile response element-mediated induction of the cystine/glutamate exchange transporter gene expression.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Sasaki H, Sato H, Kuriyama-Matsumura K, Sato K, Maebara K, Wang H, Tamba M, Itoh K, Yamamoto M, Bannai S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "12235164",
"url": "https://glygen.org/publication/PubMed/12235164"
}
]
},
{
"title": "Thiopurine metabolism and identification of the thiopurine metabolites transported by MRP4 and MRP5 overexpressed in human embryonic kidney cells.",
"journal": "Molecular pharmacology",
"date": "2002",
"authors": "Wielinga PR, Reid G, Challa EE, van der Heijden I, van Deemter L, de Haas M, Mol C, Kuil AJ, Groeneveld E, Schuetz JD, Brouwer C, De Abreu RA, Wijnholds J, Beijnen JH, Borst P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "12435799",
"url": "https://glygen.org/publication/PubMed/12435799"
}
]
},
{
"title": "Modulation of gene expression by cancer chemopreventive dithiolethiones through the Keap1-Nrf2 pathway. Identification of novel gene clusters for cell survival.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Kwak MK, Wakabayashi N, Itoh K, Motohashi H, Yamamoto M, Kensler TW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "12506115",
"url": "https://glygen.org/publication/PubMed/12506115"
}
]
},
{
"title": "Mechanism of metal activation of human hematopoietic prostaglandin D synthase.",
"journal": "Nature structural biology",
"date": "2003",
"authors": "Inoue T, Irikura D, Okazaki N, Kinugasa S, Matsumura H, Uodome N, Yamamoto M, Kumasaka T, Miyano M, Kai Y, Urade Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "12627223",
"url": "https://glygen.org/publication/PubMed/12627223"
}
]
},
{
"title": "CD28-dependent Rac1 activation is the molecular target of azathioprine in primary human CD4+ T lymphocytes.",
"journal": "The Journal of clinical investigation",
"date": "2003",
"authors": "Tiede I, Fritz G, Strand S, Poppe D, Dvorsky R, Strand D, Lehr HA, Wirtz S, Becker C, Atreya R, Mudter J, Hildner K, Bartsch B, Holtmann M, Blumberg R, Walczak H, Iven H, Galle PR, Ahmadian MR, Neurath MF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "12697733",
"url": "https://glygen.org/publication/PubMed/12697733"
}
]
},
{
"title": "Heterologous expression of recombinant human glutathione transferase A1-1 from a hepatoma cell line.",
"journal": "Protein Expr. Purif.",
"date": "1992",
"authors": "Stenberg G, Bj\u00f6rnestedt R, Mannervik B",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"reference": [
{
"type": "PubMed",
"id": "1330133",
"url": "https://glygen.org/publication/PubMed/1330133"
}
]
},
{
"title": "Gene and protein characterization of the human glutathione S-transferase kappa and evidence for a peroxisomal localization.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Morel F, Rauch C, Petit E, Piton A, Theret N, Coles B, Guillouzo A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "14742434",
"url": "https://glygen.org/publication/PubMed/14742434"
}
]
},
{
"title": "Characterization of oligomeric human half-ABC transporter ATP-binding cassette G2.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Xu J, Liu Y, Yang Y, Bates S, Zhang JT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "15001581",
"url": "https://glygen.org/publication/PubMed/15001581"
}
]
},
{
"title": "The human multidrug-resistance-associated protein MRP1 mediates ATP-dependent transport of unconjugated bilirubin.",
"journal": "The Biochemical journal",
"date": "2004",
"authors": "Rigato I, Pascolo L, Fernetti C, Ostrow JD, Tiribelli C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "15245331",
"url": "https://glygen.org/publication/PubMed/15245331"
}
]
},
{
"title": "Incorporation of a single His residue by rational design enables thiol-ester hydrolysis by human glutathione transferase A1-1.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2004",
"authors": "Hederos S, Broo KS, Jakobsson E, Kleywegt GJ, Mannervik B, Baltzer L",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"reference": [
{
"type": "PubMed",
"id": "15333749",
"url": "https://glygen.org/publication/PubMed/15333749"
}
]
},
{
"title": "Characterization of mammalian sulfiredoxin and its reactivation of hyperoxidized peroxiredoxin through reduction of cysteine sulfinic acid in the active site to cysteine.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Chang TS, Jeong W, Woo HA, Lee SM, Park S, Rhee SG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "15448164",
"url": "https://glygen.org/publication/PubMed/15448164"
}
]
},
{
"title": "Genetic ablation of Nrf2 enhances susceptibility to cigarette smoke-induced emphysema in mice.",
"journal": "The Journal of clinical investigation",
"date": "2004",
"authors": "Rangasamy T, Cho CY, Thimmulappa RK, Zhen L, Srisuma SS, Kensler TW, Yamamoto M, Petrache I, Tuder RM, Biswal S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "15520857",
"url": "https://glygen.org/publication/PubMed/15520857"
}
]
},
{
"title": "Reduction of cysteine sulfinic acid by sulfiredoxin is specific to 2-cys peroxiredoxins.",
"journal": "The Journal of biological chemistry",
"date": "2005",
"authors": "Woo HA, Jeong W, Chang TS, Park KJ, Park SJ, Yang JS, Rhee SG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "15590625",
"url": "https://glygen.org/publication/PubMed/15590625"
}
]
},
{
"title": "Sulforaphane induces thioredoxin through the antioxidant-responsive element and attenuates retinal light damage in mice.",
"journal": "Investigative ophthalmology & visual science",
"date": "2005-03",
"authors": "Tanito Masaki, Masutani Hiroshi, Kim Yong-Chul, Nishikawa Mai, Ohira Akihiro, Yodoi Junji",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "15728556",
"url": "https://glygen.org/publication/PubMed/15728556"
}
]
},
{
"title": "Cellular export of drugs and signaling molecules by the ATP-binding cassette transporters MRP4 (ABCC4) and MRP5 (ABCC5).",
"journal": "Drug metabolism reviews",
"date": "2005",
"authors": "Ritter CA, Jedlitschky G, Meyer zu Schwabedissen H, Grube M, Kock K, Kroemer HK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "15747503",
"url": "https://glygen.org/publication/PubMed/15747503"
}
]
},
{
"title": "Recognition and activation of Rho GTPases by Vav1 and Vav2 guanine nucleotide exchange factors.",
"journal": "Biochemistry",
"date": "2005",
"authors": "Heo J, Thapar R, Campbell SL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "15850391",
"url": "https://glygen.org/publication/PubMed/15850391"
}
]
},
{
"title": "Tertiary interactions stabilise the C-terminal region of human glutathione transferase A1-1: a crystallographic and calorimetric study.",
"journal": "J. Mol. Biol.",
"date": "2005",
"authors": "Kuhnert Diane C, Sayed Yasien, Mosebi Salerwe, Sayed Muhammed, Sewell Trevor, Dirr Heini W",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"reference": [
{
"type": "PubMed",
"id": "15893769",
"url": "https://glygen.org/publication/PubMed/15893769"
}
]
},
{
"title": "Thioredoxin-like domain of human kappa class glutathione transferase reveals sequence homology and structure similarity to the theta class enzyme.",
"journal": "Protein science : a publication of the Protein Society",
"date": "2005",
"authors": "Li J, Xia Z, Ding J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "16081649",
"url": "https://glygen.org/publication/PubMed/16081649"
}
]
},
{
"title": "Structural basis of the suppressed catalytic activity of wild-type human glutathione transferase T1-1 compared to its W234R mutant.",
"journal": "Journal of molecular biology",
"date": "2006",
"authors": "Tars K, Larsson AK, Shokeer A, Olin B, Mannervik B, Kleywegt GJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "16298388",
"url": "https://glygen.org/publication/PubMed/16298388"
}
]
},
{
"title": "New crystal structures of human glutathione transferase A1-1 shed light on glutathione binding and the conformation of the C-terminal helix.",
"journal": "Acta Crystallogr. D",
"date": "2006",
"authors": "Grahn E, Novotny M, Jakobsson E, Gustafsson A, Grehn L, Olin B, Madsen D, Wahlberg M, Mannervik B, Kleywegt GJ",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"reference": [
{
"type": "PubMed",
"id": "16421451",
"url": "https://glygen.org/publication/PubMed/16421451"
}
]
},
{
"title": "Involvement of the concentrative nucleoside transporter 3 and equilibrative nucleoside transporter 2 in the resistance of T-lymphoblastic cell lines to thiopurines.",
"journal": "Biochemical and biophysical research communications",
"date": "2006",
"authors": "Fotoohi AK, Lindqvist M, Peterson C, Albertioni F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "16530731",
"url": "https://glygen.org/publication/PubMed/16530731"
}
]
},
{
"title": "Transition state model and mechanism of nucleophilic aromatic substitution reactions catalyzed by human glutathione S-transferase M1a-1a.",
"journal": "Biochemistry",
"date": "2006",
"authors": "Patskovsky Y, Patskovska L, Almo SC, Listowsky I",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "16548513",
"url": "https://glygen.org/publication/PubMed/16548513"
}
]
},
{
"title": "Metabolism of oxidized linoleic acid by glutathione transferases: peroxidase activity toward 13-hydroperoxyoctadecadienoic acid.",
"journal": "Biochimica et biophysica acta",
"date": "2006-07",
"authors": "Seeley Stacy K, Poposki Julie A, Maksimchuk John, Tebbe Jill, Gaudreau Jon, Mannervik Bengt, Bull Arthur W",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"reference": [
{
"type": "PubMed",
"id": "16624487",
"url": "https://glygen.org/publication/PubMed/16624487"
}
]
},
{
"title": "Divergent activities of human glutathione transferases in the bioactivation of azathioprine.",
"journal": "Molecular pharmacology",
"date": "2006",
"authors": "Eklund BI, Moberg M, Bergquist J, Mannervik B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "16717136",
"url": "https://glygen.org/publication/PubMed/16717136"
}
]
},
{
"title": "Human prx1 gene is a target of Nrf2 and is up-regulated by hypoxia/reoxygenation: implication to tumor biology.",
"journal": "Cancer research",
"date": "2007",
"authors": "Kim YJ, Ahn JY, Liang P, Ip C, Zhang Y, Park YM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "17234762",
"url": "https://glygen.org/publication/PubMed/17234762"
}
]
},
{
"title": "Human xanthine oxidase changes its substrate specificity to aldehyde oxidase type upon mutation of amino acid residues in the active site: roles of active site residues in binding and activation of purine substrate.",
"journal": "Journal of biochemistry",
"date": "2007",
"authors": "Yamaguchi Y, Matsumura T, Ichida K, Okamoto K, Nishino T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "17301077",
"url": "https://glygen.org/publication/PubMed/17301077"
}
]
},
{
"title": "Isolation and characterization of a human glutathione S-transferase Ha1 subunit gene.",
"journal": "Arch. Biochem. Biophys.",
"date": "1992",
"authors": "Rozen F, Nguyen T, Pickett C B",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"reference": [
{
"type": "PubMed",
"id": "1731620",
"url": "https://glygen.org/publication/PubMed/1731620"
}
]
},
{
"title": "Heme oxygenase-1 induction by NRF2 requires inactivation of the transcriptional repressor BACH1.",
"journal": "Nucleic acids research",
"date": "2007",
"authors": "Reichard JF, Motz GT, Puga A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "17942419",
"url": "https://glygen.org/publication/PubMed/17942419"
}
]
},
{
"title": "Up-regulation of MRP4 and down-regulation of influx transporters in human leukemic cells with acquired resistance to 6-mercaptopurine.",
"journal": "Leukemia research",
"date": "2008",
"authors": "Peng XX, Shi Z, Damaraju VL, Huang XC, Kruh GD, Wu HC, Zhou Y, Tiwari A, Fu L, Cass CE, Chen ZS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "17996297",
"url": "https://glygen.org/publication/PubMed/17996297"
}
]
},
{
"title": "Nrf2-regulated glutathione recycling independent of biosynthesis is critical for cell survival during oxidative stress.",
"journal": "Free radical biology & medicine",
"date": "2009",
"authors": "Harvey CJ, Thimmulappa RK, Singh A, Blake DJ, Ling G, Wakabayashi N, Fujii J, Myers A, Biswal S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "19028565",
"url": "https://glygen.org/publication/PubMed/19028565"
}
]
},
{
"title": "Acetylation of Nrf2 by p300/CBP augments promoter-specific DNA binding of Nrf2 during the antioxidant response.",
"journal": "Molecular and cellular biology",
"date": "2009",
"authors": "Sun Z, Chin YE, Zhang DD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "19273602",
"url": "https://glygen.org/publication/PubMed/19273602"
}
]
},
{
"title": "Characterization of the cancer chemopreventive NRF2-dependent gene battery in human keratinocytes: demonstration that the KEAP1-NRF2 pathway, and not the BACH1-NRF2 pathway, controls cytoprotection against electrophiles as well as redox-cycling compounds.",
"journal": "Carcinogenesis",
"date": "2009",
"authors": "MacLeod AK, McMahon M, Plummer SM, Higgins LG, Penning TM, Igarashi K, Hayes JD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "19608619",
"url": "https://glygen.org/publication/PubMed/19608619"
}
]
},
{
"title": "Structural analysis of a glutathione transferase A1-1 mutant tailored for high catalytic efficiency with toxic alkenals.",
"journal": "Biochemistry",
"date": "2009",
"authors": "Balogh LM, Le Trong I, Kripps KA, Tars K, Stenkamp RE, Mannervik B, Atkins WM",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"reference": [
{
"type": "PubMed",
"id": "19618965",
"url": "https://glygen.org/publication/PubMed/19618965"
}
]
},
{
"title": "Reassessment of the interactions of guanylate kinase and 6-thioguanosine 5'-phosphate.",
"journal": "Biochemical pharmacology",
"date": "1977",
"authors": "Miller RL, Adamczyk DL, Spector T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "197968",
"url": "https://glygen.org/publication/PubMed/197968"
}
]
},
{
"title": "Structural basis for featuring of steroid isomerase activity in alpha class glutathione transferases.",
"journal": "Journal of molecular biology",
"date": "2010",
"authors": "Tars K, Olin B, Mannervik B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "20083122",
"url": "https://glygen.org/publication/PubMed/20083122"
}
]
},
{
"title": "Substrate specificity combined with stereopromiscuity in glutathione transferase A4-4-dependent metabolism of 4-hydroxynonenal.",
"journal": "Biochemistry",
"date": "2010",
"authors": "Balogh LM, Le Trong I, Kripps KA, Shireman LM, Stenkamp RE, Zhang W, Mannervik B, Atkins WM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "20085333",
"url": "https://glygen.org/publication/PubMed/20085333"
}
]
},
{
"title": "Phosphoproteome analysis of human liver tissue by long-gradient nanoflow LC coupled with multiple stage MS analysis.",
"journal": "Electrophoresis",
"date": "2010",
"authors": "Han G, Ye M, Liu H, Song C, Sun D, Wu Y, Jiang X, Chen R, Wang C, Wang L, Zou H",
"evidence": [
{
"database": "iPTMnet",
"id": "P08263",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08263"
}
],
"reference": [
{
"type": "PubMed",
"id": "20166139",
"url": "https://glygen.org/publication/PubMed/20166139"
}
]
},
{
"title": "The contribution of the C-terminal sequence to the catalytic activity of GST2, a human alpha-class glutathione transferase.",
"journal": "Biochem. J.",
"date": "1991",
"authors": "Board P G, Mannervik B",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"reference": [
{
"type": "PubMed",
"id": "2018473",
"url": "https://glygen.org/publication/PubMed/2018473"
}
]
},
{
"title": "Determination of 6-thioguanosine diphosphate and triphosphate and nucleoside diphosphate kinase activity in erythrocytes: novel targets for thiopurine therapy?",
"journal": "Therapeutic drug monitoring",
"date": "2010",
"authors": "Karner S, Shi S, Fischer C, Schaeffeler E, Neurath MF, Herrlinger KR, Hofmann U, Schwab M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "20216118",
"url": "https://glygen.org/publication/PubMed/20216118"
}
]
},
{
"title": "Global mapping of binding sites for Nrf2 identifies novel targets in cell survival response through ChIP-Seq profiling and network analysis.",
"journal": "Nucleic acids research",
"date": "2010",
"authors": "Malhotra D, Portales-Casamar E, Singh A, Srivastava S, Arenillas D, Happel C, Shyr C, Wakabayashi N, Kensler TW, Wasserman WW, Biswal S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "20460467",
"url": "https://glygen.org/publication/PubMed/20460467"
}
]
},
{
"title": "The role of a topologically conserved isoleucine in glutathione transferase structure, stability and function.",
"journal": "Acta crystallographica. Section F, Structural biology and crystallization communications",
"date": "2010",
"authors": "Achilonu I, Gildenhuys S, Fisher L, Burke J, Fanucchi S, Sewell BT, Fernandes M, Dirr HW",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"reference": [
{
"type": "PubMed",
"id": "20606271",
"url": "https://glygen.org/publication/PubMed/20606271"
}
]
},
{
"title": "Novel folding and stability defects cause a deficiency of human glutathione transferase omega 1.",
"journal": "The Journal of biological chemistry",
"date": "2011",
"authors": "Zhou H, Brock J, Casarotto MG, Oakley AJ, Board PG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "21106529",
"url": "https://glygen.org/publication/PubMed/21106529"
}
]
},
{
"title": "Guanylate kinases from human erythrocytes, hog brain, and rat liver.",
"journal": "Methods in enzymology",
"date": "1978",
"authors": "Agarwal KC, Miech RP, Parks RE Jr",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "211390",
"url": "https://glygen.org/publication/PubMed/211390"
}
]
},
{
"title": "Glutathione-S-transferase P1 is a critical regulator of Cdk5 kinase activity.",
"journal": "Journal of neurochemistry",
"date": "2011",
"authors": "Sun KH, Chang KH, Clawson S, Ghosh S, Mirzaei H, Regnier F, Shah K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "21668448",
"url": "https://glygen.org/publication/PubMed/21668448"
}
]
},
{
"title": "The pattern of gene expression and gene dose profiles of 6-Mercaptopurine- and 6-Thioguanine-resistant human leukemia cells.",
"journal": "Biochemical and biophysical research communications",
"date": "2011",
"authors": "Karim H, Hashemi J, Larsson C, Moshfegh A, Fotoohi AK, Albertioni F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "21723252",
"url": "https://glygen.org/publication/PubMed/21723252"
}
]
},
{
"title": "Beneficial role of Nrf2 in regulating NADPH generation and consumption.",
"journal": "Toxicological sciences : an official journal of the Society of Toxicology",
"date": "2011",
"authors": "Wu KC, Cui JY, Klaassen CD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "21775727",
"url": "https://glygen.org/publication/PubMed/21775727"
}
]
},
{
"title": "Complete OATP1B1 and OATP1B3 deficiency causes human Rotor syndrome by interrupting conjugated bilirubin reuptake into the liver.",
"journal": "The Journal of clinical investigation",
"date": "2012",
"authors": "van de Steeg E, Stranecky V, Hartmannova H, Noskova L, Hrebicek M, Wagenaar E, van Esch A, de Waart DR, Oude Elferink RP, Kenworthy KE, Sticova E, al-Edreesi M, Knisely AS, Kmoch S, Jirsa M, Schinkel AH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "22232210",
"url": "https://glygen.org/publication/PubMed/22232210"
}
]
},
{
"title": "Structure-based redesign of GST A2-2 for enhanced catalytic efficiency with azathioprine.",
"journal": "Chemistry & biology",
"date": "2012",
"authors": "Zhang W, Moden O, Tars K, Mannervik B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "22444596",
"url": "https://glygen.org/publication/PubMed/22444596"
}
]
},
{
"title": "Structural insights into the dehydroascorbate reductase activity of human omega-class glutathione transferases.",
"journal": "Journal of molecular biology",
"date": "2012",
"authors": "Zhou H, Brock J, Liu D, Board PG, Oakley AJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "22522127",
"url": "https://glygen.org/publication/PubMed/22522127"
}
]
},
{
"title": "The cystine/glutamate antiporter system x(c)(-) in health and disease: from molecular mechanisms to novel therapeutic opportunities.",
"journal": "Antioxidants & redox signaling",
"date": "2013",
"authors": "Lewerenz J, Hewett SJ, Huang Y, Lambros M, Gout PW, Kalivas PW, Massie A, Smolders I, Methner A, Pergande M, Smith SB, Ganapathy V, Maher P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "22667998",
"url": "https://glygen.org/publication/PubMed/22667998"
}
]
},
{
"title": "Molecular modeling to provide insight into the substrate binding and catalytic mechanism of human biliverdin-IXalpha reductase.",
"journal": "The journal of physical chemistry. B",
"date": "2012",
"authors": "Fu G, Liu H, Doerksen RJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "22823425",
"url": "https://glygen.org/publication/PubMed/22823425"
}
]
},
{
"title": "Glutathione synthesis.",
"journal": "Biochimica et biophysica acta",
"date": "2013",
"authors": "Lu SC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "22995213",
"url": "https://glygen.org/publication/PubMed/22995213"
}
]
},
{
"title": "Superoxide dismutase 3 is induced by antioxidants, inhibits oxidative DNA damage and is associated with inhibition of estrogen-induced breast cancer.",
"journal": "Carcinogenesis",
"date": "2012-12",
"authors": "Singh Bhupendra, Bhat Hari K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "23027624",
"url": "https://glygen.org/publication/PubMed/23027624"
}
]
},
{
"title": "New insight into the molecular switch mechanism of human Rho family proteins: shifting a paradigm.",
"journal": "Biological chemistry",
"date": "2013",
"authors": "Jaiswal M, Fansa EK, Dvorsky R, Ahmadian MR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "23096567",
"url": "https://glygen.org/publication/PubMed/23096567"
}
]
},
{
"title": "The Role of Human Aldo-Keto Reductases in the Metabolic Activation and Detoxication of Polycyclic Aromatic Hydrocarbons: Interconversion of PAH Catechols and PAH o-Quinones.",
"journal": "Frontiers in pharmacology",
"date": "2012",
"authors": "Zhang L, Jin Y, Huang M, Penning TM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "23162467",
"url": "https://glygen.org/publication/PubMed/23162467"
}
]
},
{
"title": "Substrate specificity and oligomerization of human GMP synthetase.",
"journal": "Journal of molecular biology",
"date": "2013",
"authors": "Welin M, Lehtio L, Johansson A, Flodin S, Nyman T, Tresaugues L, Hammarstrom M, Graslund S, Nordlund P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "23816837",
"url": "https://glygen.org/publication/PubMed/23816837"
}
]
},
{
"title": "Regulation of the human thioredoxin gene promoter and its key substrates: a study of functional and putative regulatory elements.",
"journal": "Biochimica et biophysica acta",
"date": "2014-01",
"authors": "Hawkes Hye-Jin Kim, Karlenius Therese C, Tonissen Kathryn F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "24041992",
"url": "https://glygen.org/publication/PubMed/24041992"
}
]
},
{
"title": "In vitro oxidative metabolism of 6-mercaptopurine in human liver: insights into the role of the molybdoflavoenzymes aldehyde oxidase, xanthine oxidase, and xanthine dehydrogenase.",
"journal": "Drug metabolism and disposition: the biological fate of chemicals",
"date": "2014",
"authors": "Choughule KV, Barnaba C, Joswig-Jones CA, Jones JP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "24824603",
"url": "https://glygen.org/publication/PubMed/24824603"
}
]
},
{
"title": "Glutathione transferases in the bioactivation of azathioprine.",
"journal": "Advances in cancer research",
"date": "2014",
"authors": "Moden O, Mannervik B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "24974183",
"url": "https://glygen.org/publication/PubMed/24974183"
}
]
},
{
"title": "Nrf2- and ATF4-dependent upregulation of xCT modulates the sensitivity of T24 bladder carcinoma cells to proteasome inhibition.",
"journal": "Molecular and cellular biology",
"date": "2014",
"authors": "Ye P, Mimura J, Okada T, Sato H, Liu T, Maruyama A, Ohyama C, Itoh K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "25002527",
"url": "https://glygen.org/publication/PubMed/25002527"
}
]
},
{
"title": "Evidence that glutathione S-transferases B1B1 and B2B2 are the products of separate genes and that their expression in human liver is subject to inter-individual variation. Molecular relationships between the B1 and B2 subunits and other alpha class glutathione S-transferases.",
"journal": "Biochem. J.",
"date": "1989",
"authors": "Hayes JD, Kerr LA, Cronshaw AD",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"reference": [
{
"type": "PubMed",
"id": "2604726",
"url": "https://glygen.org/publication/PubMed/2604726"
}
]
},
{
"title": "Crystal structure, biochemical and cellular activities demonstrate separate functions of MTH1 and MTH2.",
"journal": "Nature communications",
"date": "2015",
"authors": "Carter M, Jemth AS, Hagenkort A, Page BD, Gustafsson R, Griese JJ, Gad H, Valerie NC, Desroses M, Bostrom J, Warpman Berglund U, Helleday T, Stenmark P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "26238318",
"url": "https://glygen.org/publication/PubMed/26238318"
}
]
},
{
"title": "Role of Nrf2/HO-1 system in development, oxidative stress response and diseases: an evolutionarily conserved mechanism.",
"journal": "Cellular and molecular life sciences : CMLS",
"date": "2016",
"authors": "Loboda A, Damulewicz M, Pyza E, Jozkowicz A, Dulak J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "27100828",
"url": "https://glygen.org/publication/PubMed/27100828"
}
]
},
{
"title": "Peroxiredoxin 1 - an antioxidant enzyme in cancer.",
"journal": "Journal of cellular and molecular medicine",
"date": "2017",
"authors": "Ding C, Fan X, Wu G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "27653015",
"url": "https://glygen.org/publication/PubMed/27653015"
}
]
},
{
"title": "The role of peroxiredoxin 1 in redox sensing and transducing.",
"journal": "Archives of biochemistry and biophysics",
"date": "2017",
"authors": "Ledgerwood EC, Marshall JW, Weijman JF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "27756681",
"url": "https://glygen.org/publication/PubMed/27756681"
}
]
},
{
"title": "NRF2 Is a Major Target of ARF in p53-Independent Tumor Suppression.",
"journal": "Molecular cell",
"date": "2017",
"authors": "Chen D, Tavana O, Chu B, Erber L, Chen Y, Baer R, Gu W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "28985506",
"url": "https://glygen.org/publication/PubMed/28985506"
}
]
},
{
"title": "The roles of human MTH1, MTH2 and MTH3 proteins in maintaining genome stability under oxidative stress.",
"journal": "Mutation research",
"date": "2018",
"authors": "Hashiguchi K, Hayashi M, Sekiguchi M, Umezu K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "29482072",
"url": "https://glygen.org/publication/PubMed/29482072"
}
]
},
{
"title": "A review on heme oxygenase-1 induction: is it a necessary evil.",
"journal": "Inflammation research : official journal of the European Histamine Research Society ... [et al.]",
"date": "2018",
"authors": "Waza AA, Hamid Z, Ali S, Bhat SA, Bhat MA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "29693710",
"url": "https://glygen.org/publication/PubMed/29693710"
}
]
},
{
"title": "The multifaceted role of glutathione S-transferases in cancer.",
"journal": "Cancer letters",
"date": "2018",
"authors": "Chatterjee A, Gupta S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "29959055",
"url": "https://glygen.org/publication/PubMed/29959055"
}
]
},
{
"title": "Isolation of a cDNA clone and localization of human glutathione S-transferase 2 genes to chromosome band 6p12.",
"journal": "Proc. Natl. Acad. Sci. U.S.A.",
"date": "1987",
"authors": "Board P G, Webb G C",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"reference": [
{
"type": "PubMed",
"id": "3031680",
"url": "https://glygen.org/publication/PubMed/3031680"
}
]
},
{
"title": "The basic glutathione S-transferases from human livers are products of separate genes.",
"journal": "Biochem. Biophys. Res. Commun.",
"date": "1987",
"authors": "Rhoads D M, Zarlengo R P, Tu C P",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"reference": [
{
"type": "PubMed",
"id": "3036131",
"url": "https://glygen.org/publication/PubMed/3036131"
}
]
},
{
"title": "Azathioprine Biotransformation in Young Patients with Inflammatory Bowel Disease: Contribution of Glutathione-S Transferase M1 and A1 Variants.",
"journal": "Genes",
"date": "2019",
"authors": "Lucafo M, Stocco G, Martelossi S, Favretto D, Franca R, Malusa N, Lora A, Bramuzzo M, Naviglio S, Cecchin E, Toffoli G, Ventura A, Decorti G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "30987408",
"url": "https://glygen.org/publication/PubMed/30987408"
}
]
},
{
"title": "Human glutathione S-transferases. The Ha multigene family encodes products of different but overlapping substrate specificities.",
"journal": "J. Biol. Chem.",
"date": "1988",
"authors": "Chow N W, Whang-Peng J, Kao-Shan C S, Tam M F, Lai H C, Tu C P",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"reference": [
{
"type": "PubMed",
"id": "3138230",
"url": "https://glygen.org/publication/PubMed/3138230"
}
]
},
{
"title": "Programmed Cell-Death by Ferroptosis: Antioxidants as Mitigators.",
"journal": "International journal of molecular sciences",
"date": "2019",
"authors": "Kajarabille N, Latunde-Dada GO",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "31597407",
"url": "https://glygen.org/publication/PubMed/31597407"
}
]
},
{
"title": "Population pharmacokinetic analysis of intravenous busulfan: GSTA1 genotype is not a predictive factor of initial dose in Chinese adult patients undergoing hematopoietic stem cell transplantation.",
"journal": "Cancer chemotherapy and pharmacology",
"date": "2020",
"authors": "Sun Y, Huang J, Hao C, Li Z, Liang W, Zhang W, Chen B, Yang W, Hu J",
"evidence": [
{
"database": "RefSeq",
"id": "NP_665683",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_665683"
}
],
"reference": [
{
"type": "PubMed",
"id": "31834435",
"url": "https://glygen.org/publication/PubMed/31834435"
}
]
},
{
"title": "The Molecular Mechanisms Regulating the KEAP1-NRF2 Pathway.",
"journal": "Molecular and cellular biology",
"date": "2020",
"authors": "Baird L, Yamamoto M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "32284348",
"url": "https://glygen.org/publication/PubMed/32284348"
}
]
},
{
"title": "Nrf2 inhibits ferroptosis and protects against acute lung injury due to intestinal ischemia reperfusion via regulating SLC7A11 and HO-1.",
"journal": "Aging",
"date": "2020",
"authors": "Dong H, Qiang Z, Chai D, Peng J, Xia Y, Hu R, Jiang H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "32601262",
"url": "https://glygen.org/publication/PubMed/32601262"
}
]
},
{
"title": "Comparison of the tissue expressions of glutathione S transferase isoenzymes among patients with morphea and healthy controls: A preliminary study.",
"journal": "Dermatologic therapy",
"date": "2020",
"authors": "Uzuncakmak TK, Koska MC, Ozkanli S, Kaya Kocdogan A, Oguztuzun S, Karadag AS, Akdeniz N, Wollina U",
"evidence": [
{
"database": "RefSeq",
"id": "NP_665683",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_665683"
}
],
"reference": [
{
"type": "PubMed",
"id": "33002252",
"url": "https://glygen.org/publication/PubMed/33002252"
}
]
},
{
"title": "Oxidative Damage and Antioxidant Defense in Ferroptosis.",
"journal": "Frontiers in cell and developmental biology",
"date": "2020",
"authors": "Kuang F, Liu J, Tang D, Kang R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "33043019",
"url": "https://glygen.org/publication/PubMed/33043019"
}
]
},
{
"title": "Cellular degradation systems in ferroptosis.",
"journal": "Cell death and differentiation",
"date": "2021",
"authors": "Chen X, Yu C, Kang R, Kroemer G, Tang D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "33462411",
"url": "https://glygen.org/publication/PubMed/33462411"
}
]
},
{
"title": "The analysis of GSTA1 promoter genetic and functional diversity of human populations.",
"journal": "Scientific reports",
"date": "2021",
"authors": "Mlakar V, Curtis PH, Armengol M, Ythier V, Dupanloup I, Hassine KB, Lesne L, Murr R, Mlakar SJ, Nava T, Ansari M",
"evidence": [
{
"database": "RefSeq",
"id": "NP_665683",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_665683"
}
],
"reference": [
{
"type": "PubMed",
"id": "33658540",
"url": "https://glygen.org/publication/PubMed/33658540"
}
]
},
{
"title": "Gene expression of rat and human microsomal glutathione S-transferases.",
"journal": "The Journal of biological chemistry",
"date": "1988",
"authors": "DeJong JL, Morgenstern R, Jornvall H, DePierre JW, Tu CP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "3372534",
"url": "https://glygen.org/publication/PubMed/3372534"
}
]
},
{
"title": "The diverse functionality of NQO1 and its roles in redox control.",
"journal": "Redox biology",
"date": "2021",
"authors": "Ross D, Siegel D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "33774477",
"url": "https://glygen.org/publication/PubMed/33774477"
}
]
},
{
"title": "The Interaction of Human Glutathione Transferase GSTA1-1 with Reactive Dyes.",
"journal": "Molecules (Basel, Switzerland)",
"date": "2021",
"authors": "Alqarni MH, Foudah AI, Muharram MM, Labrou NE",
"evidence": [
{
"database": "RefSeq",
"id": "NP_665683",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_665683"
}
],
"reference": [
{
"type": "PubMed",
"id": "33924269",
"url": "https://glygen.org/publication/PubMed/33924269"
}
]
},
{
"title": "Influence of Glutathione-S-Transferase A1*B Allele on the Metabolism of the Aromatase Inhibitor, Exemestane, in Human Liver Cytosols and in Patients Treated With Exemestane.",
"journal": "The Journal of pharmacology and experimental therapeutics",
"date": "2022",
"authors": "Teslenko I, Trudeau J, Luo S, Watson CJW, Chen G, Truica CI, Lazarus P",
"evidence": [
{
"database": "RefSeq",
"id": "NP_665683",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_665683"
}
],
"reference": [
{
"type": "PubMed",
"id": "35793834",
"url": "https://glygen.org/publication/PubMed/35793834"
}
]
},
{
"title": "Nucleotide sequence of the human liver glutathione S-transferase subunit 1 cDNA.",
"journal": "Biochem. Soc. Trans.",
"date": "1987",
"authors": "Tu C P, Qian B",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"reference": [
{
"type": "PubMed",
"id": "3678589",
"url": "https://glygen.org/publication/PubMed/3678589"
}
]
},
{
"title": "Identity of the polymorphisms for esterase D and S-formylglutathione hydrolase in red blood cells.",
"journal": "Human genetics",
"date": "1986",
"authors": "Eiberg H, Mohr J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "3770744",
"url": "https://glygen.org/publication/PubMed/3770744"
}
]
},
{
"title": "Human liver glutathione S-transferases: complete primary sequence of an Ha subunit cDNA.",
"journal": "Biochem. Biophys. Res. Commun.",
"date": "1986",
"authors": "Tu C P, Qian B",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"reference": [
{
"type": "PubMed",
"id": "3800996",
"url": "https://glygen.org/publication/PubMed/3800996"
}
]
},
{
"title": "Esterase D: a new human polymorphism.",
"journal": "Annals of human genetics",
"date": "1973",
"authors": "Hopkinson DA, Mestriner MA, Cortner J, Harris H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "4768551",
"url": "https://glygen.org/publication/PubMed/4768551"
}
]
},
{
"title": "Two hepatic cytoplasmic protein fractions, Y and Z, and their possible role in the hepatic uptake of bilirubin, sulfobromophthalein, and other anions.",
"journal": "The Journal of clinical investigation",
"date": "1969",
"authors": "Levi AJ, Gatmaitan Z, Arias IM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "4980931",
"url": "https://glygen.org/publication/PubMed/4980931"
}
]
},
{
"title": "Human hypoxanthine phosphoribosyltransferase. I. Purification, properties, and specificity.",
"journal": "The Journal of biological chemistry",
"date": "1969",
"authors": "Krenitsky TA, Papaioannou R, Elion GB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "5767308",
"url": "https://glygen.org/publication/PubMed/5767308"
}
]
},
{
"title": "Human erythrocyte thiopurine methyltransferase: radiochemical microassay and biochemical properties.",
"journal": "Clinica chimica acta; international journal of clinical chemistry",
"date": "1978",
"authors": "Weinshilboum RM, Raymond FA, Pazmino PA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "657528",
"url": "https://glygen.org/publication/PubMed/657528"
}
]
},
{
"title": "Quantitation of plasma azathioprine and 6-mercaptopurine levels in renal transplant patients.",
"journal": "Transplantation",
"date": "1980",
"authors": "Lin SN, Jessup K, Floyd M, Wang TP, van Buren CT, Caprioli RM, Kahan BD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "6989049",
"url": "https://glygen.org/publication/PubMed/6989049"
}
]
},
{
"title": "Bilirubin binding to human liver ligandin (glutathione S-transferase).",
"journal": "The Journal of biological chemistry",
"date": "1980",
"authors": "Simons PC, Jagt DL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-189483",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483"
}
],
"reference": [
{
"type": "PubMed",
"id": "7372607",
"url": "https://glygen.org/publication/PubMed/7372607"
}
]
},
{
"title": "Extracellular superoxide dismutase (SOD3): tissue-specific expression, genomic characterization, and computer-assisted sequence analysis of the human EC SOD gene.",
"journal": "Genomics",
"date": "1994-07-01",
"authors": "Folz R J, Crapo J D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "7959763",
"url": "https://glygen.org/publication/PubMed/7959763"
}
]
},
{
"title": "Crystal structure of human class mu glutathione transferase GSTM2-2. Effects of lattice packing on conformational heterogeneity.",
"journal": "Journal of molecular biology",
"date": "1994",
"authors": "Raghunathan S, Chandross RJ, Kretsinger RH, Allison TJ, Penington CJ, Rule GS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "8182750",
"url": "https://glygen.org/publication/PubMed/8182750"
}
]
},
{
"title": "A comparison of the enzymatic and physicochemical properties of human glutathione transferase M4-4 and three other human Mu class enzymes.",
"journal": "Archives of biochemistry and biophysics",
"date": "1994",
"authors": "Comstock KE, Widersten M, Hao XY, Henner WD, Mannervik B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "8203914",
"url": "https://glygen.org/publication/PubMed/8203914"
}
]
},
{
"title": "Cloning and expression of cDNA for a human enzyme that hydrolyzes 8-oxo-dGTP, a mutagenic substrate for DNA synthesis.",
"journal": "The Journal of biological chemistry",
"date": "1993",
"authors": "Sakumi K, Furuichi M, Tsuzuki T, Kakuma T, Kawabata S, Maki H, Sekiguchi M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "8226881",
"url": "https://glygen.org/publication/PubMed/8226881"
}
]
},
{
"title": "Structure determination and refinement of human alpha class glutathione transferase A1-1, and a comparison with the Mu and Pi class enzymes.",
"journal": "J. Mol. Biol.",
"date": "1993",
"authors": "Sinning I, Kleywegt GJ, Cowan SW, Reinemer P, Dirr HW, Huber R, Gilliland GL, Armstrong RN, Ji X, Board PG, et al.",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
},
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "8331657",
"url": "https://glygen.org/publication/PubMed/8331657"
}
]
},
{
"title": "Characterization of two novel subunits of the alpha-class glutathione S-transferases of human liver.",
"journal": "Biochim. Biophys. Acta",
"date": "1993",
"authors": "Ahmad H, Singhal SS, Saxena M, Awasthi YC",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
},
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "8431482",
"url": "https://glygen.org/publication/PubMed/8431482"
}
]
},
{
"title": "Structural analysis of human alpha-class glutathione transferase A1-1 in the apo-form and in complexes with ethacrynic acid and its glutathione conjugate.",
"journal": "Structure",
"date": "1995",
"authors": "Cameron A D, Sinning I, L'Hermite G, Olin B, Board P G, Mannervik B, Jones T A",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"reference": [
{
"type": "PubMed",
"id": "8591048",
"url": "https://glygen.org/publication/PubMed/8591048"
}
]
},
{
"title": "Cloning and expression in vitro of human xanthine dehydrogenase/oxidase.",
"journal": "The Biochemical journal",
"date": "1996",
"authors": "Saksela M, Raivio KO",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "8670112",
"url": "https://glygen.org/publication/PubMed/8670112"
}
]
},
{
"title": "Identification and characterization of a novel human microsomal glutathione S-transferase with leukotriene C4 synthase activity and significant sequence identity to 5-lipoxygenase-activating protein and leukotriene C4 synthase.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Jakobsson PJ, Mancini JA, Ford-Hutchinson AW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "8703034",
"url": "https://glygen.org/publication/PubMed/8703034"
}
]
},
{
"title": "Structural organization of the human microsomal glutathione S-transferase gene (GST12).",
"journal": "Genomics",
"date": "1996",
"authors": "Kelner MJ, Stokely MN, Stovall NE, Montoya MA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "8812420",
"url": "https://glygen.org/publication/PubMed/8812420"
}
]
},
{
"title": "Stereoselective conjugation of prostaglandin A2 and prostaglandin J2 with glutathione, catalyzed by the human glutathione S-transferases A1-1, A2-2, M1a-1a, and P1-1.",
"journal": "Chemical research in toxicology",
"date": "1997-03",
"authors": "Bogaards J J, Venekamp J C, van Bladeren P J",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"reference": [
{
"type": "PubMed",
"id": "9084911",
"url": "https://glygen.org/publication/PubMed/9084911"
}
]
},
{
"title": "Tyrosine phosphorylation of the vav proto-oncogene product links FcepsilonRI to the Rac1-JNK pathway.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Teramoto H, Salem P, Robbins KC, Bustelo XR, Gutkind JS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "9099726",
"url": "https://glygen.org/publication/PubMed/9099726"
}
]
},
{
"title": "Kinetic mechanism of human hypoxanthine-guanine phosphoribosyltransferase: rapid phosphoribosyl transfer chemistry.",
"journal": "Biochemistry",
"date": "1997",
"authors": "Xu Y, Eads J, Sacchettini JC, Grubmeyer C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "9132023",
"url": "https://glygen.org/publication/PubMed/9132023"
}
]
},
{
"title": "An Nrf2/small Maf heterodimer mediates the induction of phase II detoxifying enzyme genes through antioxidant response elements.",
"journal": "Biochemical and biophysical research communications",
"date": "1997",
"authors": "Itoh K, Chiba T, Takahashi S, Ishii T, Igarashi K, Katoh Y, Oyake T, Hayashi N, Satoh K, Hatayama I, Yamamoto M, Nabeshima Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9818027",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027"
}
],
"reference": [
{
"type": "PubMed",
"id": "9240432",
"url": "https://glygen.org/publication/PubMed/9240432"
}
]
},
{
"title": "Identification and characterization of a novel microsomal enzyme with glutathione-dependent transferase and peroxidase activities.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Jakobsson PJ, Mancini JA, Riendeau D, Ford-Hutchinson AW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "9278457",
"url": "https://glygen.org/publication/PubMed/9278457"
}
]
},
{
"title": "Effect of 6-mercaptopurine on inosinic acid dehydrogenase in cultured human fibroblasts.",
"journal": "Biochemical pharmacology",
"date": "1976",
"authors": "Leyva A, Holmes EW Jr, kelley WN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9748787",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787"
}
],
"reference": [
{
"type": "PubMed",
"id": "942489",
"url": "https://glygen.org/publication/PubMed/942489"
}
]
},
{
"title": "Human theta class glutathione transferase: the crystal structure reveals a sulfate-binding pocket within a buried active site.",
"journal": "Structure (London, England : 1993)",
"date": "1998",
"authors": "Rossjohn J, McKinstry WJ, Oakley AJ, Verger D, Flanagan J, Chelvanayagam G, Tan KL, Board PG, Parker MW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "9551553",
"url": "https://glygen.org/publication/PubMed/9551553"
}
]
},
{
"title": "Purification and characterization of a novel alpha-class glutathione transferase from human liver.",
"journal": "The international journal of biochemistry & cell biology",
"date": "1998",
"authors": "Pastore A, Lo Bello M, Aureli G, Federici G, Ricci G, Di Ilio C, Petruzzelli R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-156590",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590"
}
],
"reference": [
{
"type": "PubMed",
"id": "9839448",
"url": "https://glygen.org/publication/PubMed/9839448"
}
]
}
],
"pathway": [
{
"id": "hsa:2938",
"name": "",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2938",
"resource": "KEGG Pathway"
},
{
"id": "R-HSA-156590",
"name": "Glutathione conjugation",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590",
"resource": "Reactome",
"description": "Glutathione conjugation"
},
{
"id": "R-HSA-189483",
"name": "Heme degradation",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-189483",
"resource": "Reactome",
"description": "Heme degradation"
},
{
"id": "R-HSA-9748787",
"name": "Azathioprine ADME",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748787",
"resource": "Reactome",
"description": "Azathioprine ADME"
},
{
"id": "R-HSA-9818027",
"name": "NFE2L2 regulating anti-oxidant/detoxification enzymes",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818027",
"resource": "Reactome",
"description": "NFE2L2 regulating anti-oxidant/detoxification enzymes"
}
],
"orthologs": [
{
"uniprot_canonical_ac": "A0A287AXU5-1",
"protein_name": "Glutathione S-transferase",
"gene_name": "LOC100526118",
"tax_id": 9823,
"organism": "Sus scrofa",
"sequence": {
"sequence": "MAGKPKLHYFDGRGRAEVIRWLLASAGVEFEEKFVDTLEDLEKLRNDGSLMFQQVPMIEIDGMKLVQTRAILNYIATKYDLCGKDIKERAAVDMYTEGIADIGEMIMLLPICPPDEKDAKMALIKERVSNHYLPAFEKVLKSHGQDYLVGNKLSRADIQLVELLYYVEELDPSLLANFPLLKALKTRVSNLPTVKKFLQPGSQRKPPTDEESLEKARRIFKFK",
"length": 223
},
"evidence": [
{
"id": "P08263",
"url": "https://omabrowser.org/oma/group/P08263/",
"database": "OMA"
}
],
"common_name": "Pig"
},
{
"uniprot_canonical_ac": "E9Q6L7-1",
"protein_name": "Glutathione S-transferase",
"gene_name": "Gsta5",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MAGKPVLHHFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLVQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLLICPPDQKEAKTALAKDRTKNRYLPAFEKVLKGHGQDYLVGNRLTRVDVHLLELLLYVEEFDASLLTPFPLLKAFKSRISSLPNVKKFLHPGSQRKPPLDAKQIEEARKIFKF",
"length": 222
},
"evidence": [
{
"id": "45930117",
"url": "http://www.informatics.jax.org/homology/45930117",
"database": "MGI"
}
],
"common_name": "Mouse"
},
{
"uniprot_canonical_ac": "P00502-1",
"protein_name": "Glutathione S-transferase alpha-1",
"gene_name": "Gsta1",
"tax_id": 10116,
"organism": "Rattus norvegicus",
"sequence": {
"sequence": "MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF",
"length": 222
},
"evidence": [
{
"id": "45930117",
"url": "http://www.informatics.jax.org/homology/45930117",
"database": "MGI"
},
{
"id": "45930119",
"url": "http://www.informatics.jax.org/homology/45930119",
"database": "MGI"
},
{
"id": "45930118",
"url": "http://www.informatics.jax.org/homology/45930118",
"database": "MGI"
},
{
"id": "45930121",
"url": "http://www.informatics.jax.org/homology/45930121",
"database": "MGI"
}
],
"common_name": "Rat"
},
{
"uniprot_canonical_ac": "P04903-1",
"protein_name": "Glutathione S-transferase alpha-2",
"gene_name": "Gsta2",
"tax_id": 10116,
"organism": "Rattus norvegicus",
"sequence": {
"sequence": "MSGKPVLHYFNARGRMECIRWLLAAAGVEFEEKLIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIIQLVICPPDQREAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKPAMDAKQIEEARKVFKF",
"length": 222
},
"evidence": [
{
"id": "45930117",
"url": "http://www.informatics.jax.org/homology/45930117",
"database": "MGI"
},
{
"id": "45930119",
"url": "http://www.informatics.jax.org/homology/45930119",
"database": "MGI"
},
{
"id": "45930118",
"url": "http://www.informatics.jax.org/homology/45930118",
"database": "MGI"
},
{
"id": "45930121",
"url": "http://www.informatics.jax.org/homology/45930121",
"database": "MGI"
}
],
"common_name": "Rat"
},
{
"uniprot_canonical_ac": "P04904-1",
"protein_name": "Glutathione S-transferase alpha-3",
"gene_name": "Gsta3",
"tax_id": 10116,
"organism": "Rattus norvegicus",
"sequence": {
"sequence": "MPGKPVLHYFDGRGRMEPIRWLLAAAGVEFEEQFLKTRDDLARLRNDGSLMFQQVPMVEIDGMKLVQTRAILNYIATKYNLYGKDMKERALIDMYAEGVADLDEIVLHYPYIPPGEKEASLAKIKDKARNRYFPAFEKVLKSHGQDYLVGNRLSRADVYLVQVLYHVEELDPSALANFPLLKALRTRVSNLPTVKKFLQPGSQRKPLEDEKCVESAVKIFS",
"length": 221
},
"evidence": [
{
"id": "45930117",
"url": "http://www.informatics.jax.org/homology/45930117",
"database": "MGI"
},
{
"id": "45930119",
"url": "http://www.informatics.jax.org/homology/45930119",
"database": "MGI"
},
{
"id": "45930118",
"url": "http://www.informatics.jax.org/homology/45930118",
"database": "MGI"
},
{
"id": "45930121",
"url": "http://www.informatics.jax.org/homology/45930121",
"database": "MGI"
}
],
"common_name": "Rat"
},
{
"uniprot_canonical_ac": "P09210-1",
"protein_name": "Glutathione S-transferase A2",
"gene_name": "GSTA2",
"tax_id": 9606,
"organism": "Homo sapiens",
"sequence": {
"sequence": "MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFSQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF",
"length": 222
},
"evidence": [
{
"id": "45930117",
"url": "http://www.informatics.jax.org/homology/45930117",
"database": "MGI"
},
{
"id": "45930119",
"url": "http://www.informatics.jax.org/homology/45930119",
"database": "MGI"
},
{
"id": "45930118",
"url": "http://www.informatics.jax.org/homology/45930118",
"database": "MGI"
},
{
"id": "45930121",
"url": "http://www.informatics.jax.org/homology/45930121",
"database": "MGI"
}
],
"common_name": "Human"
},
{
"uniprot_canonical_ac": "P10648-1",
"protein_name": "Glutathione S-transferase A2",
"gene_name": "Gsta2",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MAGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLVQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIGQLVLCPPDQREAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDVHLLELLLYVEELDASLLTPFPLLKAFKSRISSLPNVKKFLHPGSQRKPPLDAKQIEEARKVFKF",
"length": 222
},
"evidence": [
{
"id": "45930119",
"url": "http://www.informatics.jax.org/homology/45930119",
"database": "MGI"
}
],
"common_name": "Mouse"
},
{
"uniprot_canonical_ac": "P13745-1",
"protein_name": "Glutathione S-transferase A1",
"gene_name": "Gsta1",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MAGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLVLCPPDQREAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLEVLLYVEEFDASLLTPFPLLKAFKSRISSLPNVKKFLQPGSQRKPPMDAKQIQEARKAFKIQ",
"length": 223
},
"evidence": [
{
"id": "45930121",
"url": "http://www.informatics.jax.org/homology/45930121",
"database": "MGI"
},
{
"id": "P08263",
"url": "https://omabrowser.org/oma/group/P08263/",
"database": "OMA"
}
],
"common_name": "Mouse"
},
{
"uniprot_canonical_ac": "Q16772-1",
"protein_name": "Glutathione S-transferase A3",
"gene_name": "GSTA3",
"tax_id": 9606,
"organism": "Homo sapiens",
"sequence": {
"sequence": "MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF",
"length": 222
},
"evidence": [
{
"id": "45930117",
"url": "http://www.informatics.jax.org/homology/45930117",
"database": "MGI"
},
{
"id": "45930119",
"url": "http://www.informatics.jax.org/homology/45930119",
"database": "MGI"
},
{
"id": "45930118",
"url": "http://www.informatics.jax.org/homology/45930118",
"database": "MGI"
},
{
"id": "45930121",
"url": "http://www.informatics.jax.org/homology/45930121",
"database": "MGI"
}
],
"common_name": "Human"
},
{
"uniprot_canonical_ac": "Q6P8Q0-1",
"protein_name": "Glutathione S-transferase",
"gene_name": "Gm3776",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MAGKPVLHHFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLVLCPPDQREAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLEVLLYVEEFDASLLTPFPLLKAFKSRISSLPNVKKFLQPGSQRKPPMDAKQIQEARKAFKIQ",
"length": 223
},
"evidence": [
{
"id": "45930118",
"url": "http://www.informatics.jax.org/homology/45930118",
"database": "MGI"
}
],
"common_name": "Mouse"
},
{
"uniprot_canonical_ac": "Q7RTV2-1",
"protein_name": "Glutathione S-transferase A5",
"gene_name": "GSTA5",
"tax_id": 9606,
"organism": "Homo sapiens",
"sequence": {
"sequence": "MAEKPKLHYSNARGSMESIRWLLAAAGVELEEKFLESAEDLDKLRNDGSLLFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDMKERALIDMYTEGIVDLTEMILLLLICQPEERDAKTALVKEKIKNRYFPAFEKVLKSHRQDYLVGNKLSWADIHLVELFYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSQRKPPMDEKSLEEARKIFRF",
"length": 222
},
"evidence": [
{
"id": "45930117",
"url": "http://www.informatics.jax.org/homology/45930117",
"database": "MGI"
},
{
"id": "45930119",
"url": "http://www.informatics.jax.org/homology/45930119",
"database": "MGI"
},
{
"id": "45930118",
"url": "http://www.informatics.jax.org/homology/45930118",
"database": "MGI"
},
{
"id": "45930121",
"url": "http://www.informatics.jax.org/homology/45930121",
"database": "MGI"
}
],
"common_name": "Human"
}
],
"go_annotation": {
"categories": [
{
"name": "Molecular Function",
"total": 4,
"go_terms": [
{
"name": "glutathione transferase activity",
"id": "GO:0004364",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004364",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"pmid": ""
},
{
"name": "fatty acid binding",
"id": "GO:0005504",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005504",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"pmid": ""
},
{
"name": "steroid delta-isomerase activity",
"id": "GO:0004769",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004769",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"pmid": ""
},
{
"name": "glutathione peroxidase activity",
"id": "GO:0004602",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004602",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"pmid": ""
}
]
},
{
"name": "Cellular Component",
"total": 2,
"go_terms": [
{
"name": "cytosol",
"id": "GO:0005829",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"pmid": ""
},
{
"name": "extracellular exosome",
"id": "GO:0070062",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"pmid": ""
}
]
},
{
"name": "Biological Process",
"total": 6,
"go_terms": [
{
"name": "epithelial cell differentiation",
"id": "GO:0030855",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030855",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"pmid": ""
},
{
"name": "linoleic acid metabolic process",
"id": "GO:0043651",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043651",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"pmid": ""
},
{
"name": "xenobiotic metabolic process",
"id": "GO:0006805",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006805",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"pmid": ""
},
{
"name": "prostaglandin metabolic process",
"id": "GO:0006693",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006693",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"pmid": ""
},
{
"name": "glutathione derivative biosynthetic process",
"id": "GO:1901687",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901687",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"pmid": ""
},
{
"name": "glutathione metabolic process",
"id": "GO:0006749",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006749",
"evidence": [
{
"database": "UniProtKB",
"id": "P08263",
"url": "https://www.uniprot.org/uniprot/P08263"
}
],
"pmid": ""
}
]
}
]
},
"pro_annotation": [],
"site_annotation": [],
"ptm_annotation": [],
"interactions": [],
"reactions": [
{
"id": "16437",
"name": "",
"equation": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+)",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P04904-1",
"P46418-1",
"P24473-1",
"P30713-1",
"Q6AXY0-1",
"Q9QX69-1",
"O35543-1",
"Q9Z339-1",
"P08009-1",
"P14942-1",
"Q9Z1B2-1",
"Q6AXV9-1",
"Q5BK56-1",
"P00502-1",
"P04903-1",
"P04905-1",
"P04906-1",
"P57113-1",
"Q01579-1",
"P08010-1",
"P08011-1",
"Q4V8E6-1",
"A0A0G2K4Q5-1",
"F1LXL7-1",
"Q9Y2Q3-1",
"Q9H4Y5-1",
"P46439-1",
"Q03013-1",
"P78417-1",
"P08263-1",
"P0CG30-1",
"P09488-1",
"Q7RTV2-1",
"Q16772-1",
"P28161-1",
"P0CG29-1",
"O60760-1",
"P09211-1",
"P30711-1",
"P09210-1",
"O15217-1",
"O43813-1",
"P21266-1",
"P10620-1",
"O43708-1",
"Q99735-1",
"A0A1W2PR19-1",
"F6RWR5-1",
"Q9JHF7-1",
"E9Q6L7-1",
"Q9WVL0-1",
"O35660-1",
"P46425-1",
"P19639-1",
"P48774-1",
"Q9DCM2-1",
"Q99L20-1",
"O09131-1",
"P24472-1",
"P19157-1",
"Q61133-1",
"Q8K2Q2-1",
"Q80W21-1",
"O89112-1",
"P10648-1",
"P13745-1",
"P15626-1",
"P30115-1",
"P10649-1",
"Q64471-1",
"Q9D4P7-1",
"Q91VS7-1",
"Q6P8Q0-1",
"A2RST1-1",
"Q8R5I6-1",
"P17695-1",
"P25373-1",
"P36156-1",
"P40582-1",
"P48239-1",
"Q04806-1",
"Q12390-1",
"Q54GA9-1",
"Q54QV7-1",
"Q54VI4-1",
"Q55FF3-1",
"Q86AU1-1",
"Q556G3-1",
"Q9VG94-1",
"Q9VG96-1",
"Q7JYX0-1",
"P41043-1",
"P20432-1",
"Q9VG95-1",
"Q9VG98-1",
"Q9VG93-1",
"Q9VHD3-1",
"Q9VHD2-1"
],
"evidence": [
{
"id": "16437",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/16437"
}
]
},
{
"id": "43936",
"name": "",
"equation": "androst-5-ene-3,17-dione = androst-4-ene-3,17-dione",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P22071-1",
"P00502-1",
"P04904-1",
"P14060-1",
"P08263-1",
"P26439-1",
"Q16772-1",
"P24815-1",
"P13745-1",
"P30115-1",
"P26149-1"
],
"evidence": [
{
"id": "43936",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/43936"
}
]
},
{
"id": "48888",
"name": "",
"equation": "(13S)-hydroperoxy-(9Z,11E)-octadecadienoate + 2 glutathione = (13S)-hydroxy-(9Z,11E)-octadecadienoate + glutathione disulfide + H2O",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00502-1",
"P36970-1",
"P04041-1",
"P83645-1",
"P08263-1",
"P36969-1",
"P18283-1",
"P07203-1",
"P13745-1",
"O70325-1",
"P11352-1",
"Q9JHC0-1"
],
"evidence": [
{
"id": "48888",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/48888"
}
]
},
{
"id": "50796",
"name": "",
"equation": "glutathione + prostaglandin A2 = prostaglandin A2-S-(R)-glutathione",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00502-1",
"P04905-1",
"P08263-1",
"P09488-1",
"P13745-1",
"P10649-1"
],
"evidence": [
{
"id": "50796",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/50796"
}
]
},
{
"id": "50804",
"name": "",
"equation": "glutathione + prostaglandin J2 = prostaglandin J2-S-(R)-glutathione",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P00502-1",
"P04905-1",
"P04906-1",
"P08263-1",
"P09488-1",
"P09211-1",
"P13745-1",
"P19157-1",
"P10649-1"
],
"evidence": [
{
"id": "50804",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/50804"
}
]
},
{
"id": "R-HSA-176054",
"name": "GST dimers conjugate GSH with cytosolic substrates",
"equation": "",
"summary": "The glutathione S-transferases (GSTs) catalyze the nucleophilic attack by reduced glutathione (GSH) on nonpolar compounds that contain an electrophilic carbon, nitrogen, or sulphur atom. Their substrates include halogenonitrobenzenes, arene oxides, quinones, and alpha, beta-unsaturated carbonyls. Three major families of proteins are widely distributed in nature. Two of these, the cytosolic and mitochondrial GST, comprise soluble enzymes that are only distantly related whilst the third family comprises microsomal GST, referred to as membrane-associated proteins in eicosanoid and glutathione (MAPEG) metabolism.
At least 16 cytosolic GST subunits exist in human which are all in a dimeric form. Based on amino acid sequence similarities, seven classes of cytosolic GST are recognized in mammalian species; Alpha, Mu, Pi, Sigma, Theta, Omega, and Zeta (2\u20135). As well as being homodimers, the Alpha and Mu classes are also able to form heterodimers so a large number of isozymes are possible from all cytosolic GST subunits (Sinning et al. 1993, LeTrong et al. 2002, Ahmad et al. 1993, Pastore et al. 1998, Tars et al. 2010, Bruns et al. 1999, Balogh et al. 2010, Morel et al. 2002, Li et al. 2005, Patskovsky et al. 2006, Raghunathan et al. 1994, Patskovsky et al. 1999, Comstock et al. 1994, Board et al. 2000, Zhou et al. 2011, Zhou et al. 2012, Sun et al. 2011, Tars et al. 2006, Rossjohn et al. 1998, Polekhina et al. 2001, Inoue et al. 2003). Typical electrophilic substrates are chosen as examples for which the majority of the cytosolic GST isozymes act on.",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09210-1",
"Q16772-1",
"P0CG29-1",
"P78417-1",
"Q7RTV2-1",
"O60760-1",
"P46439-1",
"Q9H4Y5-1",
"P30711-1",
"P09211-1",
"O15217-1",
"P08263-1",
"P0CG30-1",
"P21266-1",
"O43708-1",
"P09488-1",
"P28161-1",
"Q03013-1"
],
"evidence": [
{
"id": "R-HSA-176054",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-176054"
}
]
},
{
"id": "R-HSA-9663492",
"name": "BIL dissociates from GSTA1, FABP1",
"equation": "",
"summary": "Once GSTA1 and FABP1 proteins transport bilirubin to the ER, it is assumed they must dissociate from BIL ((Levi et al. 1969, Simons & Jagt 1980) to allow its translocation, most likely by simple diffusion, into the ER lumen.",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P08263-1"
],
"evidence": [
{
"id": "R-HSA-9663492",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9663492"
}
]
},
{
"id": "R-HSA-9663511",
"name": "BIL binds GSTA1, FABP1",
"equation": "",
"summary": "Upon entry into the hepatocyte, bilirubin (BIL) can bind to one of two cytosolic binding proteins; \t; glutathione S-transferase A1 (GSTA1 aka ligandin, Y-protein), a major cytosolic protein that has both transport and detoxification functions or fatty acid-binding protein (FABP1 aka Z-protein) (Levi et al. 1969, Simons & Jagt 1980, Arias 2012). It is assumed GSTA1 transports BIL to the ER where it is detoxified by conjugation with a glucuronosyl moiety.",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P08263-1"
],
"evidence": [
{
"id": "R-HSA-9663511",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9663511"
}
]
},
{
"id": "R-HSA-9748996",
"name": "GST dimers cleave AZA to 6MP",
"equation": "",
"summary": "Azathioprine (AZA) was developed as a prodrug to 6-mercaptopurine (6MP) in order to counter the high first-pass metabolism of 6MP in the intestine. A nitroimidazol group was added to 6MP to create AZA. Human glutathione transferases (GSTs) A1-1, A2-2, and M1-1, all highly expressed in human liver, display high enzymatic activity towards AZA, cleaving it to release the antimetabolite 6-mercaptopurine (6MP) (Eklund et al. 2006, Moden & Mannervik 2014). After oral administration AZA is undetectable in blood, while 6MP appears after either oral or iv AZA administration (Lin et al. 1980). This is because, after ingestion, around 88% of AZA is converted to 6MP. The uncatalyzed reaction of AZA with glutathione is estimated to be <1% of the GST-catalyzed reaction. 6MP is released via a tetrahedral intermediate formed by nucleophilic attack of the glutathione thiolate (GS\u2212). The reaction is thought to be promoted by H-bonding or other polar interactions (Zhang et al. 2012). GSTs variants may be associated with AZA efficacy and pharmacokinetics (Lufaco et al. 2019).
",
"cellular_location": "cytosol",
"input_participant_list": [
"R-ALL-9748994"
],
"output_participant_list": [
"R-ALL-9748975"
],
"enzyme_list": [
"P09210-1",
"P08263-1",
"P09488-1"
],
"evidence": [
{
"id": "R-HSA-9748996",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9748996"
}
]
},
{
"id": "R-HSA-9760128",
"name": "AcK-NFE2L2-dependent GSTA1 gene expression",
"equation": "",
"summary": "Gluthathione-S-transferase contributes to the antioxidant response by catalyzing the conjugation of glutathione to a range of endogenous and exogenous compounds, including peroxides and other oxidizing agents (reviewed in Chatterjee et al, 2018; Baird and Yamamoto, 2020). GSTA1 expression is driven in part by the binding of a heterodimer of MAFK and acetylated NFE2L2 to the antioxidant response element (ARE) in the promoter (Itoh et al, 1997; Thimmulappa et al, 2002; Sun et al, 2009).",
"cellular_location": "cytosol, nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q09472-1",
"Q92793-1",
"P08263-1"
],
"evidence": [
{
"id": "R-HSA-9760128",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9760128"
}
]
}
],
"reaction_participants": [
{
"participant_id": "R-ALL-9748975",
"participant_name": "GS-nitroimidazole [cytosol]",
"crossref": [
{
"id": "180931",
"database": "ChEBI",
"url": ""
},
{
"id": "180931",
"database": "ChEBI",
"url": ""
},
{
"id": "180931",
"database": "ChEBI",
"url": ""
},
{
"id": "180931",
"database": "ChEBI",
"url": ""
},
{
"id": "180931",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9748994",
"participant_name": "AZA [cytosol]",
"crossref": [
{
"id": "7120",
"database": "Guide to Pharmacology",
"url": ""
},
{
"id": "PDBC00620",
"database": "PharmacoDB",
"url": ""
},
{
"id": "7120",
"database": "Guide to Pharmacology",
"url": ""
},
{
"id": "PDBC00620",
"database": "PharmacoDB",
"url": ""
},
{
"id": "7120",
"database": "Guide to Pharmacology",
"url": ""
},
{
"id": "PDBC00620",
"database": "PharmacoDB",
"url": ""
},
{
"id": "7120",
"database": "Guide to Pharmacology",
"url": ""
},
{
"id": "PDBC00620",
"database": "PharmacoDB",
"url": ""
},
{
"id": "PDBC00620",
"database": "PharmacoDB",
"url": ""
},
{
"id": "7120",
"database": "Guide to Pharmacology",
"url": ""
}
]
}
],
"reaction_enzymes": [
{
"uniprot_ac": "A0A0G2K4Q5",
"gene_name": "Gstp3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "A0A0G2K4Q5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A0G2K4Q5"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "A0A0G2K4Q5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A0G2K4Q5"
}
]
}
]
},
{
"uniprot_ac": "A0A1W2PR19",
"gene_name": "GSTT4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "A0A1W2PR19",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A1W2PR19"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "A0A1W2PR19",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A1W2PR19"
}
]
}
]
},
{
"uniprot_ac": "A2RST1",
"gene_name": "Mgst2",
"activity": [
{
"ec_number": "1.11.1.-",
"activity": "",
"evidence": [
{
"id": "A2RST1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A2RST1"
}
]
},
{
"ec_number": "4.4.1.20",
"activity": "leukotriene C4 = glutathione + leukotriene A4.",
"evidence": [
{
"id": "A2RST1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A2RST1"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "A2RST1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A2RST1"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "A2RST1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A2RST1"
}
]
}
]
},
{
"uniprot_ac": "E9Q6L7",
"gene_name": "Gsta5",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "E9Q6L7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/E9Q6L7"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "E9Q6L7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/E9Q6L7"
}
]
}
]
},
{
"uniprot_ac": "F1LXL7",
"gene_name": "AC097845.1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "F1LXL7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1LXL7"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "F1LXL7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F1LXL7"
}
]
}
]
},
{
"uniprot_ac": "F6RWR5",
"gene_name": "Gstp3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "F6RWR5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F6RWR5"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "F6RWR5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/F6RWR5"
}
]
}
]
},
{
"uniprot_ac": "O09131",
"gene_name": "Gsto1",
"activity": [
{
"ec_number": "1.20.4.2",
"activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.",
"evidence": [
{
"id": "O09131",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O09131"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.",
"evidence": [
{
"id": "O09131",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O09131"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "O09131",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O09131"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "O09131",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O09131"
}
]
},
{
"ec_number": "1.20.4.2",
"activity": "",
"evidence": [
{
"id": "O09131",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O09131"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "",
"evidence": [
{
"id": "O09131",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O09131"
}
]
}
]
},
{
"uniprot_ac": "O15217",
"gene_name": "GSTA4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "O15217",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O15217"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "O15217",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O15217"
}
]
}
]
},
{
"uniprot_ac": "O35543",
"gene_name": "Hpgds",
"activity": [
{
"ec_number": "5.3.99.2",
"activity": "prostaglandin H2 = prostaglandin D2.",
"evidence": [
{
"id": "O35543",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O35543"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "O35543",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O35543"
}
]
},
{
"ec_number": "5.3.99.2",
"activity": "",
"evidence": [
{
"id": "O35543",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O35543"
}
]
}
]
},
{
"uniprot_ac": "O35660",
"gene_name": "Gstm6",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "O35660",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O35660"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "O35660",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O35660"
}
]
}
]
},
{
"uniprot_ac": "O43708",
"gene_name": "GSTZ1",
"activity": [
{
"ec_number": "5.2.1.2",
"activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.",
"evidence": [
{
"id": "O43708",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43708"
}
]
},
{
"ec_number": "5.2.1.2",
"activity": "",
"evidence": [
{
"id": "O43708",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43708"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "O43708",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43708"
}
]
}
]
},
{
"uniprot_ac": "O43813",
"gene_name": "LANCL1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "O43813",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43813"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "O43813",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O43813"
}
]
}
]
},
{
"uniprot_ac": "O60760",
"gene_name": "HPGDS",
"activity": [
{
"ec_number": "5.3.99.2",
"activity": "prostaglandin H2 = prostaglandin D2.",
"evidence": [
{
"id": "O60760",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O60760"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "O60760",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O60760"
}
]
},
{
"ec_number": "5.3.99.2",
"activity": "",
"evidence": [
{
"id": "O60760",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O60760"
}
]
}
]
},
{
"uniprot_ac": "O70325",
"gene_name": "Gpx4",
"activity": [
{
"ec_number": "1.11.1.12",
"activity": "a hydroperoxy polyunsaturated fatty acid + 2 glutathione = a hydroxy polyunsaturated fatty acid + glutathione disulfide + H2O.",
"evidence": [
{
"id": "O70325",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O70325"
}
]
},
{
"ec_number": "1.11.1.9",
"activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.",
"evidence": [
{
"id": "O70325",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O70325"
}
]
},
{
"ec_number": "1.11.1.12",
"activity": "",
"evidence": [
{
"id": "O70325",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O70325"
}
]
}
]
},
{
"uniprot_ac": "O89112",
"gene_name": "Lancl1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "O89112",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O89112"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "O89112",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O89112"
}
]
}
]
},
{
"uniprot_ac": "P00502",
"gene_name": "Gsta1",
"activity": [
{
"ec_number": "1.11.1.-",
"activity": "",
"evidence": [
{
"id": "P00502",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00502"
}
]
},
{
"ec_number": "5.3.3.-",
"activity": "",
"evidence": [
{
"id": "P00502",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00502"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P00502",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00502"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P00502",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00502"
}
]
}
]
},
{
"uniprot_ac": "P04041",
"gene_name": "Gpx1",
"activity": [
{
"ec_number": "1.11.1.12",
"activity": "a hydroperoxy polyunsaturated fatty acid + 2 glutathione = a hydroxy polyunsaturated fatty acid + glutathione disulfide + H2O.",
"evidence": [
{
"id": "P04041",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04041"
}
]
},
{
"ec_number": "1.11.1.9",
"activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.",
"evidence": [
{
"id": "P04041",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04041"
}
]
},
{
"ec_number": "1.11.1.9",
"activity": "",
"evidence": [
{
"id": "P04041",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04041"
}
]
}
]
},
{
"uniprot_ac": "P04903",
"gene_name": "Gsta2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P04903",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04903"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P04903",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04903"
}
]
}
]
},
{
"uniprot_ac": "P04904",
"gene_name": "Gsta3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P04904",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04904"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P04904",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04904"
}
]
}
]
},
{
"uniprot_ac": "P04905",
"gene_name": "Gstm1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P04905",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04905"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P04905",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04905"
}
]
}
]
},
{
"uniprot_ac": "P04906",
"gene_name": "Gstp1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P04906",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04906"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P04906",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04906"
}
]
}
]
},
{
"uniprot_ac": "P07203",
"gene_name": "GPX1",
"activity": [
{
"ec_number": "1.11.1.12",
"activity": "a hydroperoxy polyunsaturated fatty acid + 2 glutathione = a hydroxy polyunsaturated fatty acid + glutathione disulfide + H2O.",
"evidence": [
{
"id": "P07203",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07203"
}
]
},
{
"ec_number": "1.11.1.9",
"activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.",
"evidence": [
{
"id": "P07203",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07203"
}
]
},
{
"ec_number": "1.11.1.9",
"activity": "",
"evidence": [
{
"id": "P07203",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07203"
}
]
}
]
},
{
"uniprot_ac": "P08009",
"gene_name": "Gstm7",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P08009",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08009"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P08009",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08009"
}
]
}
]
},
{
"uniprot_ac": "P08010",
"gene_name": "Gstm2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P08010",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08010"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P08010",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08010"
}
]
}
]
},
{
"uniprot_ac": "P08011",
"gene_name": "Mgst1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P08011",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08011"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P08011",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08011"
}
]
}
]
},
{
"uniprot_ac": "P08263",
"gene_name": "GSTA1",
"activity": [
{
"ec_number": "1.11.1.-",
"activity": "",
"evidence": [
{
"id": "P08263",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08263"
}
]
},
{
"ec_number": "5.3.3.-",
"activity": "",
"evidence": [
{
"id": "P08263",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08263"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P08263",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08263"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P08263",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08263"
}
]
}
]
},
{
"uniprot_ac": "P09210",
"gene_name": "GSTA2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P09210",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09210"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P09210",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09210"
}
]
}
]
},
{
"uniprot_ac": "P09211",
"gene_name": "GSTP1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P09211",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09211"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P09211",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09211"
}
]
}
]
},
{
"uniprot_ac": "P09488",
"gene_name": "GSTM1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P09488",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09488"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P09488",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09488"
}
]
}
]
},
{
"uniprot_ac": "P0CG29",
"gene_name": "GSTT2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P0CG29",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0CG29"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P0CG29",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0CG29"
}
]
}
]
},
{
"uniprot_ac": "P0CG30",
"gene_name": "GSTT2B",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P0CG30",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0CG30"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P0CG30",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P0CG30"
}
]
}
]
},
{
"uniprot_ac": "P10620",
"gene_name": "MGST1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P10620",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10620"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P10620",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10620"
}
]
}
]
},
{
"uniprot_ac": "P10648",
"gene_name": "Gsta2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P10648",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10648"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P10648",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10648"
}
]
}
]
},
{
"uniprot_ac": "P10649",
"gene_name": "Gstm1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P10649",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10649"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P10649",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P10649"
}
]
}
]
},
{
"uniprot_ac": "P11352",
"gene_name": "Gpx1",
"activity": [
{
"ec_number": "1.11.1.12",
"activity": "a hydroperoxy polyunsaturated fatty acid + 2 glutathione = a hydroxy polyunsaturated fatty acid + glutathione disulfide + H2O.",
"evidence": [
{
"id": "P11352",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11352"
}
]
},
{
"ec_number": "1.11.1.9",
"activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.",
"evidence": [
{
"id": "P11352",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11352"
}
]
},
{
"ec_number": "1.11.1.9",
"activity": "",
"evidence": [
{
"id": "P11352",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11352"
}
]
}
]
},
{
"uniprot_ac": "P13745",
"gene_name": "Gsta1",
"activity": [
{
"ec_number": "1.11.1.-",
"activity": "",
"evidence": [
{
"id": "P13745",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13745"
}
]
},
{
"ec_number": "5.3.3.-",
"activity": "",
"evidence": [
{
"id": "P13745",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13745"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P13745",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13745"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P13745",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P13745"
}
]
}
]
},
{
"uniprot_ac": "P14060",
"gene_name": "HSD3B1",
"activity": [
{
"ec_number": "1.1.1.270",
"activity": "4alpha-methyl-5alpha-cholest-7-en-3beta-ol + NADP(+) = 4alpha-methyl-5alpha-cholest-7-en-3-one + H(+) + NADPH.",
"evidence": [
{
"id": "P14060",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14060"
}
]
},
{
"ec_number": "1.1.1.145",
"activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.",
"evidence": [
{
"id": "P14060",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14060"
}
]
},
{
"ec_number": "5.3.3.1",
"activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.",
"evidence": [
{
"id": "P14060",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14060"
}
]
},
{
"ec_number": "1.1.1.210",
"activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.",
"evidence": [
{
"id": "P14060",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14060"
}
]
}
]
},
{
"uniprot_ac": "P14942",
"gene_name": "Gsta4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P14942",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14942"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P14942",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14942"
}
]
}
]
},
{
"uniprot_ac": "P15626",
"gene_name": "Gstm2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P15626",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P15626"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P15626",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P15626"
}
]
}
]
},
{
"uniprot_ac": "P17695",
"gene_name": "GRX2",
"activity": [
{
"ec_number": "1.11.1.9",
"activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.",
"evidence": [
{
"id": "P17695",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17695"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P17695",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17695"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P17695",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17695"
}
]
},
{
"ec_number": "1.11.1.9",
"activity": "",
"evidence": [
{
"id": "P17695",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17695"
}
]
}
]
},
{
"uniprot_ac": "P18283",
"gene_name": "GPX2",
"activity": [
{
"ec_number": "1.11.1.12",
"activity": "a hydroperoxy polyunsaturated fatty acid + 2 glutathione = a hydroxy polyunsaturated fatty acid + glutathione disulfide + H2O.",
"evidence": [
{
"id": "P18283",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P18283"
}
]
},
{
"ec_number": "1.11.1.9",
"activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.",
"evidence": [
{
"id": "P18283",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P18283"
}
]
},
{
"ec_number": "1.11.1.9",
"activity": "",
"evidence": [
{
"id": "P18283",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P18283"
}
]
}
]
},
{
"uniprot_ac": "P19157",
"gene_name": "Gstp1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P19157",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P19157"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P19157",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P19157"
}
]
}
]
},
{
"uniprot_ac": "P19639",
"gene_name": "Gstm3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P19639",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P19639"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P19639",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P19639"
}
]
}
]
},
{
"uniprot_ac": "P20432",
"gene_name": "GstD1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P20432",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20432"
}
]
},
{
"ec_number": "4.5.1.1",
"activity": "1,1,1-trichloro-2,2-bis(4-chlorophenyl)ethane = 1,1-dichloro-2,2-bis(4-chlorophenyl)ethylene + chloride + H(+).",
"evidence": [
{
"id": "P20432",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20432"
}
]
},
{
"ec_number": "4.5.1.1",
"activity": "",
"evidence": [
{
"id": "P20432",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20432"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P20432",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P20432"
}
]
}
]
},
{
"uniprot_ac": "P21266",
"gene_name": "GSTM3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P21266",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P21266"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P21266",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P21266"
}
]
}
]
},
{
"uniprot_ac": "P22071",
"gene_name": "Hsd3b1",
"activity": [
{
"ec_number": "1.1.1.270",
"activity": "4alpha-methyl-5alpha-cholest-7-en-3beta-ol + NADP(+) = 4alpha-methyl-5alpha-cholest-7-en-3-one + H(+) + NADPH.",
"evidence": [
{
"id": "P22071",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22071"
}
]
},
{
"ec_number": "1.1.1.145",
"activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.",
"evidence": [
{
"id": "P22071",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22071"
}
]
},
{
"ec_number": "5.3.3.1",
"activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.",
"evidence": [
{
"id": "P22071",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22071"
}
]
},
{
"ec_number": "1.1.1.210",
"activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.",
"evidence": [
{
"id": "P22071",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22071"
}
]
}
]
},
{
"uniprot_ac": "P24472",
"gene_name": "Gsta4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P24472",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24472"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P24472",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24472"
}
]
}
]
},
{
"uniprot_ac": "P24473",
"gene_name": "Gstk1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P24473",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24473"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P24473",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24473"
}
]
}
]
},
{
"uniprot_ac": "P24815",
"gene_name": "Hsd3b1",
"activity": [
{
"ec_number": "1.1.1.270",
"activity": "4alpha-methyl-5alpha-cholest-7-en-3beta-ol + NADP(+) = 4alpha-methyl-5alpha-cholest-7-en-3-one + H(+) + NADPH.",
"evidence": [
{
"id": "P24815",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24815"
}
]
},
{
"ec_number": "1.1.1.145",
"activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.",
"evidence": [
{
"id": "P24815",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24815"
}
]
},
{
"ec_number": "5.3.3.1",
"activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.",
"evidence": [
{
"id": "P24815",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24815"
}
]
},
{
"ec_number": "1.1.1.210",
"activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.",
"evidence": [
{
"id": "P24815",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24815"
}
]
}
]
},
{
"uniprot_ac": "P25373",
"gene_name": "GRX1",
"activity": [
{
"ec_number": "1.11.1.9",
"activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.",
"evidence": [
{
"id": "P25373",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P25373"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P25373",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P25373"
}
]
},
{
"ec_number": "1.11.1.9",
"activity": "",
"evidence": [
{
"id": "P25373",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P25373"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P25373",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P25373"
}
]
}
]
},
{
"uniprot_ac": "P26149",
"gene_name": "Hsd3b2",
"activity": [
{
"ec_number": "5.3.3.1",
"activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.",
"evidence": [
{
"id": "P26149",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P26149"
}
]
},
{
"ec_number": "1.1.1.145",
"activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.",
"evidence": [
{
"id": "P26149",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P26149"
}
]
}
]
},
{
"uniprot_ac": "P26439",
"gene_name": "HSD3B2",
"activity": [
{
"ec_number": "5.3.3.1",
"activity": "a 3-oxo-Delta(5)-steroid = a 3-oxo-Delta(4)-steroid.",
"evidence": [
{
"id": "P26439",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P26439"
}
]
},
{
"ec_number": "1.1.1.145",
"activity": "3beta-hydroxyandrost-5-en-17-one + NAD(+) = androst-5-ene-3,17-dione + H(+) + NADH.",
"evidence": [
{
"id": "P26439",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P26439"
}
]
}
]
},
{
"uniprot_ac": "P28161",
"gene_name": "GSTM2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P28161",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P28161"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P28161",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P28161"
}
]
}
]
},
{
"uniprot_ac": "P30115",
"gene_name": "Gsta3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P30115",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30115"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P30115",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30115"
}
]
}
]
},
{
"uniprot_ac": "P30711",
"gene_name": "GSTT1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P30711",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30711"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P30711",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30711"
}
]
}
]
},
{
"uniprot_ac": "P30713",
"gene_name": "Gstt2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P30713",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30713"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P30713",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30713"
}
]
}
]
},
{
"uniprot_ac": "P36156",
"gene_name": "ECM4",
"activity": [
{
"ec_number": "1.8.5.1",
"activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.",
"evidence": [
{
"id": "P36156",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P36156"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P36156",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P36156"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P36156",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P36156"
}
]
}
]
},
{
"uniprot_ac": "P36969",
"gene_name": "GPX4",
"activity": [
{
"ec_number": "1.11.1.12",
"activity": "a hydroperoxy polyunsaturated fatty acid + 2 glutathione = a hydroxy polyunsaturated fatty acid + glutathione disulfide + H2O.",
"evidence": [
{
"id": "P36969",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P36969"
}
]
},
{
"ec_number": "1.11.1.12",
"activity": "",
"evidence": [
{
"id": "P36969",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P36969"
}
]
},
{
"ec_number": "1.11.1.9",
"activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.",
"evidence": [
{
"id": "P36969",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P36969"
}
]
}
]
},
{
"uniprot_ac": "P36970",
"gene_name": "Gpx4",
"activity": [
{
"ec_number": "1.11.1.12",
"activity": "a hydroperoxy polyunsaturated fatty acid + 2 glutathione = a hydroxy polyunsaturated fatty acid + glutathione disulfide + H2O.",
"evidence": [
{
"id": "P36970",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P36970"
}
]
},
{
"ec_number": "1.11.1.9",
"activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.",
"evidence": [
{
"id": "P36970",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P36970"
}
]
},
{
"ec_number": "1.11.1.12",
"activity": "",
"evidence": [
{
"id": "P36970",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P36970"
}
]
}
]
},
{
"uniprot_ac": "P40582",
"gene_name": "GTT1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P40582",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P40582"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P40582",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P40582"
}
]
}
]
},
{
"uniprot_ac": "P41043",
"gene_name": "GstS1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P41043",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P41043"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P41043",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P41043"
}
]
}
]
},
{
"uniprot_ac": "P46418",
"gene_name": "Gsta5",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P46418",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P46418"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P46418",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P46418"
}
]
}
]
},
{
"uniprot_ac": "P46425",
"gene_name": "Gstp2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P46425",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P46425"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P46425",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P46425"
}
]
}
]
},
{
"uniprot_ac": "P46439",
"gene_name": "GSTM5",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P46439",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P46439"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P46439",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P46439"
}
]
}
]
},
{
"uniprot_ac": "P48239",
"gene_name": "GTO1",
"activity": [
{
"ec_number": "1.8.5.1",
"activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.",
"evidence": [
{
"id": "P48239",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P48239"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P48239",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P48239"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P48239",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P48239"
}
]
}
]
},
{
"uniprot_ac": "P48774",
"gene_name": "Gstm5",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P48774",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P48774"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P48774",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P48774"
}
]
}
]
},
{
"uniprot_ac": "P57113",
"gene_name": "Gstz1",
"activity": [
{
"ec_number": "5.2.1.2",
"activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.",
"evidence": [
{
"id": "P57113",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P57113"
}
]
},
{
"ec_number": "5.2.1.2",
"activity": "",
"evidence": [
{
"id": "P57113",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P57113"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P57113",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P57113"
}
]
}
]
},
{
"uniprot_ac": "P78417",
"gene_name": "GSTO1",
"activity": [
{
"ec_number": "1.20.4.2",
"activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.",
"evidence": [
{
"id": "P78417",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P78417"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.",
"evidence": [
{
"id": "P78417",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P78417"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "P78417",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P78417"
}
]
},
{
"ec_number": "1.20.4.2",
"activity": "",
"evidence": [
{
"id": "P78417",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P78417"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "",
"evidence": [
{
"id": "P78417",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P78417"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "P78417",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P78417"
}
]
}
]
},
{
"uniprot_ac": "P83645",
"gene_name": "Gpx2",
"activity": [
{
"ec_number": "1.11.1.12",
"activity": "a hydroperoxy polyunsaturated fatty acid + 2 glutathione = a hydroxy polyunsaturated fatty acid + glutathione disulfide + H2O.",
"evidence": [
{
"id": "P83645",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P83645"
}
]
},
{
"ec_number": "1.11.1.9",
"activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.",
"evidence": [
{
"id": "P83645",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P83645"
}
]
},
{
"ec_number": "1.11.1.9",
"activity": "",
"evidence": [
{
"id": "P83645",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P83645"
}
]
}
]
},
{
"uniprot_ac": "Q01579",
"gene_name": "Gstt1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q01579",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q01579"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q01579",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q01579"
}
]
}
]
},
{
"uniprot_ac": "Q03013",
"gene_name": "GSTM4",
"activity": [
{
"ec_number": "4.4.1.20",
"activity": "leukotriene C4 = glutathione + leukotriene A4.",
"evidence": [
{
"id": "Q03013",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03013"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q03013",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03013"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q03013",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q03013"
}
]
}
]
},
{
"uniprot_ac": "Q04806",
"gene_name": "GTO3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q04806",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04806"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q04806",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04806"
}
]
}
]
},
{
"uniprot_ac": "Q09472",
"gene_name": "EP300",
"activity": [
{
"ec_number": "2.3.1.48",
"activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].",
"evidence": [
{
"id": "Q09472",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q09472"
}
]
},
{
"ec_number": "2.3.1.-",
"activity": "",
"evidence": [
{
"id": "Q09472",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q09472"
}
]
},
{
"ec_number": "2.3.1.48",
"activity": "",
"evidence": [
{
"id": "Q09472",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q09472"
}
]
}
]
},
{
"uniprot_ac": "Q12390",
"gene_name": "GTT2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q12390",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12390"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q12390",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12390"
}
]
}
]
},
{
"uniprot_ac": "Q16772",
"gene_name": "GSTA3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q16772",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16772"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q16772",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16772"
}
]
}
]
},
{
"uniprot_ac": "Q4V8E6",
"gene_name": "Gstt4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q4V8E6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q4V8E6"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q4V8E6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q4V8E6"
}
]
}
]
},
{
"uniprot_ac": "Q54GA9",
"gene_name": "mgst",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q54GA9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54GA9"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q54GA9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54GA9"
}
]
}
]
},
{
"uniprot_ac": "Q54QV7",
"gene_name": "gsta5",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q54QV7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54QV7"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q54QV7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54QV7"
}
]
}
]
},
{
"uniprot_ac": "Q54VI4",
"gene_name": "gsta3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q54VI4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54VI4"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q54VI4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54VI4"
}
]
}
]
},
{
"uniprot_ac": "Q556G3",
"gene_name": "gsta2-2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q556G3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q556G3"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q556G3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q556G3"
}
]
}
]
},
{
"uniprot_ac": "Q55FF3",
"gene_name": "gsta1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q55FF3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q55FF3"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q55FF3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q55FF3"
}
]
}
]
},
{
"uniprot_ac": "Q5BK56",
"gene_name": "Gstm4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q5BK56",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5BK56"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q5BK56",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5BK56"
}
]
},
{
"ec_number": "4.4.1.20",
"activity": "leukotriene C4 = glutathione + leukotriene A4.",
"evidence": [
{
"id": "Q5BK56",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5BK56"
}
]
}
]
},
{
"uniprot_ac": "Q61133",
"gene_name": "Gstt2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q61133",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q61133"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q61133",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q61133"
}
]
}
]
},
{
"uniprot_ac": "Q64471",
"gene_name": "Gstt1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q64471",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64471"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q64471",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64471"
}
]
}
]
},
{
"uniprot_ac": "Q6AXV9",
"gene_name": "Gsto2",
"activity": [
{
"ec_number": "1.20.4.2",
"activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.",
"evidence": [
{
"id": "Q6AXV9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6AXV9"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.",
"evidence": [
{
"id": "Q6AXV9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6AXV9"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q6AXV9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6AXV9"
}
]
},
{
"ec_number": "1.20.4.2",
"activity": "",
"evidence": [
{
"id": "Q6AXV9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6AXV9"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q6AXV9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6AXV9"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "",
"evidence": [
{
"id": "Q6AXV9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6AXV9"
}
]
}
]
},
{
"uniprot_ac": "Q6AXY0",
"gene_name": "Gsta6",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q6AXY0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6AXY0"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q6AXY0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6AXY0"
}
]
}
]
},
{
"uniprot_ac": "Q6P8Q0",
"gene_name": "Gm3776",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q6P8Q0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6P8Q0"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q6P8Q0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6P8Q0"
}
]
}
]
},
{
"uniprot_ac": "Q7JYX0",
"gene_name": "GstE14",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q7JYX0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7JYX0"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q7JYX0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7JYX0"
}
]
}
]
},
{
"uniprot_ac": "Q7RTV2",
"gene_name": "GSTA5",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q7RTV2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7RTV2"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q7RTV2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7RTV2"
}
]
}
]
},
{
"uniprot_ac": "Q80W21",
"gene_name": "Gstm7",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q80W21",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q80W21"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q80W21",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q80W21"
}
]
}
]
},
{
"uniprot_ac": "Q86AU1",
"gene_name": "gsta4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q86AU1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q86AU1"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q86AU1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q86AU1"
}
]
}
]
},
{
"uniprot_ac": "Q8K2Q2",
"gene_name": "Gsto2",
"activity": [
{
"ec_number": "1.20.4.2",
"activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.",
"evidence": [
{
"id": "Q8K2Q2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8K2Q2"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.",
"evidence": [
{
"id": "Q8K2Q2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8K2Q2"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q8K2Q2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8K2Q2"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "",
"evidence": [
{
"id": "Q8K2Q2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8K2Q2"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q8K2Q2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8K2Q2"
}
]
},
{
"ec_number": "1.20.4.2",
"activity": "",
"evidence": [
{
"id": "Q8K2Q2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8K2Q2"
}
]
}
]
},
{
"uniprot_ac": "Q8R5I6",
"gene_name": "Gstm4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q8R5I6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8R5I6"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q8R5I6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8R5I6"
}
]
},
{
"ec_number": "4.4.1.20",
"activity": "leukotriene C4 = glutathione + leukotriene A4.",
"evidence": [
{
"id": "Q8R5I6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8R5I6"
}
]
}
]
},
{
"uniprot_ac": "Q91VS7",
"gene_name": "Mgst1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q91VS7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q91VS7"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q91VS7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q91VS7"
}
]
}
]
},
{
"uniprot_ac": "Q92793",
"gene_name": "CREBBP",
"activity": [
{
"ec_number": "2.3.1.48",
"activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].",
"evidence": [
{
"id": "Q92793",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q92793"
}
]
},
{
"ec_number": "2.3.1.48",
"activity": "",
"evidence": [
{
"id": "Q92793",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q92793"
}
]
},
{
"ec_number": "2.3.1.-",
"activity": "",
"evidence": [
{
"id": "Q92793",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q92793"
}
]
}
]
},
{
"uniprot_ac": "Q99735",
"gene_name": "MGST2",
"activity": [
{
"ec_number": "1.11.1.-",
"activity": "",
"evidence": [
{
"id": "Q99735",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99735"
}
]
},
{
"ec_number": "4.4.1.20",
"activity": "leukotriene C4 = glutathione + leukotriene A4.",
"evidence": [
{
"id": "Q99735",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99735"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q99735",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99735"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q99735",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99735"
}
]
}
]
},
{
"uniprot_ac": "Q99L20",
"gene_name": "Gstt3",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q99L20",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99L20"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q99L20",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99L20"
}
]
}
]
},
{
"uniprot_ac": "Q9D4P7",
"gene_name": "Gstt4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9D4P7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9D4P7"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9D4P7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9D4P7"
}
]
}
]
},
{
"uniprot_ac": "Q9DCM2",
"gene_name": "Gstk1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9DCM2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9DCM2"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9DCM2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9DCM2"
}
]
}
]
},
{
"uniprot_ac": "Q9H4Y5",
"gene_name": "GSTO2",
"activity": [
{
"ec_number": "1.20.4.2",
"activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.",
"evidence": [
{
"id": "Q9H4Y5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H4Y5"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.",
"evidence": [
{
"id": "Q9H4Y5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H4Y5"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9H4Y5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H4Y5"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9H4Y5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H4Y5"
}
]
}
]
},
{
"uniprot_ac": "Q9JHC0",
"gene_name": "Gpx2",
"activity": [
{
"ec_number": "1.11.1.12",
"activity": "a hydroperoxy polyunsaturated fatty acid + 2 glutathione = a hydroxy polyunsaturated fatty acid + glutathione disulfide + H2O.",
"evidence": [
{
"id": "Q9JHC0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9JHC0"
}
]
},
{
"ec_number": "1.11.1.9",
"activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.",
"evidence": [
{
"id": "Q9JHC0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9JHC0"
}
]
},
{
"ec_number": "1.11.1.9",
"activity": "",
"evidence": [
{
"id": "Q9JHC0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9JHC0"
}
]
}
]
},
{
"uniprot_ac": "Q9JHF7",
"gene_name": "Hpgds",
"activity": [
{
"ec_number": "5.3.99.2",
"activity": "prostaglandin H2 = prostaglandin D2.",
"evidence": [
{
"id": "Q9JHF7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9JHF7"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9JHF7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9JHF7"
}
]
},
{
"ec_number": "5.3.99.2",
"activity": "",
"evidence": [
{
"id": "Q9JHF7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9JHF7"
}
]
}
]
},
{
"uniprot_ac": "Q9QX69",
"gene_name": "Lancl1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9QX69",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9QX69"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9QX69",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9QX69"
}
]
}
]
},
{
"uniprot_ac": "Q9VG93",
"gene_name": "GstD7",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9VG93",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG93"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9VG93",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG93"
}
]
}
]
},
{
"uniprot_ac": "Q9VG94",
"gene_name": "GstD6",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9VG94",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG94"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9VG94",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG94"
}
]
}
]
},
{
"uniprot_ac": "Q9VG95",
"gene_name": "GstD5",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9VG95",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG95"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9VG95",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG95"
}
]
}
]
},
{
"uniprot_ac": "Q9VG96",
"gene_name": "GstD4",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9VG96",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG96"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9VG96",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG96"
}
]
}
]
},
{
"uniprot_ac": "Q9VG98",
"gene_name": "GstD2",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9VG98",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG98"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9VG98",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VG98"
}
]
}
]
},
{
"uniprot_ac": "Q9VHD2",
"gene_name": "GstZ2",
"activity": [
{
"ec_number": "5.2.1.2",
"activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.",
"evidence": [
{
"id": "Q9VHD2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VHD2"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9VHD2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VHD2"
}
]
},
{
"ec_number": "5.2.1.2",
"activity": "",
"evidence": [
{
"id": "Q9VHD2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VHD2"
}
]
}
]
},
{
"uniprot_ac": "Q9VHD3",
"gene_name": "GstZ1",
"activity": [
{
"ec_number": "5.2.1.2",
"activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.",
"evidence": [
{
"id": "Q9VHD3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VHD3"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9VHD3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VHD3"
}
]
},
{
"ec_number": "5.2.1.2",
"activity": "",
"evidence": [
{
"id": "Q9VHD3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9VHD3"
}
]
}
]
},
{
"uniprot_ac": "Q9WVL0",
"gene_name": "Gstz1",
"activity": [
{
"ec_number": "5.2.1.2",
"activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.",
"evidence": [
{
"id": "Q9WVL0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WVL0"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9WVL0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WVL0"
}
]
},
{
"ec_number": "5.2.1.2",
"activity": "",
"evidence": [
{
"id": "Q9WVL0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WVL0"
}
]
}
]
},
{
"uniprot_ac": "Q9Y2Q3",
"gene_name": "GSTK1",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9Y2Q3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y2Q3"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9Y2Q3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y2Q3"
}
]
}
]
},
{
"uniprot_ac": "Q9Z1B2",
"gene_name": "Gstm5",
"activity": [
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9Z1B2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z1B2"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9Z1B2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z1B2"
}
]
}
]
},
{
"uniprot_ac": "Q9Z339",
"gene_name": "Gsto1",
"activity": [
{
"ec_number": "1.20.4.2",
"activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.",
"evidence": [
{
"id": "Q9Z339",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z339"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.",
"evidence": [
{
"id": "Q9Z339",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z339"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).",
"evidence": [
{
"id": "Q9Z339",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z339"
}
]
},
{
"ec_number": "2.5.1.18",
"activity": "",
"evidence": [
{
"id": "Q9Z339",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z339"
}
]
},
{
"ec_number": "1.20.4.2",
"activity": "",
"evidence": [
{
"id": "Q9Z339",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z339"
}
]
},
{
"ec_number": "1.8.5.1",
"activity": "",
"evidence": [
{
"id": "Q9Z339",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z339"
}
]
}
]
}
],
"biomarkers": [],
"synthesized_glycans": [],
"cluster_types": [
{
"name": "homologset.oma",
"label": "OMA Homologs"
},
{
"name": "homologset.mgi",
"label": "MGI Homologs"
}
],
"sequence_features": {
"n_linked_sites": [],
"o_linked_sites": [],
"snv_sites": [],
"glycation_sites": [],
"phosphorylation_sites": [
37,
142,
202
],
"sequon_annotation_sites": []
},
"section_stats": [
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 3
},
{
"field": "total_sites",
"count": 3
}
],
"sort_fields": [
"start_pos",
"end_pos",
"kinase_uniprot_canonical_ac",
"kinase_gene_name",
"residue",
"comment",
"site_lbl"
]
},
{
"table_id": "snv",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv_non_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "publication",
"table_stats": [
{
"field": "total",
"count": 133
}
],
"sort_fields": [
"title",
"journal",
"date",
"authors"
]
}
]
}