{ "uniprot_canonical_ac": "P08047-1", "uniprot_ac": "P08047", "uniprot_id": "SP1_HUMAN", "mass": { "chemical_mass": 80693.0, "monoisotopic_mass": 80693.0 }, "refseq": { "ac": "NP_001238754", "name": "transcription factor Sp1 isoform c", "summary": "The protein encoded by this gene is a zinc finger transcription factor that binds to GC-rich motifs of many promoters. The encoded protein is involved in many cellular processes, including cell differentiation, cell growth, apoptosis, immune responses, response to DNA damage, and chromatin remodeling. Post-translational modifications such as phosphorylation, acetylation, glycosylation, and proteolytic processing significantly affect the activity of this protein, which can be an activator or a repressor. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2014].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001238754" }, "gene_names": [ { "name": "SP1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P08047", "id": "P08047" }, { "name": "SP1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001238754", "id": "NP_001238754" }, { "name": "TSFP1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P08047", "id": "P08047" } ], "protein_names": [ { "name": "Transcription factor Sp1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P08047" }, { "name": "specificity protein 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001238754", "id": "NP_001238754" }, { "name": "transcription factor Sp1 isoform c", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001238754", "id": "NP_001238754" } ], "function": [ { "annotation": "Effect of NFATc2- and Sp1-mediated TNFalpha Regulation on the Proliferation and Migration Behavior of Pancreatic Cancer Cells.", "evidence": [ { "database": "RefSeq", "id": "NP_001238754", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001238754" }, { "database": "PubMed", "id": "38035702", "url": "https://glygen.org/publication/PubMed/38035702" } ] }, { "annotation": "KDM4C-mediated senescence defense is a targetable vulnerability in gastric cancer harboring TP53 mutations. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001238754", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001238754" }, { "database": "PubMed", "id": "37848946", "url": "https://glygen.org/publication/PubMed/37848946" } ] }, { "annotation": "Over-expression of cFos by the Transcription Factors NFATc2 and Sp1 in Pancreatic Cancer Cells.", "evidence": [ { "database": "RefSeq", "id": "NP_001238754", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001238754" }, { "database": "PubMed", "id": "37909980", "url": "https://glygen.org/publication/PubMed/37909980" } ] }, { "annotation": "SP1 transcriptionally upregulates the expression of APOC3 in KGN cells to promote disease progression by regulating TLR2/NF-kappaB signalling pathway.", "evidence": [ { "database": "RefSeq", "id": "NP_001238754", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001238754" }, { "database": "PubMed", "id": "37902017", "url": "https://glygen.org/publication/PubMed/37902017" } ] }, { "annotation": "SP1-activated USP27X-AS1 promotes hepatocellular carcinoma progression via USP7-mediated AKT stabilisation.", "evidence": [ { "database": "RefSeq", "id": "NP_001238754", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001238754" }, { "database": "PubMed", "id": "38279869", "url": "https://glygen.org/publication/PubMed/38279869" } ] }, { "annotation": "The protein encoded by this gene is a zinc finger transcription factor that binds to GC-rich motifs of many promoters. The encoded protein is involved in many cellular processes, including cell differentiation, cell growth, apoptosis, immune responses, response to DNA damage, and chromatin remodeling. Post-translational modifications such as phosphorylation, acetylation, glycosylation, and proteolytic processing significantly affect the activity of this protein, which can be an activator or a repressor. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2014].", "evidence": [ { "database": "RefSeq", "id": "NP_001238754", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001238754" } ] }, { "annotation": "Transcription factor that can activate or repress transcription in response to physiological and pathological stimuli. Binds with high affinity to GC-rich motifs and regulates the expression of a large number of genes involved in a variety of processes such as cell growth, apoptosis, differentiation and immune responses. Highly regulated by post-translational modifications (phosphorylations, sumoylation, proteolytic cleavage, glycosylation and acetylation). Binds also the PDGFR-alpha G-box promoter. May have a role in modulating the cellular response to DNA damage. Implicated in chromatin remodeling. Plays an essential role in the regulation of FE65 gene expression. In complex with ATF7IP, maintains telomerase activity in cancer cells by inducing TERT and TERC gene expression. Isoform 3 is a stronger activator of transcription than isoform 1. Positively regulates the transcription of the core clock component BMAL1 (PubMed:10391891, PubMed:11371615, PubMed:11904305, PubMed:14593115, PubMed:16377629, PubMed:16478997, PubMed:16943418, PubMed:17049555, PubMed:18171990, PubMed:18199680, PubMed:18239466, PubMed:18513490, PubMed:18619531, PubMed:19193796, PubMed:20091743, PubMed:21798247, PubMed:21046154). Plays a role in the recruitment of SMARCA4/BRG1 on the c-FOS promoter. Plays a role in protecting cells against oxidative stress following brain injury by regulating the expression of RNF112 (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047#function" }, { "database": "PubMed", "id": "10391891", "url": "https://glygen.org/publication/PubMed/10391891" }, { "database": "PubMed", "id": "18513490", "url": "https://glygen.org/publication/PubMed/18513490" }, { "database": "PubMed", "id": "20091743", "url": "https://glygen.org/publication/PubMed/20091743" }, { "database": "PubMed", "id": "11371615", "url": "https://glygen.org/publication/PubMed/11371615" }, { "database": "PubMed", "id": "21798247", "url": "https://glygen.org/publication/PubMed/21798247" }, { "database": "PubMed", "id": "17049555", "url": "https://glygen.org/publication/PubMed/17049555" }, { "database": "PubMed", "id": "18239466", "url": "https://glygen.org/publication/PubMed/18239466" }, { "database": "PubMed", "id": "18619531", "url": "https://glygen.org/publication/PubMed/18619531" }, { "database": "PubMed", "id": "11904305", "url": "https://glygen.org/publication/PubMed/11904305" }, { "database": "PubMed", "id": "14593115", "url": "https://glygen.org/publication/PubMed/14593115" }, { "database": "PubMed", "id": "18171990", "url": "https://glygen.org/publication/PubMed/18171990" }, { "database": "UniProtKB", "id": "O89090", "url": "https://www.uniprot.org/uniprot/O89090#function" }, { "database": "PubMed", "id": "18199680", "url": "https://glygen.org/publication/PubMed/18199680" }, { "database": "PubMed", "id": "16377629", "url": "https://glygen.org/publication/PubMed/16377629" }, { "database": "UniProtKB", "id": "Q01714", "url": "https://www.uniprot.org/uniprot/Q01714#function" }, { "database": "PubMed", "id": "16478997", "url": "https://glygen.org/publication/PubMed/16478997" }, { "database": "PubMed", "id": "19193796", "url": "https://glygen.org/publication/PubMed/19193796" }, { "database": "PubMed", "id": "21046154", "url": "https://glygen.org/publication/PubMed/21046154" }, { "database": "PubMed", "id": "16943418", "url": "https://glygen.org/publication/PubMed/16943418" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "P08047", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P08047" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 126, "end_pos": 126, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (SST->NST); o-glyco-site-loss (S->N).", "chr_id": "12", "chr_pos": "53382324", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S126", "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs750438229", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750438229" }, { "id": "rs750438229", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750438229" }, { "id": "rs750438229", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750438229" } ], "glycoeffect": [ "n-glyco-sequon-gain", "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 134, "end_pos": 134, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SES->NES); o-glyco-site-loss (S->N).", "chr_id": "12", "chr_pos": "53382348", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S134", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P08047", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P08047" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 271, "end_pos": 271, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (SVS->NVS); o-glyco-site-loss (S->N).", "chr_id": "12", "chr_pos": "53382759", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S271", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1409503591", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1409503591" }, { "id": "rs1409503591", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1409503591#frequency_tab" }, { "id": "rs1409503591", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1409503591" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 120, "end_pos": 120, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "12", "chr_pos": "53382326", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S120", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs746349426", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746349426" }, { "id": "rs746349426", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746349426" }, { "id": "rs746349426", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746349426#frequency_tab" }, { "id": "rs746349426", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746349426" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 126, "end_pos": 126, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "12", "chr_pos": "53382323", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S126", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs769899910", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769899910" }, { "id": "rs769899910", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769899910" }, { "id": "rs769899910", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769899910" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 126, "end_pos": 126, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "12", "chr_pos": "53382325", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S126", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs775596739", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775596739" }, { "id": "rs775596739", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775596739" }, { "id": "rs775596739", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs775596739#frequency_tab" }, { "id": "rs775596739", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775596739" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 128, "end_pos": 128, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "12", "chr_pos": "53382330", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T128", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs775596739", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775596739" }, { "id": "rs775596739", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775596739" }, { "id": "rs775596739", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs775596739#frequency_tab" }, { "id": "rs775596739", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775596739" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 128, "end_pos": 128, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->N).", "chr_id": "12", "chr_pos": "53382330", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T128", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1211751174", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1211751174" }, { "id": "rs1211751174", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1211751174#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 276, "end_pos": 276, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "12", "chr_pos": "53382773", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T276", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1443880847", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1443880847" }, { "id": "rs1443880847", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1443880847" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 27, "end_pos": 27, "sequence_org": "G", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NGG->NGS).", "chr_id": "12", "chr_pos": "53381730", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "G27", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1448029279", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1448029279" }, { "id": "rs1448029279", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1448029279" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 325, "end_pos": 325, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NAN->NAS).", "chr_id": "12", "chr_pos": "53382921", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N325", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs368201460", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs368201460" }, { "id": "rs368201460", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs368201460" }, { "id": "rs368201460", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs368201460" }, { "id": "rs368201460", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs368201460#frequency_tab" }, { "id": "rs368201460", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs368201460" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 32, "end_pos": 32, "sequence_org": "G", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NGG->NGS).", "chr_id": "12", "chr_pos": "53381745", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "G32", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1014872752", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1014872752" }, { "id": "rs1014872752", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1014872752" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 332, "end_pos": 332, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TTS->NTS).", "chr_id": "12", "chr_pos": "53382942", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T332", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs781045537", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781045537" }, { "id": "rs781045537", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781045537" }, { "id": "rs781045537", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781045537" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 394, "end_pos": 394, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "12", "chr_pos": "53383128", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T394", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1349034988", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1349034988" }, { "id": "rs1349034988", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1349034988#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 40, "end_pos": 40, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SSS->NSS).", "chr_id": "12", "chr_pos": "53381770", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S40", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P08047", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P08047" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 421, "end_pos": 421, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "L", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->L).", "chr_id": "12", "chr_pos": "53383209", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S421", "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P08047", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P08047" }, { "id": "rs1447055936", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1447055936" }, { "id": "rs1447055936", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1447055936" }, { "id": "rs1447055936", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1447055936#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 446, "end_pos": 446, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "C", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->C).", "chr_id": "12", "chr_pos": "53383284", "ref_nt": "C", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "S446", "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ] }, { "evidence": [ { "id": "P08047", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P08047" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 455, "end_pos": 455, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "R", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->R).", "chr_id": "12", "chr_pos": "53383311", "ref_nt": "C", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "T455", "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs769748180", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769748180" }, { "id": "rs769748180", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769748180" }, { "id": "rs769748180", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769748180" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 498, "end_pos": 498, "sequence_org": "S", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SNT->NNT).", "chr_id": "12", "chr_pos": "53383440", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S498", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs760294506", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760294506" }, { "id": "rs760294506", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760294506" }, { "id": "rs760294506", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs760294506#frequency_tab" }, { "id": "rs760294506", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs760294506" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 510, "end_pos": 510, "sequence_org": "S", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->A).", "chr_id": "12", "chr_pos": "53383475", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S510", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs760294506", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760294506" }, { "id": "rs760294506", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760294506" }, { "id": "rs760294506", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs760294506#frequency_tab" }, { "id": "rs760294506", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs760294506" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 510, "end_pos": 510, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "12", "chr_pos": "53383475", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S510", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs955320750", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs955320750" }, { "id": "rs955320750", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs955320750" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 517, "end_pos": 517, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "12", "chr_pos": "53383496", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T517", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs779339105", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779339105" }, { "id": "rs779339105", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779339105" }, { "id": "rs779339105", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs779339105" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 558, "end_pos": 558, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NAP->NAS).", "chr_id": "12", "chr_pos": "53383619", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P558", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1248086337", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1248086337" }, { "id": "rs1248086337", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1248086337" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 612, "end_pos": 612, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "12", "chr_pos": "53406743", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S612", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs779541987", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779541987" }, { "id": "rs779541987", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779541987" }, { "id": "rs779541987", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs779541987" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 612, "end_pos": 612, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->N).", "chr_id": "12", "chr_pos": "53406744", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S612", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1290175428", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1290175428" }, { "id": "rs1290175428", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1290175428#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 77, "end_pos": 77, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NEN->NES).", "chr_id": "12", "chr_pos": "53382177", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N77", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 101, "end_pos": 101, "sequence_org": "S", "sequence_mut": "A", "comment": "Significant reduction of phosphorylation on DNA damage.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18619531", "url": "https://glygen.org/publication/PubMed/18619531" }, { "database": "PubMed", "id": "18171990", "url": "https://glygen.org/publication/PubMed/18171990" } ] }, { "start_pos": 101, "end_pos": 101, "sequence_org": "S", "sequence_mut": "D", "comment": "Increase in phosphorylation on DNA damage.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18619531", "url": "https://glygen.org/publication/PubMed/18619531" }, { "database": "PubMed", "id": "18171990", "url": "https://glygen.org/publication/PubMed/18171990" } ] }, { "start_pos": 117, "end_pos": 117, "sequence_org": "T", "sequence_mut": "A", "comment": "No effect on activated MAPK8-mediated phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18199680", "url": "https://glygen.org/publication/PubMed/18199680" } ] }, { "start_pos": 15, "end_pos": 15, "sequence_org": "V", "sequence_mut": "R", "comment": "Enhanced transcriptional activity.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ] }, { "start_pos": 16, "end_pos": 16, "sequence_org": "K", "sequence_mut": "R", "comment": "Loss of sumoylation. No cleavage and reduced transcriptional activity.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "16407261", "url": "https://glygen.org/publication/PubMed/16407261" } ] }, { "start_pos": 18, "end_pos": 18, "sequence_org": "E", "sequence_mut": "A", "comment": "Loss of sumoylation. Increased cleavage and enhanced transcriptional activity.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "16407261", "url": "https://glygen.org/publication/PubMed/16407261" } ] }, { "start_pos": 19, "end_pos": 19, "sequence_org": "K", "sequence_mut": "R", "comment": "No effect on sumoylation nor on proteolytic cleavage.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "16407261", "url": "https://glygen.org/publication/PubMed/16407261" } ] }, { "start_pos": 220, "end_pos": 220, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on dephosphorylation by PP2A.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "17049555", "url": "https://glygen.org/publication/PubMed/17049555" } ] }, { "start_pos": 250, "end_pos": 250, "sequence_org": "T", "sequence_mut": "A", "comment": "No effect on phosphorylation on DNA damage.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18619531", "url": "https://glygen.org/publication/PubMed/18619531" } ] }, { "start_pos": 278, "end_pos": 278, "sequence_org": "T", "sequence_mut": "A", "comment": "Almost complete abolition of activated MAPK8-mediated phosphorylation and 40% reduction in protein levels during mitosis. Protein levels reduced by 70% during mitosis; when associated with A-739.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18199680", "url": "https://glygen.org/publication/PubMed/18199680" } ] }, { "start_pos": 278, "end_pos": 278, "sequence_org": "T", "sequence_mut": "D", "comment": "Increased protein stability during mitosis; when associated with D-739.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18199680", "url": "https://glygen.org/publication/PubMed/18199680" } ] }, { "start_pos": 281, "end_pos": 281, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on phosphorylation on DNA damage.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18619531", "url": "https://glygen.org/publication/PubMed/18619531" } ] }, { "start_pos": 291, "end_pos": 291, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on phosphorylation on DNA damage.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18619531", "url": "https://glygen.org/publication/PubMed/18619531" } ] }, { "start_pos": 296, "end_pos": 296, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on phosphorylation on DNA damage.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18619531", "url": "https://glygen.org/publication/PubMed/18619531" } ] }, { "start_pos": 313, "end_pos": 313, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on phosphorylation on DNA damage.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18619531", "url": "https://glygen.org/publication/PubMed/18619531" } ] }, { "start_pos": 351, "end_pos": 351, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on phosphorylation on DNA damage.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18619531", "url": "https://glygen.org/publication/PubMed/18619531" } ] }, { "start_pos": 355, "end_pos": 355, "sequence_org": "T", "sequence_mut": "A", "comment": "No effect on dephosphorylation by PP2A.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "17049555", "url": "https://glygen.org/publication/PubMed/17049555" }, { "database": "PubMed", "id": "11904305", "url": "https://glygen.org/publication/PubMed/11904305" } ] }, { "start_pos": 36, "end_pos": 36, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on phosphorylation on DNA damage.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18619531", "url": "https://glygen.org/publication/PubMed/18619531" } ] }, { "start_pos": 394, "end_pos": 394, "sequence_org": "T", "sequence_mut": "A", "comment": "No effect on phosphorylation on DNA damage.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18619531", "url": "https://glygen.org/publication/PubMed/18619531" } ] }, { "start_pos": 427, "end_pos": 427, "sequence_org": "T", "sequence_mut": "A", "comment": "No effect on phosphorylation on DNA damage.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18619531", "url": "https://glygen.org/publication/PubMed/18619531" } ] }, { "start_pos": 431, "end_pos": 431, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on phosphorylation on DNA damage.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18619531", "url": "https://glygen.org/publication/PubMed/18619531" } ] }, { "start_pos": 453, "end_pos": 453, "sequence_org": "T", "sequence_mut": "A", "comment": "Abolishes MAPK-mediated phosphorylation, 50% reduction in MAPK1/MAPK3-mediated activity on VEGF promoter and no effect on dephosphorylation by PP2A. Greatly reduced MAPK1-mediated activity on VEGF promoter; when associated with A-739.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "17049555", "url": "https://glygen.org/publication/PubMed/17049555" }, { "database": "PubMed", "id": "11904305", "url": "https://glygen.org/publication/PubMed/11904305" }, { "database": "PubMed", "id": "14593115", "url": "https://glygen.org/publication/PubMed/14593115" } ] }, { "start_pos": 491, "end_pos": 491, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of O-glycosylation. Increase in transcriptional activity.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "11371615", "url": "https://glygen.org/publication/PubMed/11371615" }, { "database": "PubMed", "id": "9343410", "url": "https://glygen.org/publication/PubMed/9343410" } ] }, { "start_pos": 56, "end_pos": 56, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on phosphorylation on DNA damage.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18619531", "url": "https://glygen.org/publication/PubMed/18619531" } ] }, { "start_pos": 59, "end_pos": 59, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of phosphorylation. No effect on activated MAPK8-mediated phosphorylation. Similar loss of phosphorylation as by dephosphorylation by PP2AC. Reduced proteolytic processing.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "17049555", "url": "https://glygen.org/publication/PubMed/17049555" }, { "database": "PubMed", "id": "18239466", "url": "https://glygen.org/publication/PubMed/18239466" }, { "database": "PubMed", "id": "18199680", "url": "https://glygen.org/publication/PubMed/18199680" } ] }, { "start_pos": 59, "end_pos": 59, "sequence_org": "S", "sequence_mut": "E", "comment": "Some association with chromatin, increased phosphorylation levels and decreased glycosylation.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "17049555", "url": "https://glygen.org/publication/PubMed/17049555" }, { "database": "PubMed", "id": "18239466", "url": "https://glygen.org/publication/PubMed/18239466" }, { "database": "PubMed", "id": "18199680", "url": "https://glygen.org/publication/PubMed/18199680" } ] }, { "start_pos": 612, "end_pos": 612, "sequence_org": "S", "sequence_mut": "A", "comment": "Diminished glycosylation. Inhibits transcriptional activity; when associated with A-640; A-641; A-698 and A-702.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18513490", "url": "https://glygen.org/publication/PubMed/18513490" } ] }, { "start_pos": 640, "end_pos": 640, "sequence_org": "T", "sequence_mut": "A", "comment": "Diminished glycosylation. Inhibits transcriptional activity; when associated with A-612; A-641; A-698 and A-702.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18513490", "url": "https://glygen.org/publication/PubMed/18513490" } ] }, { "start_pos": 641, "end_pos": 641, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes PRKCzeta-mediated phosphorylation. Diminished glycosylation. Inhibits transcriptional activity; when associated with A-612; A-640; A-641 and A-702.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18513490", "url": "https://glygen.org/publication/PubMed/18513490" }, { "database": "PubMed", "id": "16943418", "url": "https://glygen.org/publication/PubMed/16943418" } ] }, { "start_pos": 651, "end_pos": 651, "sequence_org": "T", "sequence_mut": "A", "comment": "No effect on dephosphorylation by PP2A.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "17049555", "url": "https://glygen.org/publication/PubMed/17049555" } ] }, { "start_pos": 668, "end_pos": 668, "sequence_org": "T", "sequence_mut": "A", "comment": "Abolishes PRKCzeta-mediated but not PKCdelta-mediated phosphorylation. No effect on DNA binding; when associated with A-670 and A-681.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18258854", "url": "https://glygen.org/publication/PubMed/18258854" } ] }, { "start_pos": 670, "end_pos": 670, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes PRKCzeta-mediated but not PKCdelta-mediated phosphorylation. No effect on DNA binding; when associated with A-668 and A-681.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18258854", "url": "https://glygen.org/publication/PubMed/18258854" } ] }, { "start_pos": 681, "end_pos": 681, "sequence_org": "T", "sequence_mut": "A", "comment": "Abolishes PRKCzeta-mediated but not PKCdelta-mediated phosphorylation. Some effect on dephosphorylation by PP2A. No effect on DNA binding; when associated with A-668 and A-681.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "17049555", "url": "https://glygen.org/publication/PubMed/17049555" }, { "database": "PubMed", "id": "18258854", "url": "https://glygen.org/publication/PubMed/18258854" } ] }, { "start_pos": 698, "end_pos": 698, "sequence_org": "S", "sequence_mut": "A", "comment": "Diminished glycosylation. Inhibits transcriptional activity; when associated with A-612; A-640; A-641 and A-702.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18513490", "url": "https://glygen.org/publication/PubMed/18513490" } ] }, { "start_pos": 702, "end_pos": 702, "sequence_org": "S", "sequence_mut": "A", "comment": "Diminished glycosylation. Inhibits transcriptional activity; when associated with A-612; A-640; A-641 and A-698.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18513490", "url": "https://glygen.org/publication/PubMed/18513490" } ] }, { "start_pos": 703, "end_pos": 703, "sequence_org": "K", "sequence_mut": "A", "comment": "Abolishes acetylation. Increases recruitment of p300 to the promoter and enhances gene transcription.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "16478997", "url": "https://glygen.org/publication/PubMed/16478997" } ] }, { "start_pos": 728, "end_pos": 728, "sequence_org": "S", "sequence_mut": "A", "comment": "Exhibits attenuated endoproteolytic cleavage; when associated with A-732.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18239466", "url": "https://glygen.org/publication/PubMed/18239466" } ] }, { "start_pos": 732, "end_pos": 732, "sequence_org": "S", "sequence_mut": "A", "comment": "Exhibits attenuated endoproteolytic cleavage; when associated with A-728.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18239466", "url": "https://glygen.org/publication/PubMed/18239466" } ] }, { "start_pos": 739, "end_pos": 739, "sequence_org": "T", "sequence_mut": "A", "comment": "Abolishes MAPK-mediated phosphorylation. 50% reduction in MAPK1/MAPK3-mediated activity on VEGF promoter, 40% reduction in protein levels during mitosis and no effect on dephosphorylation by PP2A. Greatly reduced MAPK1-mediated activity on VEGF promoter; when associated with A-453. Protein levels during mitosis reduced by 70%; when associated with A-278.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "17049555", "url": "https://glygen.org/publication/PubMed/17049555" }, { "database": "PubMed", "id": "11904305", "url": "https://glygen.org/publication/PubMed/11904305" }, { "database": "PubMed", "id": "14593115", "url": "https://glygen.org/publication/PubMed/14593115" }, { "database": "PubMed", "id": "18199680", "url": "https://glygen.org/publication/PubMed/18199680" } ] }, { "start_pos": 739, "end_pos": 739, "sequence_org": "T", "sequence_mut": "D", "comment": "Increased protein stability during mitosis; when associated with D-278.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "17049555", "url": "https://glygen.org/publication/PubMed/17049555" }, { "database": "PubMed", "id": "11904305", "url": "https://glygen.org/publication/PubMed/11904305" }, { "database": "PubMed", "id": "14593115", "url": "https://glygen.org/publication/PubMed/14593115" }, { "database": "PubMed", "id": "18199680", "url": "https://glygen.org/publication/PubMed/18199680" } ] }, { "start_pos": 73, "end_pos": 73, "sequence_org": "S", "sequence_mut": "A", "comment": "Little effect on activated MAPK8-mediated phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18199680", "url": "https://glygen.org/publication/PubMed/18199680" } ] }, { "start_pos": 7, "end_pos": 7, "sequence_org": "S", "sequence_mut": "A", "comment": "Increase in protein stability. No change in sumoylation.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18239466", "url": "https://glygen.org/publication/PubMed/18239466" } ] }, { "start_pos": 81, "end_pos": 81, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on phosphorylation on DNA damage.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18619531", "url": "https://glygen.org/publication/PubMed/18619531" } ] }, { "start_pos": 85, "end_pos": 85, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on phosphorylation on DNA damage.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18619531", "url": "https://glygen.org/publication/PubMed/18619531" } ] }, { "start_pos": 98, "end_pos": 98, "sequence_org": "T", "sequence_mut": "A", "comment": "No effect on phosphorylation on DNA damage.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18619531", "url": "https://glygen.org/publication/PubMed/18619531" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "74.91", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000185591", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185591" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "93.11", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185591", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185591" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "77.95", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000185591", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185591" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000185591", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185591" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "91.78", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185591", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185591" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "93.12", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185591", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185591" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000185591", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185591" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "91.6", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185591", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185591" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "87.79", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185591", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185591" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000185591", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185591" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "85.55", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185591", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185591" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "85.41", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185591", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185591" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "90.45", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185591", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185591" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P08047", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08047" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P08047", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08047" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P08047", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08047" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P08047", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08047" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P08047", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08047" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P08047", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08047" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P08047", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08047" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P08047", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08047" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P08047", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08047" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P08047", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08047" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P08047", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08047" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P08047", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P08047" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "common_name": "Human" } ], "gene": [ { "name": "SP1", "url": "https://www.uniprot.org/uniprot/P08047", "locus": { "chromosome": "12", "start_pos": 53416446, "end_pos": 53380176, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000185591", "url": "https://www.ensembl.org/id/ENSG00000185591" } ] } } ], "crossref": [ { "id": "ENSG00000185591", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185591", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P08047", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P08047", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd22539", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd22539", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL6103", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL6103", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "SP1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=SP1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "6667", "url": "https://www.ncbi.nlm.nih.gov/gene/6667", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "605", "url": "https://glyconnect.expasy.org/browser/proteins/605", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "11205", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=11205", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P08047", "url": "https://www.ebi.ac.uk/intact/interactors/id:P08047*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR013087", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013087", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036236", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036236", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:6667", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:6667", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "189906", "url": "http://www.omim.org/entry/189906", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P08047", "url": "https://www.nextprot.org/entry/NX_P08047", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P08047", "url": "https://oglcnac.org/atlas/detail/P08047", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "NWSFCGK", "url": "https://omabrowser.org/oma/group/NWSFCGK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5396935at2759", "url": "http://www.orthodb.org/?query=5396935at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23235", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23235", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23235:SF16", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23235:SF16", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1SP1", "url": "https://www.rcsb.org/structure/1SP1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1SP2", "url": "https://www.rcsb.org/structure/1SP2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1VA1", "url": "https://www.rcsb.org/structure/1VA1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1VA2", "url": "https://www.rcsb.org/structure/1VA2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1VA3", "url": "https://www.rcsb.org/structure/1VA3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6PV0", "url": "https://www.rcsb.org/structure/6PV0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6PV1", "url": "https://www.rcsb.org/structure/6PV1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6PV2", "url": "https://www.rcsb.org/structure/6PV2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6PV3", "url": "https://www.rcsb.org/structure/6PV3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6UCO", "url": "https://www.rcsb.org/structure/6UCO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6UCP", "url": "https://www.rcsb.org/structure/6UCP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00096", "url": "http://pfam.xfam.org/family/PF00096", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P08047", "url": "https://pharos.nih.gov/targets/P08047", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P08047", "url": "http://purl.obolibrary.org/obo/PR_P08047", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2559585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559585", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9735871", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9735871", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9762293", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9762293", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9818030", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818030", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001238754", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001238754", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "H3BUU5", "url": "https://www.uniprot.org/uniprot/H3BUU5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BUU5-1", "url": "https://www.uniprot.org/uniprot/H3BUU5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BVI2", "url": "https://www.uniprot.org/uniprot/H3BVI2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BVI2-1", "url": "https://www.uniprot.org/uniprot/H3BVI2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P08047-1", "url": "https://www.uniprot.org/uniprot/P08047-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P08047-2", "url": "https://www.uniprot.org/uniprot/P08047-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P08047-3", "url": "https://www.uniprot.org/uniprot/P08047-3", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSTGGGGQESQPSPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQGLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPVTSGTTISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSSGTNSQGQTPQRVSGLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGGQALQALQAAPLSGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSINISGNGF", "length": 785, "header": "sp|P08047-1|SP1_HUMAN Isoform 1 of Transcription factor Sp1 OS=Homo sapiens OX=9606 GN=SP1 PE=1 SV=3 CANONICAL=P08047-1" }, "isoforms": [ { "isoform_ac": "H3BUU5-1", "url": "", "sequence": { "sequence": "MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSTGGGGQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGA", "length": 162, "header": "tr|H3BUU5-1|SP1_HUMAN Computationally mapped isoform of Transcription factor Sp1 OS=Homo sapiens OX=9606 GN=SP1 PE=1 SV=1 CANONICAL=P08047-1" }, "locus": { "chromosome": "12", "start_pos": 53382577, "end_pos": 53380292, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000551969.5", "url": "https://www.ensembl.org/id/ENST00000551969.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000457804.1", "url": "https://www.ensembl.org/id/ENSP00000457804.1" } ] } }, { "isoform_ac": "H3BVI2-1", "url": "", "sequence": { "sequence": "MDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSTGGGGQESQPSPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVP", "length": 230, "header": "tr|H3BVI2-1|SP1_HUMAN Computationally mapped isoform of Transcription factor Sp1 OS=Homo sapiens OX=9606 GN=SP1 PE=1 SV=1 CANONICAL=P08047-1" }, "locus": { "chromosome": "12", "start_pos": 53382658, "end_pos": 53381673, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000548560.1", "url": "https://www.ensembl.org/id/ENST00000548560.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000458133.1", "url": "https://www.ensembl.org/id/ENSP00000458133.1" } ] } }, { "isoform_ac": "P08047-1", "url": "", "sequence": { "sequence": "MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSTGGGGQESQPSPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQGLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPVTSGTTISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSSGTNSQGQTPQRVSGLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGGQALQALQAAPLSGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSINISGNGF", "length": 785, "header": "sp|P08047-1|SP1_HUMAN Isoform 1 of Transcription factor Sp1 OS=Homo sapiens OX=9606 GN=SP1 PE=1 SV=3 CANONICAL=P08047-1" }, "locus": { "chromosome": "12", "start_pos": 53411237, "end_pos": 53380292, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000327443.9", "url": "https://www.ensembl.org/id/ENST00000327443.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000329357.4", "url": "https://www.ensembl.org/id/ENSP00000329357.4" } ] } }, { "isoform_ac": "P08047-2", "url": "", "sequence": { "sequence": "MDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSTGGGGQESQPSPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQGLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPVTSGTTISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSSGTNSQGQTPQRVSGLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGGQALQALQAAPLSGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSINISGNGF", "length": 778, "header": "sp|P08047-2|SP1_HUMAN Isoform 2 of Transcription factor Sp1 OS=Homo sapiens OX=9606 GN=SP1 PE=1 SV=3 CANONICAL=P08047-1" }, "locus": { "chromosome": "12", "start_pos": 53411237, "end_pos": 53381673, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000426431.2", "url": "https://www.ensembl.org/id/ENST00000426431.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000404263.2", "url": "https://www.ensembl.org/id/ENSP00000404263.2" } ] } }, { "isoform_ac": "P08047-3", "url": "", "sequence": { "sequence": "MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSTGGGGQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQGLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPVTSGTTISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSSGTNSQGQTPQRVSGLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGGQALQALQAAPLSGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSINISGNGF", "length": 737, "header": "sp|P08047-3|SP1_HUMAN Isoform 3 of Transcription factor Sp1 OS=Homo sapiens OX=9606 GN=SP1 PE=1 SV=3 CANONICAL=P08047-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 120, "start_aa": "Ser", "end_pos": 120, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser120", "evidence": [ { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "24129563", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24129563" }, { "id": "21795679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21795679" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "9111324", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9111324" }, { "id": "20699577", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20699577" }, { "id": "31847126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31847126" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "19193796", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19193796" }, { "id": "24802710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24802710" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21105874" }, { "id": "24995865", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24995865" }, { "id": "25352121", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25352121" }, { "id": "31866443", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31866443" }, { "id": "9343410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9343410" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "17049555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17049555" }, { "id": "24553187", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24553187" }, { "id": "16027160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16027160" }, { "id": "19302979", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19302979" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "17614351", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17614351" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34638625", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34638625" }, { "id": "9452489", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9452489" }, { "id": "20657584", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20657584" }, { "id": "9079710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9079710" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "23013401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23013401" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "28054006", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28054006" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "26499076", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26499076" }, { "id": "11371615", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11371615" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ] }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 120, "start_aa": "Ser", "end_pos": 120, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser120", "evidence": [ { "id": "GLY_000142", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000142" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 126, "start_aa": "Ser", "end_pos": 126, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser126", "evidence": [ { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "24129563", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24129563" }, { "id": "21795679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21795679" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "9111324", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9111324" }, { "id": "20699577", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20699577" }, { "id": "31847126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31847126" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "19193796", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19193796" }, { "id": "24802710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24802710" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21105874" }, { "id": "24995865", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24995865" }, { "id": "25352121", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25352121" }, { "id": "31866443", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31866443" }, { "id": "9343410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9343410" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "17049555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17049555" }, { "id": "24553187", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24553187" }, { "id": "16027160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16027160" }, { "id": "19302979", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19302979" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "17614351", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17614351" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34638625", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34638625" }, { "id": "9452489", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9452489" }, { "id": "20657584", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20657584" }, { "id": "9079710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9079710" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "23013401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23013401" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "28054006", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28054006" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "26499076", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26499076" }, { "id": "11371615", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11371615" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 128, "start_aa": "Thr", "end_pos": 128, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr128", "evidence": [ { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "24129563", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24129563" }, { "id": "21795679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21795679" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "9111324", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9111324" }, { "id": "20699577", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20699577" }, { "id": "31847126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31847126" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "19193796", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19193796" }, { "id": "24802710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24802710" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21105874" }, { "id": "24995865", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24995865" }, { "id": "25352121", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25352121" }, { "id": "31866443", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31866443" }, { "id": "9343410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9343410" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "17049555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17049555" }, { "id": "24553187", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24553187" }, { "id": "16027160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16027160" }, { "id": "19302979", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19302979" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "17614351", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17614351" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34638625", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34638625" }, { "id": "9452489", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9452489" }, { "id": "20657584", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20657584" }, { "id": "9079710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9079710" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "23013401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23013401" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "28054006", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28054006" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "26499076", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26499076" }, { "id": "11371615", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11371615" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 134, "start_aa": "Ser", "end_pos": 134, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser134", "evidence": [ { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "24129563", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24129563" }, { "id": "21795679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21795679" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "9111324", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9111324" }, { "id": "20699577", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20699577" }, { "id": "31847126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31847126" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "19193796", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19193796" }, { "id": "24802710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24802710" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21105874" }, { "id": "24995865", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24995865" }, { "id": "25352121", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25352121" }, { "id": "31866443", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31866443" }, { "id": "9343410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9343410" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "17049555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17049555" }, { "id": "24553187", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24553187" }, { "id": "16027160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16027160" }, { "id": "19302979", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19302979" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "17614351", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17614351" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34638625", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34638625" }, { "id": "9452489", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9452489" }, { "id": "20657584", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20657584" }, { "id": "9079710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9079710" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "23013401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23013401" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "28054006", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28054006" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "26499076", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26499076" }, { "id": "11371615", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11371615" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 254, "start_aa": "Thr", "end_pos": 254, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr254", "evidence": [ { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "24129563", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24129563" }, { "id": "21795679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21795679" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "9111324", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9111324" }, { "id": "20699577", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20699577" }, { "id": "31847126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31847126" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "19193796", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19193796" }, { "id": "24802710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24802710" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21105874" }, { "id": "24995865", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24995865" }, { "id": "25352121", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25352121" }, { "id": "31866443", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31866443" }, { "id": "9343410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9343410" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "17049555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17049555" }, { "id": "24553187", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24553187" }, { "id": "16027160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16027160" }, { "id": "19302979", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19302979" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "17614351", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17614351" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34638625", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34638625" }, { "id": "9452489", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9452489" }, { "id": "20657584", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20657584" }, { "id": "9079710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9079710" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "23013401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23013401" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "28054006", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28054006" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "26499076", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26499076" }, { "id": "11371615", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11371615" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 265, "start_aa": "Thr", "end_pos": 265, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr265", "evidence": [ { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "24129563", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24129563" }, { "id": "21795679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21795679" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "9111324", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9111324" }, { "id": "20699577", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20699577" }, { "id": "31847126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31847126" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "19193796", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19193796" }, { "id": "24802710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24802710" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21105874" }, { "id": "24995865", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24995865" }, { "id": "25352121", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25352121" }, { "id": "31866443", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31866443" }, { "id": "9343410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9343410" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "17049555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17049555" }, { "id": "24553187", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24553187" }, { "id": "16027160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16027160" }, { "id": "19302979", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19302979" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "17614351", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17614351" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34638625", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34638625" }, { "id": "9452489", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9452489" }, { "id": "20657584", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20657584" }, { "id": "9079710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9079710" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "23013401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23013401" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "28054006", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28054006" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "26499076", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26499076" }, { "id": "11371615", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11371615" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 271, "start_aa": "Ser", "end_pos": 271, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser271", "evidence": [ { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "24129563", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24129563" }, { "id": "21795679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21795679" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "9111324", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9111324" }, { "id": "20699577", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20699577" }, { "id": "31847126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31847126" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "19193796", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19193796" }, { "id": "24802710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24802710" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21105874" }, { "id": "24995865", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24995865" }, { "id": "25352121", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25352121" }, { "id": "31866443", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31866443" }, { "id": "9343410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9343410" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "17049555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17049555" }, { "id": "24553187", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24553187" }, { "id": "16027160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16027160" }, { "id": "19302979", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19302979" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "17614351", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17614351" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34638625", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34638625" }, { "id": "9452489", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9452489" }, { "id": "20657584", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20657584" }, { "id": "9079710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9079710" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "23013401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23013401" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "28054006", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28054006" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "26499076", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26499076" }, { "id": "11371615", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11371615" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 273, "start_aa": "Ser", "end_pos": 273, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser273", "evidence": [ { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "24129563", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24129563" }, { "id": "21795679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21795679" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "9111324", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9111324" }, { "id": "20699577", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20699577" }, { "id": "31847126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31847126" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "19193796", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19193796" }, { "id": "24802710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24802710" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21105874" }, { "id": "24995865", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24995865" }, { "id": "25352121", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25352121" }, { "id": "31866443", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31866443" }, { "id": "9343410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9343410" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "17049555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17049555" }, { "id": "24553187", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24553187" }, { "id": "16027160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16027160" }, { "id": "19302979", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19302979" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "17614351", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17614351" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34638625", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34638625" }, { "id": "9452489", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9452489" }, { "id": "20657584", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20657584" }, { "id": "9079710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9079710" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "23013401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23013401" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "28054006", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28054006" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "26499076", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26499076" }, { "id": "11371615", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11371615" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ] }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 273, "start_aa": "Ser", "end_pos": 273, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser273", "evidence": [ { "id": "GLY_000142", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000142" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 276, "start_aa": "Thr", "end_pos": 276, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr276", "evidence": [ { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "24129563", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24129563" }, { "id": "21795679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21795679" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "9111324", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9111324" }, { "id": "20699577", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20699577" }, { "id": "31847126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31847126" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "19193796", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19193796" }, { "id": "24802710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24802710" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21105874" }, { "id": "24995865", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24995865" }, { "id": "25352121", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25352121" }, { "id": "31866443", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31866443" }, { "id": "9343410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9343410" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "17049555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17049555" }, { "id": "24553187", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24553187" }, { "id": "16027160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16027160" }, { "id": "19302979", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19302979" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "17614351", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17614351" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34638625", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34638625" }, { "id": "9452489", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9452489" }, { "id": "20657584", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20657584" }, { "id": "9079710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9079710" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "23013401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23013401" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "28054006", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28054006" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "26499076", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26499076" }, { "id": "11371615", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11371615" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 312, "start_aa": "Ser", "end_pos": 312, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser312", "evidence": [ { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "24129563", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24129563" }, { "id": "21795679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21795679" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "9111324", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9111324" }, { "id": "20699577", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20699577" }, { "id": "31847126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31847126" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "19193796", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19193796" }, { "id": "24802710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24802710" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21105874" }, { "id": "24995865", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24995865" }, { "id": "25352121", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25352121" }, { "id": "31866443", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31866443" }, { "id": "9343410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9343410" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "17049555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17049555" }, { "id": "24553187", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24553187" }, { "id": "16027160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16027160" }, { "id": "19302979", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19302979" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "17614351", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17614351" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34638625", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34638625" }, { "id": "9452489", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9452489" }, { "id": "20657584", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20657584" }, { "id": "9079710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9079710" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "23013401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23013401" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "28054006", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28054006" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "26499076", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26499076" }, { "id": "11371615", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11371615" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 394, "start_aa": "Thr", "end_pos": 394, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr394", "evidence": [ { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "24129563", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24129563" }, { "id": "21795679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21795679" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "9111324", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9111324" }, { "id": "20699577", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20699577" }, { "id": "31847126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31847126" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "19193796", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19193796" }, { "id": "24802710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24802710" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21105874" }, { "id": "24995865", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24995865" }, { "id": "25352121", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25352121" }, { "id": "31866443", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31866443" }, { "id": "9343410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9343410" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "17049555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17049555" }, { "id": "24553187", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24553187" }, { "id": "16027160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16027160" }, { "id": "19302979", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19302979" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "17614351", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17614351" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34638625", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34638625" }, { "id": "9452489", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9452489" }, { "id": "20657584", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20657584" }, { "id": "9079710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9079710" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "23013401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23013401" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "28054006", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28054006" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "26499076", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26499076" }, { "id": "11371615", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11371615" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ] }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 394, "start_aa": "Thr", "end_pos": 394, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr394", "evidence": [ { "id": "GLY_000142", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000142" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 421, "start_aa": "Ser", "end_pos": 421, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser421", "evidence": [ { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "24129563", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24129563" }, { "id": "21795679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21795679" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "9111324", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9111324" }, { "id": "20699577", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20699577" }, { "id": "31847126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31847126" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "19193796", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19193796" }, { "id": "24802710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24802710" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21105874" }, { "id": "24995865", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24995865" }, { "id": "25352121", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25352121" }, { "id": "31866443", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31866443" }, { "id": "9343410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9343410" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "17049555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17049555" }, { "id": "24553187", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24553187" }, { "id": "16027160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16027160" }, { "id": "19302979", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19302979" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "17614351", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17614351" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34638625", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34638625" }, { "id": "9452489", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9452489" }, { "id": "20657584", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20657584" }, { "id": "9079710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9079710" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "23013401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23013401" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "28054006", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28054006" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "26499076", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26499076" }, { "id": "11371615", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11371615" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 424, "start_aa": "Thr", "end_pos": 424, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr424", "evidence": [ { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "24129563", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24129563" }, { "id": "21795679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21795679" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "9111324", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9111324" }, { "id": "20699577", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20699577" }, { "id": "31847126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31847126" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "19193796", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19193796" }, { "id": "24802710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24802710" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21105874" }, { "id": "24995865", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24995865" }, { "id": "25352121", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25352121" }, { "id": "31866443", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31866443" }, { "id": "9343410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9343410" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "17049555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17049555" }, { "id": "24553187", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24553187" }, { "id": "16027160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16027160" }, { "id": "19302979", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19302979" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "17614351", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17614351" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34638625", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34638625" }, { "id": "9452489", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9452489" }, { "id": "20657584", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20657584" }, { "id": "9079710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9079710" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "23013401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23013401" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "28054006", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28054006" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "26499076", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26499076" }, { "id": "11371615", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11371615" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 446, "start_aa": "Ser", "end_pos": 446, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser446", "evidence": [ { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "24129563", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24129563" }, { "id": "21795679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21795679" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "9111324", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9111324" }, { "id": "20699577", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20699577" }, { "id": "31847126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31847126" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "19193796", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19193796" }, { "id": "24802710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24802710" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21105874" }, { "id": "24995865", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24995865" }, { "id": "25352121", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25352121" }, { "id": "31866443", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31866443" }, { "id": "9343410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9343410" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "17049555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17049555" }, { "id": "24553187", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24553187" }, { "id": "16027160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16027160" }, { "id": "19302979", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19302979" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "17614351", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17614351" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34638625", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34638625" }, { "id": "9452489", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9452489" }, { "id": "20657584", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20657584" }, { "id": "9079710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9079710" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "23013401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23013401" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "28054006", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28054006" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "26499076", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26499076" }, { "id": "11371615", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11371615" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ] }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 446, "start_aa": "Ser", "end_pos": 446, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser446", "evidence": [ { "id": "GLY_000142", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000142" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 453, "start_aa": "Thr", "end_pos": 453, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr453", "evidence": [ { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "24129563", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24129563" }, { "id": "21795679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21795679" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "9111324", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9111324" }, { "id": "20699577", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20699577" }, { "id": "31847126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31847126" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "19193796", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19193796" }, { "id": "24802710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24802710" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21105874" }, { "id": "24995865", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24995865" }, { "id": "25352121", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25352121" }, { "id": "31866443", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31866443" }, { "id": "9343410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9343410" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "17049555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17049555" }, { "id": "24553187", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24553187" }, { "id": "16027160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16027160" }, { "id": "19302979", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19302979" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "17614351", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17614351" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34638625", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34638625" }, { "id": "9452489", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9452489" }, { "id": "20657584", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20657584" }, { "id": "9079710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9079710" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "23013401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23013401" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "28054006", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28054006" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "26499076", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26499076" }, { "id": "11371615", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11371615" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 455, "start_aa": "Thr", "end_pos": 455, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr455", "evidence": [ { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "24129563", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24129563" }, { "id": "21795679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21795679" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "9111324", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9111324" }, { "id": "20699577", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20699577" }, { "id": "31847126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31847126" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "19193796", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19193796" }, { "id": "24802710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24802710" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21105874" }, { "id": "24995865", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24995865" }, { "id": "25352121", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25352121" }, { "id": "31866443", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31866443" }, { "id": "9343410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9343410" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "17049555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17049555" }, { "id": "24553187", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24553187" }, { "id": "16027160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16027160" }, { "id": "19302979", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19302979" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "17614351", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17614351" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34638625", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34638625" }, { "id": "9452489", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9452489" }, { "id": "20657584", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20657584" }, { "id": "9079710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9079710" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "23013401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23013401" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "28054006", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28054006" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "26499076", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26499076" }, { "id": "11371615", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11371615" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 491, "start_aa": "Ser", "end_pos": 491, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser491", "evidence": [ { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "24129563", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24129563" }, { "id": "21795679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21795679" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "9111324", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9111324" }, { "id": "20699577", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20699577" }, { "id": "31847126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31847126" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "19193796", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19193796" }, { "id": "24802710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24802710" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21105874" }, { "id": "24995865", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24995865" }, { "id": "25352121", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25352121" }, { "id": "31866443", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31866443" }, { "id": "9343410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9343410" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "17049555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17049555" }, { "id": "24553187", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24553187" }, { "id": "16027160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16027160" }, { "id": "19302979", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19302979" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "17614351", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17614351" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34638625", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34638625" }, { "id": "9452489", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9452489" }, { "id": "20657584", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20657584" }, { "id": "9079710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9079710" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "23013401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23013401" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "28054006", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28054006" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "26499076", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26499076" }, { "id": "11371615", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11371615" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" }, { "id": "25484640", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25484640" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (GlcNAc) serine O-GlcNAcylation", "start_pos": 491, "start_aa": "Ser", "end_pos": 491, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser491", "evidence": [ { "id": "P08047", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08047#ptm_processing" }, { "id": "9343410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9343410" }, { "id": "11371615", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11371615" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 507, "start_aa": "Ser", "end_pos": 507, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser507", "evidence": [ { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "24129563", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24129563" }, { "id": "21795679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21795679" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "9111324", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9111324" }, { "id": "20699577", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20699577" }, { "id": "31847126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31847126" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "19193796", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19193796" }, { "id": "24802710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24802710" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21105874" }, { "id": "24995865", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24995865" }, { "id": "25352121", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25352121" }, { "id": "31866443", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31866443" }, { "id": "9343410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9343410" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "17049555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17049555" }, { "id": "24553187", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24553187" }, { "id": "16027160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16027160" }, { "id": "19302979", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19302979" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "17614351", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17614351" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34638625", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34638625" }, { "id": "9452489", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9452489" }, { "id": "20657584", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20657584" }, { "id": "9079710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9079710" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "23013401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23013401" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "28054006", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28054006" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "26499076", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26499076" }, { "id": "11371615", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11371615" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ] }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 507, "start_aa": "Ser", "end_pos": 507, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser507", "evidence": [ { "id": "GLY_000142", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000142" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 510, "start_aa": "Ser", "end_pos": 510, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser510", "evidence": [ { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "24129563", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24129563" }, { "id": "21795679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21795679" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "9111324", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9111324" }, { "id": "20699577", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20699577" }, { "id": "31847126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31847126" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "19193796", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19193796" }, { "id": "24802710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24802710" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21105874" }, { "id": "24995865", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24995865" }, { "id": "25352121", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25352121" }, { "id": "31866443", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31866443" }, { "id": "9343410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9343410" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "17049555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17049555" }, { "id": "24553187", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24553187" }, { "id": "16027160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16027160" }, { "id": "19302979", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19302979" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "17614351", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17614351" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34638625", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34638625" }, { "id": "9452489", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9452489" }, { "id": "20657584", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20657584" }, { "id": "9079710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9079710" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "23013401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23013401" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "28054006", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28054006" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "26499076", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26499076" }, { "id": "11371615", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11371615" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 517, "start_aa": "Thr", "end_pos": 517, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr517", "evidence": [ { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "24129563", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24129563" }, { "id": "21795679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21795679" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "9111324", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9111324" }, { "id": "20699577", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20699577" }, { "id": "31847126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31847126" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "19193796", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19193796" }, { "id": "24802710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24802710" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21105874" }, { "id": "24995865", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24995865" }, { "id": "25352121", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25352121" }, { "id": "31866443", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31866443" }, { "id": "9343410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9343410" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "17049555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17049555" }, { "id": "24553187", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24553187" }, { "id": "16027160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16027160" }, { "id": "19302979", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19302979" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "17614351", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17614351" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34638625", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34638625" }, { "id": "9452489", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9452489" }, { "id": "20657584", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20657584" }, { "id": "9079710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9079710" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "23013401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23013401" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "28054006", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28054006" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "26499076", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26499076" }, { "id": "11371615", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11371615" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 612, "start_aa": "Ser", "end_pos": 612, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser612", "evidence": [ { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "24129563", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24129563" }, { "id": "21795679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21795679" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "9111324", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9111324" }, { "id": "20699577", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20699577" }, { "id": "31847126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31847126" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "19193796", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19193796" }, { "id": "24802710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24802710" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21105874" }, { "id": "24995865", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24995865" }, { "id": "25352121", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25352121" }, { "id": "31866443", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31866443" }, { "id": "9343410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9343410" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "17049555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17049555" }, { "id": "24553187", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24553187" }, { "id": "16027160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16027160" }, { "id": "19302979", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19302979" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "17614351", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17614351" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34638625", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34638625" }, { "id": "9452489", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9452489" }, { "id": "20657584", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20657584" }, { "id": "9079710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9079710" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "23013401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23013401" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "28054006", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28054006" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "26499076", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26499076" }, { "id": "11371615", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11371615" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" }, { "id": "25484640", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25484640" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (GlcNAc) serine; alternate O-GlcNAcylation", "start_pos": 612, "start_aa": "Ser", "end_pos": 612, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser612", "evidence": [ { "id": "P08047", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08047#ptm_processing" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 640, "start_aa": "Thr", "end_pos": 640, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr640", "evidence": [ { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "24129563", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24129563" }, { "id": "21795679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21795679" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "9111324", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9111324" }, { "id": "20699577", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20699577" }, { "id": "31847126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31847126" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "19193796", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19193796" }, { "id": "24802710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24802710" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21105874" }, { "id": "24995865", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24995865" }, { "id": "25352121", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25352121" }, { "id": "31866443", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31866443" }, { "id": "9343410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9343410" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "17049555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17049555" }, { "id": "24553187", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24553187" }, { "id": "16027160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16027160" }, { "id": "19302979", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19302979" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "17614351", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17614351" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34638625", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34638625" }, { "id": "9452489", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9452489" }, { "id": "20657584", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20657584" }, { "id": "9079710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9079710" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "23013401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23013401" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "28054006", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28054006" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "26499076", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26499076" }, { "id": "11371615", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11371615" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" }, { "id": "25484640", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25484640" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GlcNAc) threonine; alternate O-GlcNAcylation", "start_pos": 640, "start_aa": "Thr", "end_pos": 640, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr640", "evidence": [ { "id": "P08047", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08047#ptm_processing" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 641, "start_aa": "Ser", "end_pos": 641, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser641", "evidence": [ { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "24129563", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24129563" }, { "id": "21795679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21795679" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "9111324", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9111324" }, { "id": "20699577", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20699577" }, { "id": "31847126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31847126" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "19193796", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19193796" }, { "id": "24802710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24802710" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21105874" }, { "id": "24995865", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24995865" }, { "id": "25352121", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25352121" }, { "id": "31866443", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31866443" }, { "id": "9343410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9343410" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "17049555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17049555" }, { "id": "24553187", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24553187" }, { "id": "16027160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16027160" }, { "id": "19302979", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19302979" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "17614351", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17614351" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34638625", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34638625" }, { "id": "9452489", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9452489" }, { "id": "20657584", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20657584" }, { "id": "9079710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9079710" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "23013401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23013401" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "28054006", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28054006" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "26499076", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26499076" }, { "id": "11371615", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11371615" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" }, { "id": "25484640", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25484640" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (GlcNAc) serine; alternate O-GlcNAcylation", "start_pos": 641, "start_aa": "Ser", "end_pos": 641, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser641", "evidence": [ { "id": "P08047", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08047#ptm_processing" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 698, "start_aa": "Ser", "end_pos": 698, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser698", "evidence": [ { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "24129563", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24129563" }, { "id": "21795679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21795679" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "9111324", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9111324" }, { "id": "20699577", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20699577" }, { "id": "31847126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31847126" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "19193796", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19193796" }, { "id": "24802710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24802710" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21105874" }, { "id": "24995865", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24995865" }, { "id": "25352121", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25352121" }, { "id": "31866443", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31866443" }, { "id": "9343410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9343410" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "17049555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17049555" }, { "id": "24553187", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24553187" }, { "id": "16027160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16027160" }, { "id": "19302979", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19302979" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "17614351", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17614351" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34638625", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34638625" }, { "id": "9452489", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9452489" }, { "id": "20657584", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20657584" }, { "id": "9079710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9079710" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "23013401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23013401" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "28054006", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28054006" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "26499076", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26499076" }, { "id": "11371615", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11371615" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" }, { "id": "25484640", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25484640" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (GlcNAc) serine; alternate O-GlcNAcylation", "start_pos": 698, "start_aa": "Ser", "end_pos": 698, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser698", "evidence": [ { "id": "P08047", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08047#ptm_processing" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 702, "start_aa": "Ser", "end_pos": 702, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser702", "evidence": [ { "id": "P08047", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33686291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33686291" }, { "id": "24129563", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24129563" }, { "id": "21795679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21795679" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "9111324", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9111324" }, { "id": "20699577", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20699577" }, { "id": "31847126", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31847126" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "19193796", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19193796" }, { "id": "24802710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24802710" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" }, { "id": "21105874", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21105874" }, { "id": "24995865", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24995865" }, { "id": "25352121", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25352121" }, { "id": "31866443", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31866443" }, { "id": "9343410", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9343410" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "17049555", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17049555" }, { "id": "24553187", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24553187" }, { "id": "16027160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16027160" }, { "id": "19302979", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19302979" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "17614351", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17614351" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34638625", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34638625" }, { "id": "9452489", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9452489" }, { "id": "20657584", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20657584" }, { "id": "9079710", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9079710" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "23013401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23013401" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "28054006", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28054006" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "26499076", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26499076" }, { "id": "11371615", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11371615" }, { "id": "P08047", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P08047" }, { "id": "25484640", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25484640" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (GlcNAc) serine; alternate O-GlcNAcylation", "start_pos": 702, "start_aa": "Ser", "end_pos": 702, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser702", "evidence": [ { "id": "P08047", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08047#ptm_processing" }, { "id": "16332679", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16332679" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "605", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/605" }, { "id": "3139301", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3139301" } ] } ], "phosphorylation": [ { "start_pos": 101, "end_pos": 101, "kinase_uniprot_canonical_ac": "Q13315-1", "kinase_gene_name": "ATM", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "17609267", "url": "https://glygen.org/publication/PubMed/17609267" }, { "database": "PubMed", "id": "18619531", "url": "https://glygen.org/publication/PubMed/18619531" } ], "site_lbl": "Ser101" }, { "start_pos": 101, "end_pos": 101, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATM", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "18619531", "url": "https://glygen.org/publication/PubMed/18619531" }, { "database": "PubMed", "id": "18171990", "url": "https://glygen.org/publication/PubMed/18171990" } ], "site_lbl": "Ser101" }, { "start_pos": 278, "end_pos": 278, "kinase_uniprot_canonical_ac": "P45983-1", "kinase_gene_name": "MAPK8", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "18199680", "url": "https://glygen.org/publication/PubMed/18199680" }, { "database": "PubMed", "id": "19245816", "url": "https://glygen.org/publication/PubMed/19245816" } ], "site_lbl": "Thr278" }, { "start_pos": 278, "end_pos": 278, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by MAPK8", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "18199680", "url": "https://glygen.org/publication/PubMed/18199680" } ], "site_lbl": "Thr278" }, { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ], "site_lbl": "Ser2" }, { "start_pos": 375, "end_pos": 375, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr375" }, { "start_pos": 40, "end_pos": 40, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "P08047", "url": "http://phospho.elm.eu.org/byAccession/P08047.html" } ], "site_lbl": "Ser40" }, { "start_pos": 41, "end_pos": 41, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "P08047", "url": "http://phospho.elm.eu.org/byAccession/P08047.html" } ], "site_lbl": "Ser41" }, { "start_pos": 42, "end_pos": 42, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "P08047", "url": "http://phospho.elm.eu.org/byAccession/P08047.html" } ], "site_lbl": "Ser42" }, { "start_pos": 43, "end_pos": 43, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "P08047", "url": "http://phospho.elm.eu.org/byAccession/P08047.html" } ], "site_lbl": "Thr43" }, { "start_pos": 453, "end_pos": 453, "kinase_uniprot_canonical_ac": "P27361-1", "kinase_gene_name": "MAPK3", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "11904305", "url": "https://glygen.org/publication/PubMed/11904305" }, { "database": "phospho.ELM", "id": "P08047", "url": "http://phospho.elm.eu.org/byAccession/P08047.html" }, { "database": "PubMed", "id": "14593115", "url": "https://glygen.org/publication/PubMed/14593115" }, { "database": "PubMed", "id": "20882567", "url": "https://glygen.org/publication/PubMed/20882567" }, { "database": "PubMed", "id": "14744793", "url": "https://glygen.org/publication/PubMed/14744793" } ], "site_lbl": "Thr453" }, { "start_pos": 453, "end_pos": 453, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "11904305", "url": "https://glygen.org/publication/PubMed/11904305" }, { "database": "PubMed", "id": "19318349", "url": "https://glygen.org/publication/PubMed/19318349" }, { "database": "phospho.ELM", "id": "P08047", "url": "http://phospho.elm.eu.org/byAccession/P08047.html" }, { "database": "PubMed", "id": "14593115", "url": "https://glygen.org/publication/PubMed/14593115" }, { "database": "PubMed", "id": "20882567", "url": "https://glygen.org/publication/PubMed/20882567" } ], "site_lbl": "Thr453" }, { "start_pos": 453, "end_pos": 453, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by MAPK1 and MAPK3", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "phospho.ELM", "id": "P08047", "url": "http://phospho.elm.eu.org/byAccession/P08047.html" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "14744793", "url": "https://glygen.org/publication/PubMed/14744793" }, { "database": "PubMed", "id": "32615164", "url": "https://glygen.org/publication/PubMed/32615164" }, { "database": "PubMed", "id": "14593115", "url": "https://glygen.org/publication/PubMed/14593115" }, { "database": "PubMed", "id": "16377629", "url": "https://glygen.org/publication/PubMed/16377629" }, { "database": "PubMed", "id": "11904305", "url": "https://glygen.org/publication/PubMed/11904305" } ], "site_lbl": "Thr453" }, { "start_pos": 46, "end_pos": 46, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "P08047", "url": "http://phospho.elm.eu.org/byAccession/P08047.html" } ], "site_lbl": "Ser46" }, { "start_pos": 48, "end_pos": 48, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "P08047", "url": "http://phospho.elm.eu.org/byAccession/P08047.html" } ], "site_lbl": "Ser48" }, { "start_pos": 56, "end_pos": 56, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "P08047", "url": "http://phospho.elm.eu.org/byAccession/P08047.html" } ], "site_lbl": "Ser56" }, { "start_pos": 579, "end_pos": 579, "kinase_uniprot_canonical_ac": "P68400-1", "kinase_gene_name": "CSNK2A1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "9153193", "url": "https://glygen.org/publication/PubMed/9153193" } ], "site_lbl": "Thr579" }, { "start_pos": 579, "end_pos": 579, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P08047", "url": "http://phospho.elm.eu.org/byAccession/P08047.html" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "9153193", "url": "https://glygen.org/publication/PubMed/9153193" }, { "database": "PRO", "id": "P08047", "url": "http://purl.obolibrary.org/obo/P08047" } ], "site_lbl": "Thr579" }, { "start_pos": 59, "end_pos": 59, "kinase_uniprot_canonical_ac": "P27361-1", "kinase_gene_name": "MAPK3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "19318349", "url": "https://glygen.org/publication/PubMed/19318349" } ], "site_lbl": "Ser59" }, { "start_pos": 59, "end_pos": 59, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "19318349", "url": "https://glygen.org/publication/PubMed/19318349" }, { "database": "PubMed", "id": "11904305", "url": "https://glygen.org/publication/PubMed/11904305" } ], "site_lbl": "Ser59" }, { "start_pos": 59, "end_pos": 59, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "17049555", "url": "https://glygen.org/publication/PubMed/17049555" }, { "database": "PubMed", "id": "18239466", "url": "https://glygen.org/publication/PubMed/18239466" }, { "database": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "18199680", "url": "https://glygen.org/publication/PubMed/18199680" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" }, { "database": "phospho.ELM", "id": "P08047", "url": "http://phospho.elm.eu.org/byAccession/P08047.html" }, { "database": "PRO", "id": "P08047", "url": "http://purl.obolibrary.org/obo/P08047" } ], "site_lbl": "Ser59" }, { "start_pos": 612, "end_pos": 612, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; alternate", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "16332679", "url": "https://glygen.org/publication/PubMed/16332679" } ], "site_lbl": "Ser612" }, { "start_pos": 617, "end_pos": 617, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser617" }, { "start_pos": 640, "end_pos": 640, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; alternate", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "16332679", "url": "https://glygen.org/publication/PubMed/16332679" } ], "site_lbl": "Thr640" }, { "start_pos": 641, "end_pos": 641, "kinase_uniprot_canonical_ac": "Q05513-1", "kinase_gene_name": "PRKCZ", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "16943418", "url": "https://glygen.org/publication/PubMed/16943418" }, { "database": "PubMed", "id": "18258854", "url": "https://glygen.org/publication/PubMed/18258854" }, { "database": "PubMed", "id": "19464346", "url": "https://glygen.org/publication/PubMed/19464346" } ], "site_lbl": "Ser641" }, { "start_pos": 641, "end_pos": 641, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKC/PRKCZ; alternate", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "16332679", "url": "https://glygen.org/publication/PubMed/16332679" }, { "database": "PubMed", "id": "16943418", "url": "https://glygen.org/publication/PubMed/16943418" } ], "site_lbl": "Ser641" }, { "start_pos": 651, "end_pos": 651, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by PKC/PRKCZ", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "P08047", "url": "http://phospho.elm.eu.org/byAccession/P08047.html" } ], "site_lbl": "Thr651" }, { "start_pos": 668, "end_pos": 668, "kinase_uniprot_canonical_ac": "Q05513-1", "kinase_gene_name": "PRKCZ", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "16943418", "url": "https://glygen.org/publication/PubMed/16943418" }, { "database": "PubMed", "id": "18258854", "url": "https://glygen.org/publication/PubMed/18258854" } ], "site_lbl": "Thr668" }, { "start_pos": 668, "end_pos": 668, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18258854", "url": "https://glygen.org/publication/PubMed/18258854" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" } ], "site_lbl": "Thr668" }, { "start_pos": 670, "end_pos": 670, "kinase_uniprot_canonical_ac": "Q05513-1", "kinase_gene_name": "PRKCZ", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "16943418", "url": "https://glygen.org/publication/PubMed/16943418" }, { "database": "PubMed", "id": "18258854", "url": "https://glygen.org/publication/PubMed/18258854" } ], "site_lbl": "Ser670" }, { "start_pos": 670, "end_pos": 670, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKC/PRKCZ", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "18258854", "url": "https://glygen.org/publication/PubMed/18258854" } ], "site_lbl": "Ser670" }, { "start_pos": 681, "end_pos": 681, "kinase_uniprot_canonical_ac": "Q05513-1", "kinase_gene_name": "PRKCZ", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "16943418", "url": "https://glygen.org/publication/PubMed/16943418" }, { "database": "PubMed", "id": "18258854", "url": "https://glygen.org/publication/PubMed/18258854" } ], "site_lbl": "Thr681" }, { "start_pos": 681, "end_pos": 681, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by PKC/PRKCZ", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "17049555", "url": "https://glygen.org/publication/PubMed/17049555" }, { "database": "PubMed", "id": "18258854", "url": "https://glygen.org/publication/PubMed/18258854" } ], "site_lbl": "Thr681" }, { "start_pos": 698, "end_pos": 698, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; alternate", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "16332679", "url": "https://glygen.org/publication/PubMed/16332679" } ], "site_lbl": "Ser698" }, { "start_pos": 702, "end_pos": 702, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; alternate", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "16332679", "url": "https://glygen.org/publication/PubMed/16332679" }, { "database": "PubMed", "id": "20953893", "url": "https://glygen.org/publication/PubMed/20953893" } ], "site_lbl": "Ser702" }, { "start_pos": 728, "end_pos": 728, "kinase_uniprot_canonical_ac": "P49841-1", "kinase_gene_name": "GSK3B", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "19372209", "url": "https://glygen.org/publication/PubMed/19372209" } ], "site_lbl": "Ser728" }, { "start_pos": 732, "end_pos": 732, "kinase_uniprot_canonical_ac": "P49841-1", "kinase_gene_name": "GSK3B", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "19372209", "url": "https://glygen.org/publication/PubMed/19372209" } ], "site_lbl": "Ser732" }, { "start_pos": 739, "end_pos": 739, "kinase_uniprot_canonical_ac": "P06493-1", "kinase_gene_name": "CDK1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "20150555", "url": "https://glygen.org/publication/PubMed/20150555" } ], "site_lbl": "Thr739" }, { "start_pos": 739, "end_pos": 739, "kinase_uniprot_canonical_ac": "P27361-1", "kinase_gene_name": "MAPK3", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "11904305", "url": "https://glygen.org/publication/PubMed/11904305" }, { "database": "PubMed", "id": "19318349", "url": "https://glygen.org/publication/PubMed/19318349" }, { "database": "phospho.ELM", "id": "P08047", "url": "http://phospho.elm.eu.org/byAccession/P08047.html" }, { "database": "PubMed", "id": "14593115", "url": "https://glygen.org/publication/PubMed/14593115" }, { "database": "PubMed", "id": "14744793", "url": "https://glygen.org/publication/PubMed/14744793" } ], "site_lbl": "Thr739" }, { "start_pos": 739, "end_pos": 739, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "11904305", "url": "https://glygen.org/publication/PubMed/11904305" }, { "database": "PubMed", "id": "19318349", "url": "https://glygen.org/publication/PubMed/19318349" }, { "database": "phospho.ELM", "id": "P08047", "url": "http://phospho.elm.eu.org/byAccession/P08047.html" }, { "database": "PubMed", "id": "14593115", "url": "https://glygen.org/publication/PubMed/14593115" }, { "database": "PubMed", "id": "20882567", "url": "https://glygen.org/publication/PubMed/20882567" } ], "site_lbl": "Thr739" }, { "start_pos": 739, "end_pos": 739, "kinase_uniprot_canonical_ac": "P45983-1", "kinase_gene_name": "MAPK8", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "18199680", "url": "https://glygen.org/publication/PubMed/18199680" }, { "database": "PubMed", "id": "19245816", "url": "https://glygen.org/publication/PubMed/19245816" } ], "site_lbl": "Thr739" }, { "start_pos": 739, "end_pos": 739, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by MAPK1, MAPK3 and MAPK8", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "phospho.ELM", "id": "P08047", "url": "http://phospho.elm.eu.org/byAccession/P08047.html" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "14744793", "url": "https://glygen.org/publication/PubMed/14744793" }, { "database": "PubMed", "id": "20882567", "url": "https://glygen.org/publication/PubMed/20882567" }, { "database": "PubMed", "id": "14593115", "url": "https://glygen.org/publication/PubMed/14593115" }, { "database": "PubMed", "id": "16377629", "url": "https://glygen.org/publication/PubMed/16377629" }, { "database": "PubMed", "id": "11904305", "url": "https://glygen.org/publication/PubMed/11904305" } ], "site_lbl": "Thr739" }, { "start_pos": 7, "end_pos": 7, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18239466", "url": "https://glygen.org/publication/PubMed/18239466" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ], "site_lbl": "Ser7" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Smad3-Smad4 and AP-1 complexes synergize in transcriptional activation of the c-Jun promoter by transforming growth factor beta.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Wong C, Rougier-Chapman EM, Frederick JP, Datto MB, Liberati NT, Li JM, Wang XF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "10022869", "url": "https://glygen.org/publication/PubMed/10022869" } ] }, { "title": "The general transcription factors IIA, IIB, IIF, and IIE are required for RNA polymerase II transcription from the human U1 small nuclear RNA promoter.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Kuhlman TC, Cho H, Reinberg D, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "10022900", "url": "https://glygen.org/publication/PubMed/10022900" } ] }, { "title": "A Smad transcriptional corepressor.", "journal": "Cell", "date": "1999", "authors": "Wotton D, Lo RS, Lee S, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "10199400", "url": "https://glygen.org/publication/PubMed/10199400" } ] }, { "title": "p300/cAMP-responsive element-binding protein interactions with ets-1 and ets-2 in the transcriptional activation of the human stromelysin promoter.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Jayaraman G, Srinivas R, Duggan C, Ferreira E, Swaminathan S, Somasundaram K, Williams J, Hauser C, Kurkinen M, Dhar R, Weitzman S, Buttice G, Thimmapaya B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559585" } ], "reference": [ { "type": "PubMed", "id": "10358095", "url": "https://glygen.org/publication/PubMed/10358095" } ] }, { "title": "Functional interactions between Sp1 or Sp3 and the helicase-like transcription factor mediate basal expression from the human plasminogen activator inhibitor-1 gene.", "journal": "The Journal of biological chemistry", "date": "1999-07-09", "authors": "Ding H, Benotmane A M, Suske G, Collen D, Belayew A", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "reference": [ { "type": "PubMed", "id": "10391891", "url": "https://glygen.org/publication/PubMed/10391891" } ] }, { "title": "Identification of conserved cis-elements and transcription factors required for sterol-regulated transcription of stearoyl-CoA desaturase 1 and 2.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Tabor DE, Kim JB, Spiegelman BM, Edwards PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "10400691", "url": "https://glygen.org/publication/PubMed/10400691" } ] }, { "title": "Estrogen induction of the cyclin D1 promoter: involvement of a cAMP response-like element.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Sabbah M, Courilleau D, Mester J, Redeuilh G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10500157", "url": "https://glygen.org/publication/PubMed/10500157" } ] }, { "title": "Sterol regulation of human fatty acid synthase promoter I requires nuclear factor-Y- and Sp-1-binding sites.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Xiong S, Chirala SS, Wakil SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "10759542", "url": "https://glygen.org/publication/PubMed/10759542" } ] }, { "title": "The murine and human cholesterol 7alpha-hydroxylase gene promoters are differentially responsive to regulation by fatty acids mediated via peroxisome proliferator-activated receptor alpha.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Cheema SK, Agellon LB", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "10777541", "url": "https://glygen.org/publication/PubMed/10777541" } ] }, { "title": "Transcriptional activation of transforming growth factor alpha by estradiol: requirement for both a GC-rich site and an estrogen response element half-site.", "journal": "Journal of molecular endocrinology", "date": "2000", "authors": "Vyhlidal C, Samudio I, Kladde MP, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10828826", "url": "https://glygen.org/publication/PubMed/10828826" } ] }, { "title": "Promoter analysis and chromosomal mapping of human EBAG9 gene.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Ikeda K, Sato M, Tsutsumi O, Tsuchiya F, Tsuneizumi M, Emi M, Imoto I, Inazawa J, Muramatsu M, Inoue S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10873660", "url": "https://glygen.org/publication/PubMed/10873660" } ] }, { "title": "Heterogeneous Sp1 mRNAs in human HepG2 cells include a product of homotypic trans-splicing.", "journal": "J. Biol. Chem.", "date": "2000", "authors": "Takahara T, Kanazu S I, Yanagisawa S, Akanuma H", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "reference": [ { "type": "PubMed", "id": "10973950", "url": "https://glygen.org/publication/PubMed/10973950" } ] }, { "title": "A set of proteins interacting with transcription factor Sp1 identified in a two-hybrid screening.", "journal": "Mol. Cell. Biochem.", "date": "2000", "authors": "Gunther M, Laithier M, Brison O", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "reference": [ { "type": "PubMed", "id": "10976766", "url": "https://glygen.org/publication/PubMed/10976766" } ] }, { "title": "Synergistic cooperation between Sp1 and Smad3/Smad4 mediates transforming growth factor beta1 stimulation of alpha 2(I)-collagen (COL1A2) transcription.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Zhang W, Ou J, Inagaki Y, Greenwel P, Ramirez F", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "11007770", "url": "https://glygen.org/publication/PubMed/11007770" } ] }, { "title": "Synergistic, p160 coactivator-dependent enhancement of estrogen receptor function by CARM1 and p300.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Chen D, Huang SM, Stallcup MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11010967", "url": "https://glygen.org/publication/PubMed/11010967" } ] }, { "title": "Smad2, Smad3 and Smad4 cooperate with Sp1 to induce p15(Ink4B) transcription in response to TGF-beta.", "journal": "The EMBO journal", "date": "2000", "authors": "Feng XH, Lin X, Derynck R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "11013220", "url": "https://glygen.org/publication/PubMed/11013220" } ] }, { "title": "MYB oncogene amplification in hereditary BRCA1 breast cancer.", "journal": "Cancer research", "date": "2000", "authors": "Kauraniemi P, Hedenfalk I, Persson K, Duggan DJ, Tanner M, Johannsson O, Olsson H, Trent JM, Isola J, Borg A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11034064", "url": "https://glygen.org/publication/PubMed/11034064" } ] }, { "title": "PDZK1 and GREB1 are estrogen-regulated genes expressed in hormone-responsive breast cancer.", "journal": "Cancer research", "date": "2000", "authors": "Ghosh MG, Thompson DA, Weigel RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11103799", "url": "https://glygen.org/publication/PubMed/11103799" } ] }, { "title": "Cofactor dynamics and sufficiency in estrogen receptor-regulated transcription.", "journal": "Cell", "date": "2000", "authors": "Shang Y, Hu X, DiRenzo J, Lazar MA, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11136970", "url": "https://glygen.org/publication/PubMed/11136970" } ] }, { "title": "Transcriptional activation of cathepsin D gene expression by 17beta-estradiol: mechanism of aryl hydrocarbon receptor-mediated inhibition.", "journal": "Molecular and cellular endocrinology", "date": "2001", "authors": "Wang F, Samudio I, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11165043", "url": "https://glygen.org/publication/PubMed/11165043" } ] }, { "title": "Opposing effects of Ets and Id proteins on p16INK4a expression during cellular senescence.", "journal": "Nature", "date": "2001", "authors": "Ohtani N, Zebedee Z, Huot TJ, Stinson JA, Sugimoto M, Ohashi Y, Sharrocks AD, Peters G, Hara E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559585" } ], "reference": [ { "type": "PubMed", "id": "11234019", "url": "https://glygen.org/publication/PubMed/11234019" } ] }, { "title": "Alternative splicing and tissue-specific transcription of human and rodent ubiquitous 5-aminolevulinate synthase (ALAS1) genes.", "journal": "Biochimica et biophysica acta", "date": "2001", "authors": "Roberts AG, Elder GH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "11267664", "url": "https://glygen.org/publication/PubMed/11267664" } ] }, { "title": "Inactivation of menin, a Smad3-interacting protein, blocks transforming growth factor type beta signaling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Kaji H, Canaff L, Lebrun JJ, Goltzman D, Hendy GN", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "11274402", "url": "https://glygen.org/publication/PubMed/11274402" } ] }, { "title": "Transcriptional activation of genes by 17 beta-estradiol through estrogen receptor-Sp1 interactions.", "journal": "Vitamins and hormones", "date": "2001", "authors": "Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11345900", "url": "https://glygen.org/publication/PubMed/11345900" } ] }, { "title": "O-linkage of N-acetylglucosamine to Sp1 activation domain inhibits its transcriptional capability.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Yang X, Su K, Roos MD, Chang Q, Paterson AJ, Kudlow JE", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047#ptm_processing" }, { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "11371615", "url": "https://glygen.org/publication/PubMed/11371615" } ] }, { "title": "Estrogen regulation of cyclin D1 gene expression in ZR-75 breast cancer cells involves multiple enhancer elements.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Castro-Rivera E, Samudio I, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11410592", "url": "https://glygen.org/publication/PubMed/11410592" } ] }, { "title": "Cloning and characterization of the human stearoyl-CoA desaturase gene promoter: transcriptional activation by sterol regulatory element binding protein and repression by polyunsaturated fatty acids and cholesterol.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Bene H, Lasky D, Ntambi JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "11414710", "url": "https://glygen.org/publication/PubMed/11414710" } ] }, { "title": "Involvement of Smads in TGFbeta1-induced furin (fur) transcription.", "journal": "Journal of cellular physiology", "date": "2001", "authors": "Blanchette F, Rudd P, Grondin F, Attisano L, Dubois CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "11424093", "url": "https://glygen.org/publication/PubMed/11424093" } ] }, { "title": "TGIF2 interacts with histone deacetylase 1 and represses transcription.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Melhuish TA, Gallo CM, Wotton D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "11427533", "url": "https://glygen.org/publication/PubMed/11427533" } ] }, { "title": "Estrogen receptor interaction with estrogen response elements.", "journal": "Nucleic acids research", "date": "2001", "authors": "Klinge CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11452016", "url": "https://glygen.org/publication/PubMed/11452016" } ] }, { "title": "Selective coactivation of estrogen-dependent transcription by CITED1 CBP/p300-binding protein.", "journal": "Genes & development", "date": "2001", "authors": "Yahata T, Shao W, Endoh H, Hur J, Coser KR, Sun H, Ueda Y, Kato S, Isselbacher KJ, Brown M, Shioda T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11581164", "url": "https://glygen.org/publication/PubMed/11581164" } ] }, { "title": "Synergism between ERalpha transactivation function 1 (AF-1) and AF-2 mediated by steroid receptor coactivator protein-1: requirement for the AF-1 alpha-helical core and for a direct interaction between the N- and C-terminal domains.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2001", "authors": "Metivier R, Penot G, Flouriot G, Pakdel F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11682626", "url": "https://glygen.org/publication/PubMed/11682626" } ] }, { "title": "An ERK2 docking site in the Pointed domain distinguishes a subset of ETS transcription factors.", "journal": "Genes & development", "date": "2002", "authors": "Seidel JJ, Graves BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559585" } ], "reference": [ { "type": "PubMed", "id": "11782450", "url": "https://glygen.org/publication/PubMed/11782450" } ] }, { "title": "Crystallization of the Oct-1/SNAP190 peptide/DNA complex.", "journal": "Acta crystallographica. Section D, Biological crystallography", "date": "2002", "authors": "Hovde S, Brooks A, Strong K, Geiger JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "11856838", "url": "https://glygen.org/publication/PubMed/11856838" } ] }, { "title": "Transcriptional regulation of the human tumor suppressor p14(ARF) by E2F1, E2F2, E2F3, and Sp1-like factors.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "Parisi T, Pollice A, Di Cristofano A, Calabro V, La Mantia G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559585" } ], "reference": [ { "type": "PubMed", "id": "11883935", "url": "https://glygen.org/publication/PubMed/11883935" } ] }, { "title": "Identification of two Sp1 phosphorylation sites for p42/p44 mitogen-activated protein kinases: their implication in vascular endothelial growth factor gene transcription.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Milanini-Mongiat J, Pouyssegur J, Pages G", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "iPTMnet", "id": "P08047-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047-1" } ], "reference": [ { "type": "PubMed", "id": "11904305", "url": "https://glygen.org/publication/PubMed/11904305" } ] }, { "title": "POZ domain transcription factor, FBI-1, represses transcription of ADH5/FDH by interacting with the zinc finger and interfering with DNA binding activity of Sp1.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Lee DK, Suh D, Edenberg HJ, Hur MW", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "reference": [ { "type": "PubMed", "id": "12004059", "url": "https://glygen.org/publication/PubMed/12004059" } ] }, { "title": "Cellular transcription factor Sp1 recruits simian virus 40 capsid proteins to the viral packaging signal, ses.", "journal": "J. Virol.", "date": "2002", "authors": "Gordon-Shaag Ariela, Ben-Nun-Shaul Orly, Roitman Vered, Yosef Yael, Oppenheim Ariella", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "reference": [ { "type": "PubMed", "id": "12021324", "url": "https://glygen.org/publication/PubMed/12021324" } ] }, { "title": "SREBP-2 and NF-Y are involved in the transcriptional regulation of squalene epoxidase.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "Nagai M, Sakakibara J, Nakamura Y, Gejyo F, Ono T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "12083769", "url": "https://glygen.org/publication/PubMed/12083769" } ] }, { "title": "Peroxisome proliferator-activated receptor alpha (PPARalpha ) turnover by the ubiquitin-proteasome system controls the ligand-induced expression level of its target genes.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Blanquart C, Barbier O, Fruchart JC, Staels B, Glineur C", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "12118000", "url": "https://glygen.org/publication/PubMed/12118000" } ] }, { "title": "E2F4/5 and p107 as Smad cofactors linking the TGFbeta receptor to c-myc repression.", "journal": "Cell", "date": "2002", "authors": "Chen CR, Kang Y, Siegel PM, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "12150994", "url": "https://glygen.org/publication/PubMed/12150994" } ] }, { "title": "Transcriptional activities of nuclear SREBP-1a, -1c, and -2 to different target promoters of lipogenic and cholesterogenic genes.", "journal": "Journal of lipid research", "date": "2002", "authors": "Amemiya-Kudo M, Shimano H, Hasty AH, Yahagi N, Yoshikawa T, Matsuzaka T, Okazaki H, Tamura Y, Iizuka Y, Ohashi K, Osuga J, Harada K, Gotoda T, Sato R, Kimura S, Ishibashi S, Yamada N", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "12177166", "url": "https://glygen.org/publication/PubMed/12177166" } ] }, { "title": "Activator recruitment by the general transcription machinery: X-ray structural analysis of the Oct-1 POU domain/human U1 octamer/SNAP190 peptide ternary complex.", "journal": "Genes & development", "date": "2002", "authors": "Hovde S, Hinkley CS, Strong K, Brooks A, Gu L, Henry RW, Geiger J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "12414730", "url": "https://glygen.org/publication/PubMed/12414730" } ] }, { "title": "Y-box-binding protein YB-1 mediates transcriptional repression of human alpha 2(I) collagen gene expression by interferon-gamma.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Higashi K, Inagaki Y, Suzuki N, Mitsui S, Mauviel A, Kaneko H, Nakatsuka I", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "12446674", "url": "https://glygen.org/publication/PubMed/12446674" } ] }, { "title": "Crosstalk between CARM1 methylation and CBP acetylation on histone H3.", "journal": "Current biology : CB", "date": "2002", "authors": "Daujat S, Bauer UM, Shah V, Turner B, Berger S, Kouzarides T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12498683", "url": "https://glygen.org/publication/PubMed/12498683" } ] }, { "title": "Regulation of P450 4A expression by peroxisome proliferator activated receptors.", "journal": "Toxicology", "date": "2002", "authors": "Johnson EF, Hsu MH, Savas U, Griffin KJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "12505311", "url": "https://glygen.org/publication/PubMed/12505311" } ] }, { "title": "The C-terminal domain of pol II and a DRB-sensitive kinase are required for 3' processing of U2 snRNA.", "journal": "The EMBO journal", "date": "2003", "authors": "Medlin JE, Uguen P, Taylor A, Bentley DL, Murphy S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "12574128", "url": "https://glygen.org/publication/PubMed/12574128" } ] }, { "title": "The UDP-glucuronosyltransferase 1A9 enzyme is a peroxisome proliferator-activated receptor alpha and gamma target gene.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Barbier O, Villeneuve L, Bocher V, Fontaine C, Torra IP, Duhem C, Kosykh V, Fruchart JC, Guillemette C, Staels B", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "12582161", "url": "https://glygen.org/publication/PubMed/12582161" } ] }, { "title": "Two domains of the progesterone receptor interact with the estrogen receptor and are required for progesterone activation of the c-Src/Erk pathway in mammalian cells.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Ballare C, Uhrig M, Bechtold T, Sancho E, Di Domenico M, Migliaccio A, Auricchio F, Beato M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12612073", "url": "https://glygen.org/publication/PubMed/12612073" } ] }, { "title": "Acetyl-CoA carboxylase beta gene is regulated by sterol regulatory element-binding protein-1 in liver.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Oh SY, Park SK, Kim JW, Ahn YH, Park SW, Kim KS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "12764144", "url": "https://glygen.org/publication/PubMed/12764144" } ] }, { "title": "Che-1 arrests human colon carcinoma cell proliferation by displacing HDAC1 from the p21WAF1/CIP1 promoter.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Di Padova Monica, Bruno Tiziana, De Nicola Francesca, Iezzi Simona, D'Angelo Carmen, Gallo Rita, Nicosia Daniela, Corbi Nicoletta, Biroccio Annamaria, Floridi Aristide, Passananti Claudio, Fanciulli Maurizio", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "reference": [ { "type": "PubMed", "id": "12847090", "url": "https://glygen.org/publication/PubMed/12847090" } ] }, { "title": "Interaction between the varicella zoster virus IE62 major transactivator and cellular transcription factor Sp1.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Peng Hua, He Hongying, Hay John, Ruyechan William T", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "reference": [ { "type": "PubMed", "id": "12855699", "url": "https://glygen.org/publication/PubMed/12855699" } ] }, { "title": "Interferon-gamma interferes with transforming growth factor-beta signaling through direct interaction of YB-1 with Smad3.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Higashi K, Inagaki Y, Fujimori K, Nakao A, Kaneko H, Nakatsuka I", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "12917425", "url": "https://glygen.org/publication/PubMed/12917425" } ] }, { "title": "Profiling of estrogen up- and down-regulated gene expression in human breast cancer cells: insights into gene networks and pathways underlying estrogenic control of proliferation and cell phenotype.", "journal": "Endocrinology", "date": "2003", "authors": "Frasor J, Danes JM, Komm B, Chang KC, Lyttle CR, Katzenellenbogen BS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12959972", "url": "https://glygen.org/publication/PubMed/12959972" } ] }, { "title": "Molecular cloning of human mevalonate kinase and identification of a missense mutation in the genetic disease mevalonic aciduria.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Schafer BL, Bishop RW, Kratunis VJ, Kalinowski SS, Mosley ST, Gibson KM, Tanaka RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "1377680", "url": "https://glygen.org/publication/PubMed/1377680" } ] }, { "title": "Fibroblast growth factor-2 represses platelet-derived growth factor receptor-alpha (PDGFR-alpha) transcription via ERK1/2-dependent Sp1 phosphorylation and an atypical cis-acting element in the proximal PDGFR-alpha promoter.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Bonello MR, Khachigian LM", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" } ], "reference": [ { "type": "PubMed", "id": "14593115", "url": "https://glygen.org/publication/PubMed/14593115" } ] }, { "title": "Acetylation and methylation in nuclear receptor gene activation.", "journal": "Methods in enzymology", "date": "2003", "authors": "Xu W, Cho H, Evans RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "14631847", "url": "https://glygen.org/publication/PubMed/14631847" } ] }, { "title": "Arkadia amplifies TGF-beta superfamily signalling through degradation of Smad7.", "journal": "The EMBO journal", "date": "2003", "authors": "Koinuma D, Shinozaki M, Komuro A, Goto K, Saitoh M, Hanyu A, Ebina M, Nukiwa T, Miyazawa K, Imamura T, Miyazono K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "14657019", "url": "https://glygen.org/publication/PubMed/14657019" } ] }, { "title": "Estrogen receptor-alpha directs ordered, cyclical, and combinatorial recruitment of cofactors on a natural target promoter.", "journal": "Cell", "date": "2003", "authors": "Metivier R, Penot G, Hubner MR, Reid G, Brand H, Kos M, Gannon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "14675539", "url": "https://glygen.org/publication/PubMed/14675539" } ] }, { "title": "Role of the C-terminal domain of RNA polymerase II in U2 snRNA transcription and 3' processing.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Jacobs EY, Ogiwara I, Weiner AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "14701755", "url": "https://glygen.org/publication/PubMed/14701755" } ] }, { "title": "ERF nuclear shuttling, a continuous monitor of Erk activity that links it to cell cycle progression.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Le Gallic L, Virgilio L, Cohen P, Biteau B, Mavrothalassitis G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559585" } ], "reference": [ { "type": "PubMed", "id": "14729966", "url": "https://glygen.org/publication/PubMed/14729966" } ] }, { "title": "Transcriptional activation of p21(waf1/cip1) by alkylphospholipids: role of the mitogen-activated protein kinase pathway in the transactivation of the human p21(waf1/cip1) promoter by Sp1.", "journal": "Cancer research", "date": "2004", "authors": "De Siervi A, Marinissen M, Diggs J, Wang XF, Pages G, Senderowicz A", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" } ], "reference": [ { "type": "PubMed", "id": "14744793", "url": "https://glygen.org/publication/PubMed/14744793" } ] }, { "title": "Genome-wide identification of high-affinity estrogen response elements in human and mouse.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2004", "authors": "Bourdeau V, Deschenes J, Metivier R, Nagai Y, Nguyen D, Bretschneider N, Gannon F, White JH, Mader S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15001666", "url": "https://glygen.org/publication/PubMed/15001666" } ] }, { "title": "Effect of peroxisome proliferator-activated receptor alpha on human angiotensinogen promoter.", "journal": "International journal of molecular medicine", "date": "2004", "authors": "Shimamoto Y, Hirota K, Fukamizu A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "15067378", "url": "https://glygen.org/publication/PubMed/15067378" } ] }, { "title": "Sorting of furin in polarized epithelial and endothelial cells: expression beyond the Golgi apparatus.", "journal": "The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society", "date": "2004", "authors": "Mayer G, Boileau G, Bendayan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "15100235", "url": "https://glygen.org/publication/PubMed/15100235" } ] }, { "title": "Functional analysis of peroxisome-proliferator-responsive element motifs in genes of fatty acid-binding proteins.", "journal": "The Biochemical journal", "date": "2004", "authors": "Schachtrup C, Emmler T, Bleck B, Sandqvist A, Spener F", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "15130092", "url": "https://glygen.org/publication/PubMed/15130092" } ] }, { "title": "Menin is required for bone morphogenetic protein 2- and transforming growth factor beta-regulated osteoblastic differentiation through interaction with Smads and Runx2.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Sowa H, Kaji H, Hendy GN, Canaff L, Komori T, Sugimoto T, Chihara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "15150273", "url": "https://glygen.org/publication/PubMed/15150273" } ] }, { "title": "Cellular control of gene expression by T-type cyclin/CDK9 complexes.", "journal": "Gene", "date": "2004", "authors": "Garriga J, Grana X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15276198", "url": "https://glygen.org/publication/PubMed/15276198" } ] }, { "title": "Estrogens and progesterone promote persistent CCND1 gene activation during G1 by inducing transcriptional derepression via c-Jun/c-Fos/estrogen receptor (progesterone receptor) complex assembly to a distal regulatory element and recruitment of cyclin D1 to its own gene promoter.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Cicatiello L, Addeo R, Sasso A, Altucci L, Petrizzi VB, Borgo R, Cancemi M, Caporali S, Caristi S, Scafoglio C, Teti D, Bresciani F, Perillo B, Weisz A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15282324", "url": "https://glygen.org/publication/PubMed/15282324" } ] }, { "title": "Large-scale characterization of HeLa cell nuclear phosphoproteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "P08047-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047-1" } ], "reference": [ { "type": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" } ] }, { "title": "Transcriptional complexes engaged by apo-estrogen receptor-alpha isoforms have divergent outcomes.", "journal": "The EMBO journal", "date": "2004", "authors": "Metivier R, Penot G, Carmouche RP, Hubner MR, Reid G, Denger S, Manu D, Brand H, Kos M, Benes V, Gannon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15343269", "url": "https://glygen.org/publication/PubMed/15343269" } ] }, { "title": "Discovery of estrogen receptor alpha target genes and response elements in breast tumor cells.", "journal": "Genome biology", "date": "2004", "authors": "Lin CY, Strom A, Vega VB, Kong SL, Yeo AL, Thomsen JS, Chan WC, Doray B, Bangarusamy DK, Ramasamy A, Vergara LA, Tang S, Chong A, Bajic VB, Miller LD, Gustafsson JA, Liu ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15345050", "url": "https://glygen.org/publication/PubMed/15345050" } ] }, { "title": "Oct-1 and Oct-2 potentiate functional interactions of a transcription factor with the proximal sequence element of small nuclear RNA genes.", "journal": "Molecular and cellular biology", "date": "1992", "authors": "Murphy S, Yoon JB, Gerster T, Roeder RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "1535687", "url": "https://glygen.org/publication/PubMed/1535687" } ] }, { "title": "Global gene expression analysis of estrogen receptor transcription factor cross talk in breast cancer: identification of estrogen-induced/activator protein-1-dependent genes.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2005", "authors": "DeNardo DG, Kim HT, Hilsenbeck S, Cuba V, Tsimelzon A, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15514030", "url": "https://glygen.org/publication/PubMed/15514030" } ] }, { "title": "Ras/mitogen-activated protein kinase signaling activates Ets-1 and Ets-2 by CBP/p300 recruitment.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Foulds CE, Nelson ML, Blaszczak AG, Graves BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559585" } ], "reference": [ { "type": "PubMed", "id": "15572696", "url": "https://glygen.org/publication/PubMed/15572696" } ] }, { "title": "Regulation of human hepatic hydroxysteroid sulfotransferase gene expression by the peroxisome proliferator-activated receptor alpha transcription factor.", "journal": "Molecular pharmacology", "date": "2005", "authors": "Fang HL, Strom SC, Cai H, Falany CN, Kocarek TA, Runge-Morris M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "15635043", "url": "https://glygen.org/publication/PubMed/15635043" } ] }, { "title": "Transcriptional repression and heterochromatin formation by MBD1 and MCAF/AM family proteins.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Ichimura T, Watanabe S, Sakamoto Y, Aoto T, Fujita N, Nakao M", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "reference": [ { "type": "PubMed", "id": "15691849", "url": "https://glygen.org/publication/PubMed/15691849" } ] }, { "title": "The identification of Hoxc8 target genes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005-02-15", "authors": "Lei Haiyan, Wang Hailong, Juan Aster H, Ruddle Frank H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9762293", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9762293" } ], "reference": [ { "type": "PubMed", "id": "15699330", "url": "https://glygen.org/publication/PubMed/15699330" } ] }, { "title": "GREB 1 is a critical regulator of hormone dependent breast cancer growth.", "journal": "Breast cancer research and treatment", "date": "2005", "authors": "Rae JM, Johnson MD, Scheys JO, Cordero KE, Larios JM, Lippman ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15986123", "url": "https://glygen.org/publication/PubMed/15986123" } ] }, { "title": "Chromosome-wide mapping of estrogen receptor binding reveals long-range regulation requiring the forkhead protein FoxA1.", "journal": "Cell", "date": "2005", "authors": "Carroll JS, Liu XS, Brodsky AS, Li W, Meyer CA, Szary AJ, Eeckhoute J, Shao W, Hestermann EV, Geistlinger TR, Fox EA, Silver PA, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16009131", "url": "https://glygen.org/publication/PubMed/16009131" } ] }, { "title": "Perturbations in O-linked beta-N-acetylglucosamine protein modification cause severe defects in mitotic progression and cytokinesis.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Slawson C, Zachara NE, Vosseller K, Cheung WD, Lane MD, Hart GW", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "16027160", "url": "https://glygen.org/publication/PubMed/16027160" } ] }, { "title": "Cathepsin D: newly discovered functions of a long-standing aspartic protease in cancer and apoptosis.", "journal": "Cancer letters", "date": "2006", "authors": "Liaudet-Coopman E, Beaujouin M, Derocq D, Garcia M, Glondu-Lassis M, Laurent-Matha V, Prebois C, Rochefort H, Vignon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16046058", "url": "https://glygen.org/publication/PubMed/16046058" } ] }, { "title": "From the Cover: Location analysis of estrogen receptor alpha target promoters reveals that FOXA1 defines a domain of the estrogen response.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Laganiere J, Deblois G, Lefebvre C, Bataille AR, Robert F, Giguere V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16087863", "url": "https://glygen.org/publication/PubMed/16087863" } ] }, { "title": "The severe acute respiratory syndrome coronavirus nucleocapsid protein is phosphorylated and localizes in the cytoplasm by 14-3-3-mediated translocation.", "journal": "Journal of virology", "date": "2005", "authors": "Surjit M, Kumar R, Mishra RN, Reddy MK, Chow VT, Lal SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9735871", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9735871" } ], "reference": [ { "type": "PubMed", "id": "16103198", "url": "https://glygen.org/publication/PubMed/16103198" } ] }, { "title": "Downstream targets of growth factor and oestrogen signalling and endocrine resistance: the potential roles of c-Myc, cyclin D1 and cyclin E.", "journal": "Endocrine-related cancer", "date": "2005", "authors": "Butt AJ, McNeil CM, Musgrove EA, Sutherland RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16113099", "url": "https://glygen.org/publication/PubMed/16113099" } ] }, { "title": "Distinct E2F-mediated transcriptional program regulates p14ARF gene expression.", "journal": "The EMBO journal", "date": "2005", "authors": "Komori H, Enomoto M, Nakamura M, Iwanaga R, Ohtani K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559585" } ], "reference": [ { "type": "PubMed", "id": "16211008", "url": "https://glygen.org/publication/PubMed/16211008" } ] }, { "title": "Integrator, a multiprotein mediator of small nuclear RNA processing, associates with the C-terminal repeat of RNA polymerase II.", "journal": "Cell", "date": "2005", "authors": "Baillat D, Hakimi MA, Naar AM, Shilatifard A, Cooch N, Shiekhattar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "16239144", "url": "https://glygen.org/publication/PubMed/16239144" } ] }, { "title": "Y-box protein-1 is the crucial mediator of antifibrotic interferon-gamma effects.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Dooley S, Said HM, Gressner AM, Floege J, En-Nia A, Mertens PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "16278212", "url": "https://glygen.org/publication/PubMed/16278212" } ] }, { "title": "Mechanism of estrogen activation of c-myc oncogene expression.", "journal": "Oncogene", "date": "1992", "authors": "Dubik D, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "1630819", "url": "https://glygen.org/publication/PubMed/1630819" } ] }, { "title": "P-TEFb is not an essential elongation factor for the intronless human U2 snRNA and histone H2b genes.", "journal": "The EMBO journal", "date": "2005", "authors": "Medlin J, Scurry A, Taylor A, Zhang F, Peterlin BM, Murphy S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "16308568", "url": "https://glygen.org/publication/PubMed/16308568" } ] }, { "title": "Constitutively phosphorylated Smad3 interacts with Sp1 and p300 in scleroderma fibroblasts.", "journal": "Rheumatology (Oxford, England)", "date": "2006", "authors": "Ihn H, Yamane K, Asano Y, Jinnin M, Tamaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "16319104", "url": "https://glygen.org/publication/PubMed/16319104" } ] }, { "title": "Insulin dynamically regulates calmodulin gene expression by sequential o-glycosylation and phosphorylation of sp1 and its subcellular compartmentalization in liver cells.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Majumdar G, Harrington A, Hungerford J, Martinez-Hernandez A, Gerling IC, Raghow R, Solomon S", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047#ptm_processing" }, { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" } ], "reference": [ { "type": "PubMed", "id": "16332679", "url": "https://glygen.org/publication/PubMed/16332679" } ] }, { "title": "HER-2/neu represses the metastasis suppressor RECK via ERK and Sp transcription factors to promote cell invasion.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Hsu MC, Chang HC, Hung WC", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" } ], "reference": [ { "type": "PubMed", "id": "16377629", "url": "https://glygen.org/publication/PubMed/16377629" } ] }, { "title": "Identification of novel PPARgamma target genes in primary human adipocytes.", "journal": "Gene", "date": "2006", "authors": "Perera RJ, Marcusson EG, Koo S, Kang X, Kim Y, White N, Dean NM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "16380219", "url": "https://glygen.org/publication/PubMed/16380219" } ] }, { "title": "Sumoylation inhibits cleavage of Sp1 N-terminal negative regulatory domain and inhibits Sp1-dependent transcription.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Spengler ML, Brattain MG", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "reference": [ { "type": "PubMed", "id": "16407261", "url": "https://glygen.org/publication/PubMed/16407261" } ] }, { "title": "Global identification of O-GlcNAc-modified proteins.", "journal": "Analytical chemistry", "date": "2006", "authors": "Nandi A, Sprung R, Barma DK, Zhao Y, Kim SC, Falck JR, Zhao Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "16408927", "url": "https://glygen.org/publication/PubMed/16408927" } ] }, { "title": "Sp1 deacetylation induced by phorbol ester recruits p300 to activate 12(S)-lipoxygenase gene transcription.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Hung JJ, Wang YT, Chang WC", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "reference": [ { "type": "PubMed", "id": "16478997", "url": "https://glygen.org/publication/PubMed/16478997" } ] }, { "title": "Identification of a Hoxc8-regulated transcriptional network in mouse embryo fibroblast cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006-07-05", "authors": "Lei Haiyan, Juan Aster H, Kim Moo-Sang, Ruddle Frank H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9762293", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9762293" } ], "reference": [ { "type": "PubMed", "id": "16793922", "url": "https://glygen.org/publication/PubMed/16793922" } ] }, { "title": "DDX3, a DEAD box RNA helicase with tumor growth-suppressive property and transcriptional regulation activity of the p21waf1/cip1 promoter, is a candidate tumor suppressor.", "journal": "Cancer Res.", "date": "2006", "authors": "Chao Chi-Hong, Chen Chun-Ming, Cheng Pei-Lin, Shih Jing-Wen, Tsou Ann-Ping, Lee Yan-Hwa Wu", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "reference": [ { "type": "PubMed", "id": "16818630", "url": "https://glygen.org/publication/PubMed/16818630" } ] }, { "title": "The unorthodox SNAP50 zinc finger domain contributes to cooperative promoter recognition by human SNAPC.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Jawdekar GW, Hanzlowsky A, Hovde SL, Jelencic B, Feig M, Geiger JH, Henry RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "16901896", "url": "https://glygen.org/publication/PubMed/16901896" } ] }, { "title": "Phosphatidylinositol 3-kinase/protein kinase Czeta-induced phosphorylation of Sp1 and p107 repressor release have a critical role in histone deacetylase inhibitor-mediated derepression [corrected] of transcription of the luteinizing hormone receptor gene.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Zhang Y, Liao M, Dufau ML", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" } ], "reference": [ { "type": "PubMed", "id": "16943418", "url": "https://glygen.org/publication/PubMed/16943418" } ] }, { "title": "A probability-based approach for high-throughput protein phosphorylation analysis and site localization.", "journal": "Nature biotechnology", "date": "2006", "authors": "Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "iPTMnet", "id": "P08047-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047-1" } ], "reference": [ { "type": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" } ] }, { "title": "The arylhydrocarbon receptor repressor (AhRR): structure, expression, and function.", "journal": "Biological chemistry", "date": "2006", "authors": "Haarmann-Stemmann T, Abel J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "16972786", "url": "https://glygen.org/publication/PubMed/16972786" } ] }, { "title": "A cell-type-specific transcriptional network required for estrogen regulation of cyclin D1 and cell cycle progression in breast cancer.", "journal": "Genes & development", "date": "2006", "authors": "Eeckhoute J, Carroll JS, Geistlinger TR, Torres-Arzayus MI, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16980581", "url": "https://glygen.org/publication/PubMed/16980581" } ] }, { "title": "SARS-CoV nucleocapsid protein binds to hUbc9, a ubiquitin conjugating enzyme of the sumoylation system.", "journal": "Journal of medical virology", "date": "2006", "authors": "Fan Z, Zhuo Y, Tan X, Zhou Z, Yuan J, Qiang B, Yan J, Peng X, Gao GF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9735871", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9735871" } ], "reference": [ { "type": "PubMed", "id": "16998888", "url": "https://glygen.org/publication/PubMed/16998888" } ] }, { "title": "Genome-wide analysis of estrogen receptor binding sites.", "journal": "Nature genetics", "date": "2006", "authors": "Carroll JS, Meyer CA, Song J, Li W, Geistlinger TR, Eeckhoute J, Brodsky AS, Keeton EK, Fertuck KC, Hall GF, Wang Q, Bekiranov S, Sementchenko V, Fox EA, Silver PA, Gingeras TR, Liu XS, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17013392", "url": "https://glygen.org/publication/PubMed/17013392" } ] }, { "title": "Increased chromatin association of Sp1 in interphase cells by PP2A-mediated dephosphorylations.", "journal": "Journal of molecular biology", "date": "2006", "authors": "Vicart A, Lefebvre T, Imbert J, Fernandez A, Kahn-Perles B", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "database": "iPTMnet", "id": "P08047-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047-1" } ], "reference": [ { "type": "PubMed", "id": "17049555", "url": "https://glygen.org/publication/PubMed/17049555" } ] }, { "title": "Cooperative demethylation by JMJD2C and LSD1 promotes androgen receptor-dependent gene expression.", "journal": "Nature cell biology", "date": "2007", "authors": "Wissmann M, Yin N, Muller JM, Greschik H, Fodor BD, Jenuwein T, Vogler C, Schneider R, Gunther T, Buettner R, Metzger E, Schule R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17277772", "url": "https://glygen.org/publication/PubMed/17277772" } ] }, { "title": "The SARS-Coronavirus Membrane protein induces apoptosis through modulating the Akt survival pathway.", "journal": "Archives of biochemistry and biophysics", "date": "2007", "authors": "Chan CM, Ma CW, Chan WY, Chan HY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9735871", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9735871" } ], "reference": [ { "type": "PubMed", "id": "17306213", "url": "https://glygen.org/publication/PubMed/17306213" } ] }, { "title": "Promoter-selective activation domains in Oct-1 and Oct-2 direct differential activation of an snRNA and mRNA promoter.", "journal": "Cell", "date": "1992", "authors": "Tanaka M, Lai JS, Herr W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "1739980", "url": "https://glygen.org/publication/PubMed/1739980" } ] }, { "title": "Smad7 antagonizes transforming growth factor beta signaling in the nucleus by interfering with functional Smad-DNA complex formation.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Zhang S, Fei T, Zhang L, Zhang R, Chen F, Ning Y, Han Y, Feng XH, Meng A, Chen YG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "17438144", "url": "https://glygen.org/publication/PubMed/17438144" } ] }, { "title": "Genistein downregulates SREBP-1 regulated gene expression by inhibiting site-1 protease expression in HepG2 cells.", "journal": "The Journal of nutrition", "date": "2007", "authors": "Shin ES, Lee HH, Cho SY, Park HW, Lee SJ, Lee TR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "17449569", "url": "https://glygen.org/publication/PubMed/17449569" } ] }, { "title": "Regulation of GREB1 transcription by estrogen receptor alpha through a multipartite enhancer spread over 20 kb of upstream flanking sequences.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Deschenes J, Bourdeau V, White JH, Mader S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17463000", "url": "https://glygen.org/publication/PubMed/17463000" } ] }, { "title": "The DEAD-box p68/p72 proteins and the noncoding RNA steroid receptor activator SRA: eclectic regulators of disparate biological functions.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2007", "authors": "Caretti G, Lei EP, Sartorelli V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17495528", "url": "https://glygen.org/publication/PubMed/17495528" } ] }, { "title": "Novel estrogen receptor-alpha binding sites and estradiol target genes identified by chromatin immunoprecipitation cloning in breast cancer.", "journal": "Cancer research", "date": "2007", "authors": "Lin Z, Reierstad S, Huang CC, Bulun SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17510434", "url": "https://glygen.org/publication/PubMed/17510434" } ] }, { "title": "Enhanced phosphorylation of transcription factor sp1 in response to herpes simplex virus type 1 infection is dependent on the ataxia telangiectasia-mutated protein.", "journal": "Journal of virology", "date": "2007", "authors": "Iwahori S, Shirata N, Kawaguchi Y, Weller SK, Sato Y, Kudoh A, Nakayama S, Isomura H, Tsurumi T", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" } ], "reference": [ { "type": "PubMed", "id": "17609267", "url": "https://glygen.org/publication/PubMed/17609267" } ] }, { "title": "Antisense glutaminase inhibition modifies the O-GlcNAc pattern and flux through the hexosamine pathway in breast cancer cells.", "journal": "Journal of cellular biochemistry", "date": "2008", "authors": "Donadio AC, Lobo C, Tosina M, de la Rosa V, Martin-Rufian M, Campos-Sandoval JA, Mates JM, Marquez J, Alonso FJ, Segura JA", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "17614351", "url": "https://glygen.org/publication/PubMed/17614351" } ] }, { "title": "The AP-1 transcription factor regulates breast cancer cell growth via cyclins and E2F factors.", "journal": "Oncogene", "date": "2008", "authors": "Shen Q, Uray IP, Li Y, Krisko TI, Strecker TE, Kim HT, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17637753", "url": "https://glygen.org/publication/PubMed/17637753" } ] }, { "title": "Long-range activation of GREB1 by estrogen receptor via three distal consensus estrogen-responsive elements in breast cancer cells.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2007", "authors": "Sun J, Nawaz Z, Slingerland JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17666587", "url": "https://glygen.org/publication/PubMed/17666587" } ] }, { "title": "Mechanism of and requirement for estrogen-regulated MYB expression in estrogen-receptor-positive breast cancer cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Drabsch Y, Hugo H, Zhang R, Dowhan DH, Miao YR, Gewirtz AM, Barry SC, Ramsay RG, Gonda TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17690249", "url": "https://glygen.org/publication/PubMed/17690249" } ] }, { "title": "Histone deacetylase 3 down-regulates cholesterol synthesis through repression of lanosterol synthase gene expression.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Villagra A, Ulloa N, Zhang X, Yuan Z, Sotomayor E, Seto E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "17925399", "url": "https://glygen.org/publication/PubMed/17925399" } ] }, { "title": "Severe acute respiratory syndrome coronavirus Orf3a protein interacts with caveolin.", "journal": "The Journal of general virology", "date": "2007", "authors": "Padhan K, Tanwar C, Hussain A, Hui PY, Lee MY, Cheung CY, Peiris JSM, Jameel S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9735871", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9735871" } ], "reference": [ { "type": "PubMed", "id": "17947532", "url": "https://glygen.org/publication/PubMed/17947532" } ] }, { "title": "Severe acute respiratory syndrome-associated coronavirus nucleocapsid protein interacts with Smad3 and modulates transforming growth factor-beta signaling.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Zhao X, Nicholls JM, Chen YG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9735871", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9735871" } ], "reference": [ { "type": "PubMed", "id": "18055455", "url": "https://glygen.org/publication/PubMed/18055455" } ] }, { "title": "Serine-7 of the RNA polymerase II CTD is specifically required for snRNA gene expression.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Egloff S, O'Reilly D, Chapman RD, Taylor A, Tanzhaus K, Pitts L, Eick D, Murphy S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "18079403", "url": "https://glygen.org/publication/PubMed/18079403" } ] }, { "title": "Phosphorylation of Sp1 in response to DNA damage by ataxia telangiectasia-mutated kinase.", "journal": "Molecular cancer research : MCR", "date": "2007", "authors": "Olofsson BA, Kelly CM, Kim J, Hornsby SM, Azizkhan-Clifford J", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" } ], "reference": [ { "type": "PubMed", "id": "18171990", "url": "https://glygen.org/publication/PubMed/18171990" } ] }, { "title": "DNA oxidation as triggered by H3K9me2 demethylation drives estrogen-induced gene expression.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "Perillo B, Ombra MN, Bertoni A, Cuozzo C, Sacchetti S, Sasso A, Chiariotti L, Malorni A, Abbondanza C, Avvedimento EV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18187655", "url": "https://glygen.org/publication/PubMed/18187655" } ] }, { "title": "Phosphorylation by c-Jun NH2-terminal kinase 1 regulates the stability of transcription factor Sp1 during mitosis.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Chuang JY, Wang YT, Yeh SH, Liu YW, Chang WC, Hung JJ", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" } ], "reference": [ { "type": "PubMed", "id": "18199680", "url": "https://glygen.org/publication/PubMed/18199680" } ] }, { "title": "Cohesins localize with CTCF at the KSHV latency control region and at cellular c-myc and H19/Igf2 insulators.", "journal": "The EMBO journal", "date": "2008", "authors": "Stedman W, Kang H, Lin S, Kissil JL, Bartolomei MS, Lieberman PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18219272", "url": "https://glygen.org/publication/PubMed/18219272" } ] }, { "title": "Phosphorylation mediates Sp1 coupled activities of proteolytic processing, desumoylation and degradation.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2008", "authors": "Spengler ML, Guo LW, Brattain MG", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "iPTMnet", "id": "P08047-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047-1" } ], "reference": [ { "type": "PubMed", "id": "18239466", "url": "https://glygen.org/publication/PubMed/18239466" } ] }, { "title": "Genome-wide mapping and characterization of hypomethylated sites in human tissues and breast cancer cell lines.", "journal": "Genome research", "date": "2008", "authors": "Shann YJ, Cheng C, Chiao CH, Chen DT, Li PH, Hsu MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18256232", "url": "https://glygen.org/publication/PubMed/18256232" } ] }, { "title": "Angiotensin II-inducible platelet-derived growth factor-D transcription requires specific Ser/Thr residues in the second zinc finger region of Sp1.", "journal": "Circulation research", "date": "2008", "authors": "Tan NY, Midgley VC, Kavurma MM, Santiago FS, Luo X, Peden R, Fahmy RG, Berndt MC, Molloy MP, Khachigian LM", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" } ], "reference": [ { "type": "PubMed", "id": "18258854", "url": "https://glygen.org/publication/PubMed/18258854" } ] }, { "title": "Both Oct-1 and Oct-2A contain domains which can activate the ubiquitously expressed U2 snRNA genes.", "journal": "The EMBO journal", "date": "1991", "authors": "Yang J, Muller-Immergluck MM, Seipel K, Janson L, Westin G, Schaffner W, Pettersson U", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "1829677", "url": "https://glygen.org/publication/PubMed/1829677" } ] }, { "title": "Transient cyclical methylation of promoter DNA.", "journal": "Nature", "date": "2008", "authors": "Kangaspeska S, Stride B, Metivier R, Polycarpou-Schwarz M, Ibberson D, Carmouche RP, Benes V, Gannon F, Reid G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18322535", "url": "https://glygen.org/publication/PubMed/18322535" } ] }, { "title": "FoxA1 translates epigenetic signatures into enhancer-driven lineage-specific transcription.", "journal": "Cell", "date": "2008", "authors": "Lupien M, Eeckhoute J, Meyer CA, Wang Q, Zhang Y, Li W, Carroll JS, Liu XS, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18358809", "url": "https://glygen.org/publication/PubMed/18358809" } ] }, { "title": "Estrogen and MYB in breast cancer: potential for new therapies.", "journal": "Expert opinion on biological therapy", "date": "2008", "authors": "Gonda TJ, Leo P, Ramsay RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18476782", "url": "https://glygen.org/publication/PubMed/18476782" } ] }, { "title": "Activation of PPARgamma negatively regulates O-GlcNAcylation of Sp1.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Chung SS, Kim JH, Park HS, Choi HH, Lee KW, Cho YM, Lee HK, Park KS", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "reference": [ { "type": "PubMed", "id": "18513490", "url": "https://glygen.org/publication/PubMed/18513490" } ] }, { "title": "Meta-analysis of human cancer microarrays reveals GATA3 is integral to the estrogen receptor alpha pathway.", "journal": "Molecular cancer", "date": "2008", "authors": "Wilson BJ, Giguere V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18533032", "url": "https://glygen.org/publication/PubMed/18533032" } ] }, { "title": "The aryl hydrocarbon receptor complex and the control of gene expression.", "journal": "Critical reviews in eukaryotic gene expression", "date": "2008", "authors": "Beischlag TV, Luis Morales J, Hollingshead BD, Perdew GH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "18540824", "url": "https://glygen.org/publication/PubMed/18540824" } ] }, { "title": "Microarray analyses of SREBP-1a and SREBP-1c target genes identify new regulatory pathways in muscle.", "journal": "Physiological genomics", "date": "2008", "authors": "Rome S, Lecomte V, Meugnier E, Rieusset J, Debard C, Euthine V, Vidal H, Lefai E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "18559965", "url": "https://glygen.org/publication/PubMed/18559965" } ] }, { "title": "TAZ controls Smad nucleocytoplasmic shuttling and regulates human embryonic stem-cell self-renewal.", "journal": "Nature cell biology", "date": "2008", "authors": "Varelas X, Sakuma R, Samavarchi-Tehrani P, Peerani R, Rao BM, Dembowy J, Yaffe MB, Zandstra PW, Wrana JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "18568018", "url": "https://glygen.org/publication/PubMed/18568018" } ] }, { "title": "Identification of phosphorylation sites on transcription factor Sp1 in response to DNA damage and its accumulation at damaged sites.", "journal": "Cellular signalling", "date": "2008", "authors": "Iwahori S, Yasui Y, Kudoh A, Sato Y, Nakayama S, Murata T, Isomura H, Tsurumi T", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" } ], "reference": [ { "type": "PubMed", "id": "18619531", "url": "https://glygen.org/publication/PubMed/18619531" } ] }, { "title": "Genome-wide occupancy of SREBP1 and its partners NFY and SP1 reveals novel functional roles and combinatorial regulation of distinct classes of genes.", "journal": "PLoS genetics", "date": "2008", "authors": "Reed BD, Charos AE, Szekely AM, Weissman SM, Snyder M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "18654640", "url": "https://glygen.org/publication/PubMed/18654640" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "P08047-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Proto-oncogene FBI-1 (Pokemon) and SREBP-1 synergistically activate transcription of fatty-acid synthase gene (FASN).", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Choi WI, Jeon BN, Park H, Yoo JY, Kim YS, Koh DI, Kim MH, Kim YR, Lee CE, Kim KS, Osborne TF, Hur MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "18682402", "url": "https://glygen.org/publication/PubMed/18682402" } ] }, { "title": "Differential regulation of human ALAS1 mRNA and protein levels by heme and cobalt protoporphyrin.", "journal": "Molecular and cellular biochemistry", "date": "2008", "authors": "Zheng J, Shan Y, Lambrecht RW, Donohue SE, Bonkovsky HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "18719978", "url": "https://glygen.org/publication/PubMed/18719978" } ] }, { "title": "cDNA cloning, chromosome mapping and expression characterization of human geranylgeranyl pyrophosphate synthase.", "journal": "Science in China. Series C, Life sciences", "date": "2000", "authors": "Zhao Y, Yu L, Gao J, Fu Q, Hua Y, Zhang H, Zhao S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "18726356", "url": "https://glygen.org/publication/PubMed/18726356" } ] }, { "title": "Cathepsin D: a cellular roadmap.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Zaidi N, Maurer A, Nieke S, Kalbacher H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18762174", "url": "https://glygen.org/publication/PubMed/18762174" } ] }, { "title": "Marking time: the dynamic role of chromatin and covalent modification in transcription.", "journal": "The international journal of biochemistry & cell biology", "date": "2009", "authors": "Reid G, Gallais R, Metivier R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18805503", "url": "https://glygen.org/publication/PubMed/18805503" } ] }, { "title": "Regulation of constitutive and inducible AHR signaling: complex interactions involving the AHR repressor.", "journal": "Biochemical pharmacology", "date": "2009", "authors": "Hahn ME, Allan LL, Sherr DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "18848529", "url": "https://glygen.org/publication/PubMed/18848529" } ] }, { "title": "CXXC5 is a novel BMP4-regulated modulator of Wnt signaling in neural stem cells.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Andersson T, Sodersten E, Duckworth JK, Cascante A, Fritz N, Sacchetti P, Cervenka I, Bryja V, Hermanson O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19001364", "url": "https://glygen.org/publication/PubMed/19001364" } ] }, { "title": "Transcriptional regulation of the cyclin D1 gene at a glance.", "journal": "Journal of cell science", "date": "2008", "authors": "Klein EA, Assoian RK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19020303", "url": "https://glygen.org/publication/PubMed/19020303" } ] }, { "title": "Transcriptional regulation of HMG-CoA synthase and HMG-CoA reductase genes by human ACBP.", "journal": "Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology", "date": "2008", "authors": "Vock C, Doring F, Nitz I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "19088433", "url": "https://glygen.org/publication/PubMed/19088433" } ] }, { "title": "The lysine demethylase LSD1 (KDM1) is required for maintenance of global DNA methylation.", "journal": "Nature genetics", "date": "2009", "authors": "Wang J, Hevi S, Kurash JK, Lei H, Gay F, Bajko J, Su H, Sun W, Chang H, Xu G, Gaudet F, Li E, Chen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19098913", "url": "https://glygen.org/publication/PubMed/19098913" } ] }, { "title": "MCAF1/AM is involved in Sp1-mediated maintenance of cancer-associated telomerase activity.", "journal": "J. Biol. Chem.", "date": "2009", "authors": "Liu Lifeng, Ishihara Ko, Ichimura Takaya, Fujita Naoyuki, Hino Shinjiro, Tomita Saori, Watanabe Sugiko, Saitoh Noriko, Ito Takaaki, Nakao Mitsuyoshi", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "reference": [ { "type": "PubMed", "id": "19106100", "url": "https://glygen.org/publication/PubMed/19106100" } ] }, { "title": "O-linked N-acetylglucosaminylation of Sp1 inhibits the human immunodeficiency virus type 1 promoter.", "journal": "Journal of virology", "date": "2009", "authors": "Jochmann R, Thurau M, Jung S, Hofmann C, Naschberger E, Kremmer E, Harrer T, Miller M, Schaft N, Sturzl M", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "19193796", "url": "https://glygen.org/publication/PubMed/19193796" } ] }, { "title": "Heat shock protein 90 is important for Sp1 stability during mitosis.", "journal": "Journal of molecular biology", "date": "2009", "authors": "Wang SA, Chuang JY, Yeh SH, Wang YT, Liu YW, Chang WC, Hung JJ", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" } ], "reference": [ { "type": "PubMed", "id": "19245816", "url": "https://glygen.org/publication/PubMed/19245816" } ] }, { "title": "Breast cancer, estrogen receptor and ligands.", "journal": "Archiv der Pharmazie", "date": "2009", "authors": "Bai Z, Gust R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19274700", "url": "https://glygen.org/publication/PubMed/19274700" } ] }, { "title": "O-GlcNAc inhibits interaction between Sp1 and Elf-1 transcription factors.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2009", "authors": "Lim K, Chang HI", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "reference": [ { "type": "PubMed", "id": "19285002", "url": "https://glygen.org/publication/PubMed/19285002" } ] }, { "title": "Histone modifications at human enhancers reflect global cell-type-specific gene expression.", "journal": "Nature", "date": "2009", "authors": "Heintzman ND, Hon GC, Hawkins RD, Kheradpour P, Stark A, Harp LF, Ye Z, Lee LK, Stuart RK, Ching CW, Ching KA, Antosiewicz-Bourget JE, Liu H, Zhang X, Green RD, Lobanenkov VV, Stewart R, Thomson JA, Crawford GE, Kellis M, Ren B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19295514", "url": "https://glygen.org/publication/PubMed/19295514" } ] }, { "title": "O-GlcNAcylation of Sp1 interrupts Sp1 interaction with NF-Y.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2009", "authors": "Lim K, Chang HI", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "19302979", "url": "https://glygen.org/publication/PubMed/19302979" } ] }, { "title": "Phosphorylated extracellular signal-regulated protein kinases 1 and 2 phosphorylate Sp1 on serine 59 and regulate cellular senescence via transcription of p21Sdi1/Cip1/Waf1.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Kim HS, Lim IK", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" } ], "reference": [ { "type": "PubMed", "id": "19318349", "url": "https://glygen.org/publication/PubMed/19318349" } ] }, { "title": "Genomic responses from the estrogen-responsive element-dependent signaling pathway mediated by estrogen receptor alpha are required to elicit cellular alterations.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Nott SL, Huang Y, Li X, Fluharty BR, Qiu X, Welshons WV, Yeh S, Muyan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19321454", "url": "https://glygen.org/publication/PubMed/19321454" } ] }, { "title": "Thiazolidinediones mimic glucose starvation in facilitating Sp1 degradation through the up-regulation of beta-transducin repeat-containing protein.", "journal": "Molecular pharmacology", "date": "2009", "authors": "Wei S, Chuang HC, Tsai WC, Yang HC, Ho SR, Paterson AJ, Kulp SK, Chen CS", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" } ], "reference": [ { "type": "PubMed", "id": "19372209", "url": "https://glygen.org/publication/PubMed/19372209" } ] }, { "title": "E2-mediated cathepsin D (CTSD) activation involves looping of distal enhancer elements.", "journal": "Molecular oncology", "date": "2008", "authors": "Bretschneider N, Kangaspeska S, Seifert M, Reid G, Gannon F, Denger S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19383337", "url": "https://glygen.org/publication/PubMed/19383337" } ] }, { "title": "Participation of signaling pathways in the derepression of luteinizing hormone receptor transcription.", "journal": "Molecular and cellular endocrinology", "date": "2010", "authors": "Dufau ML, Liao M, Zhang Y", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" } ], "reference": [ { "type": "PubMed", "id": "19464346", "url": "https://glygen.org/publication/PubMed/19464346" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P08047-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047-1" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "Human BAHD1 promotes heterochromatic gene silencing.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2009", "authors": "Bierne H, Tham TN, Batsche E, Dumay A, Leguillou M, Kerneis-Golsteyn S, Regnault B, Seeler JS, Muchardt C, Feunteun J, Cossart P", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "reference": [ { "type": "PubMed", "id": "19666599", "url": "https://glygen.org/publication/PubMed/19666599" } ] }, { "title": "TFIIH-associated Cdk7 kinase functions in phosphorylation of C-terminal domain Ser7 residues, promoter-proximal pausing, and termination by RNA polymerase II.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Glover-Cutter K, Larochelle S, Erickson B, Zhang C, Shokat K, Fisher RP, Bentley DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "19667075", "url": "https://glygen.org/publication/PubMed/19667075" } ] }, { "title": "Isolation and sequence of the human farnesyl pyrophosphate synthetase cDNA. Coordinate regulation of the mRNAs for farnesyl pyrophosphate synthetase, 3-hydroxy-3-methylglutaryl coenzyme A reductase, and 3-hydroxy-3-methylglutaryl coenzyme A synthase by phorbol ester.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Wilkin DJ, Kutsunai SY, Edwards PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "1968462", "url": "https://glygen.org/publication/PubMed/1968462" } ] }, { "title": "Comparative analysis of gene regulation by the transcription factor PPARalpha between mouse and human.", "journal": "PloS one", "date": "2009", "authors": "Rakhshandehroo M, Hooiveld G, Muller M, Kersten S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "19710929", "url": "https://glygen.org/publication/PubMed/19710929" } ] }, { "title": "The DEAD-box protein p72 regulates ERalpha-/oestrogen-dependent transcription and cell growth, and is associated with improved survival in ERalpha-positive breast cancer.", "journal": "Oncogene", "date": "2009", "authors": "Wortham NC, Ahamed E, Nicol SM, Thomas RS, Periyasamy M, Jiang J, Ochocka AM, Shousha S, Huson L, Bray SE, Coombes RC, Ali S, Fuller-Pace FV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19718048", "url": "https://glygen.org/publication/PubMed/19718048" } ] }, { "title": "Nuclear CDKs drive Smad transcriptional activation and turnover in BMP and TGF-beta pathways.", "journal": "Cell", "date": "2009", "authors": "Alarcon C, Zaromytidou AI, Xi Q, Gao S, Yu J, Fujisawa S, Barlas A, Miller AN, Manova-Todorova K, Macias MJ, Sapkota G, Pan D, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "19914168", "url": "https://glygen.org/publication/PubMed/19914168" } ] }, { "title": "Activating peroxisome proliferator-activated receptor gamma mutant promotes tumor growth in vivo by enhancing angiogenesis.", "journal": "Cancer research", "date": "2009", "authors": "Tian L, Zhou J, Casimiro MC, Liang B, Ojeifo JO, Wang M, Hyslop T, Wang C, Pestell RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "19934321", "url": "https://glygen.org/publication/PubMed/19934321" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "iPTMnet", "id": "P08047-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Transcriptional regulation of human FE65, a ligand of Alzheimer's disease amyloid precursor protein, by Sp1.", "journal": "Journal of cellular biochemistry", "date": "2010-03-01", "authors": "Yu Hoi-Tin, Chan William Wai-Lun, Chai Ka-Ho, Lee Chris Wing-Cheung, Chang Raymond Chuen-Chung, Yu Man-Shan, McLoughlin Declan M, Miller Christopher C J, Lau Kwok-Fai", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "reference": [ { "type": "PubMed", "id": "20091743", "url": "https://glygen.org/publication/PubMed/20091743" } ] }, { "title": "Profiling of promoter occupancy by PPARalpha in human hepatoma cells via ChIP-chip analysis.", "journal": "Nucleic acids research", "date": "2010", "authors": "van der Meer DL, Degenhardt T, Vaisanen S, de Groot PJ, Heinaniemi M, de Vries SC, Muller M, Carlberg C, Kersten S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "20110263", "url": "https://glygen.org/publication/PubMed/20110263" } ] }, { "title": "Snail associates with EGR-1 and SP-1 to upregulate transcriptional activation of p15INK4b.", "journal": "FEBS J.", "date": "2010", "authors": "Hu Chi-Tan, Chang Tsu-Yao, Cheng Chuan-Chu, Liu Chun-Shan, Wu Jia-Ru, Li Ming-Che, Wu Wen-Sheng", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "reference": [ { "type": "PubMed", "id": "20121949", "url": "https://glygen.org/publication/PubMed/20121949" } ] }, { "title": "Activation of TM7SF2 promoter by SREBP-2 depends on a new sterol regulatory element, a GC-box, and an inverted CCAAT-box.", "journal": "Biochimica et biophysica acta", "date": "2010", "authors": "Schiavoni G, Bennati AM, Castelli M, Della Fazia MA, Beccari T, Servillo G, Roberti R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "20138239", "url": "https://glygen.org/publication/PubMed/20138239" } ] }, { "title": "TRAIL promotes VSMC proliferation and neointima formation in a FGF-2-, Sp1 phosphorylation-, and NFkappaB-dependent manner.", "journal": "Circulation research", "date": "2010", "authors": "Chan J, Prado-Lourenco L, Khachigian LM, Bennett MR, Di Bartolo BA, Kavurma MM", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" } ], "reference": [ { "type": "PubMed", "id": "20150555", "url": "https://glygen.org/publication/PubMed/20150555" } ] }, { "title": "Self-assembly of severe acute respiratory syndrome coronavirus membrane protein.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Tseng YT, Wang SM, Huang KJ, Lee AI, Chiang CC, Wang CT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9735871", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9735871" } ], "reference": [ { "type": "PubMed", "id": "20154085", "url": "https://glygen.org/publication/PubMed/20154085" } ] }, { "title": "A CTCF-independent role for cohesin in tissue-specific transcription.", "journal": "Genome research", "date": "2010", "authors": "Schmidt D, Schwalie PC, Ross-Innes CS, Hurtado A, Brown GD, Carroll JS, Flicek P, Odom DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20219941", "url": "https://glygen.org/publication/PubMed/20219941" } ] }, { "title": "A novel Wilms tumor 1 (WT1) target gene negatively regulates the WNT signaling pathway.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Kim MS, Yoon SK, Bollig F, Kitagaki J, Hur W, Whye NJ, Wu YP, Rivera MN, Park JY, Kim HS, Malik K, Bell DW, Englert C, Perantoni AO, Lee SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20220130", "url": "https://glygen.org/publication/PubMed/20220130" } ] }, { "title": "Glycopeptide-specific monoclonal antibodies suggest new roles for O-GlcNAc.", "journal": "Nature chemical biology", "date": "2010", "authors": "Teo CF, Ingale S, Wolfert MA, Elsayed GA, Not LG, Chatham JC, Wells L, Boons GJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "20305658", "url": "https://glygen.org/publication/PubMed/20305658" } ] }, { "title": "Sterol-regulatory-element-binding protein 2 and nuclear factor Y control human farnesyl diphosphate synthase expression and affect cell proliferation in hepatoblastoma cells.", "journal": "The Biochemical journal", "date": "2010", "authors": "Ishimoto K, Tachibana K, Hanano I, Yamasaki D, Nakamura H, Kawai M, Urano Y, Tanaka T, Hamakubo T, Sakai J, Kodama T, Doi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "20450493", "url": "https://glygen.org/publication/PubMed/20450493" } ] }, { "title": "The integrator complex recognizes a new double mark on the RNA polymerase II carboxyl-terminal domain.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Egloff S, Szczepaniak SA, Dienstbier M, Taylor A, Knight S, Murphy S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "20457598", "url": "https://glygen.org/publication/PubMed/20457598" } ] }, { "title": "Interactions of SARS coronavirus nucleocapsid protein with the host cell proteasome subunit p42.", "journal": "Virology journal", "date": "2010", "authors": "Wang Q, Li C, Zhang Q, Wang T, Li J, Guan W, Yu J, Liang M, Li D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9735871", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9735871" } ], "reference": [ { "type": "PubMed", "id": "20478047", "url": "https://glygen.org/publication/PubMed/20478047" } ] }, { "title": "Novel trans-tail regulation of H2B ubiquitylation and H3K4 methylation by the N terminus of histone H2A.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Zheng S, Wyrick JJ, Reese JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20498280", "url": "https://glygen.org/publication/PubMed/20498280" } ] }, { "title": "Ras signaling requires dynamic properties of Ets1 for phosphorylation-enhanced binding to coactivator CBP.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Nelson ML, Kang HS, Lee GM, Blaszczak AG, Lau DK, McIntosh LP, Graves BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559585" } ], "reference": [ { "type": "PubMed", "id": "20534573", "url": "https://glygen.org/publication/PubMed/20534573" } ] }, { "title": "Role of EBAG9 protein in coat protein complex I-dependent glycoprotein maturation and secretion processes in tumor cells.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2010", "authors": "Wolf J, Reimer TA, Schuck S, Ruder C, Gerlach K, Muller EC, Otto A, Dorken B, Rehm A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20570965", "url": "https://glygen.org/publication/PubMed/20570965" } ] }, { "title": "Smad2 protects against TGF-beta/Smad3-mediated renal fibrosis.", "journal": "Journal of the American Society of Nephrology : JASN", "date": "2010", "authors": "Meng XM, Huang XR, Chung AC, Qin W, Shao X, Igarashi P, Ju W, Bottinger EP, Lan HY", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "20595680", "url": "https://glygen.org/publication/PubMed/20595680" } ] }, { "title": "Regulation of notch1 signaling by nrf2: implications for tissue regeneration.", "journal": "Science signaling", "date": "2010-07-13", "authors": "Wakabayashi Nobunao, Shin Soona, Slocum Stephen L, Agoston Elin S, Wakabayashi Junko, Kwak Mi-Kyoung, Misra Vikas, Biswal Shyam, Yamamoto Masayuki, Kensler Thomas W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818030", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818030" } ], "reference": [ { "type": "PubMed", "id": "20628156", "url": "https://glygen.org/publication/PubMed/20628156" } ] }, { "title": "Quantification of O-glycosylation stoichiometry and dynamics using resolvable mass tags.", "journal": "Nature chemical biology", "date": "2010", "authors": "Rexach JE, Rogers CJ, Yu SH, Tao J, Sun YE, Hsieh-Wilson LC", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "20657584", "url": "https://glygen.org/publication/PubMed/20657584" } ] }, { "title": "The histone demethylase JMJD2B is regulated by estrogen receptor alpha and hypoxia, and is a key mediator of estrogen induced growth.", "journal": "Cancer research", "date": "2010", "authors": "Yang J, Jubb AM, Pike L, Buffa FM, Turley H, Baban D, Leek R, Gatter KC, Ragoussis J, Harris AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20682797", "url": "https://glygen.org/publication/PubMed/20682797" } ] }, { "title": "Elevated O-linked N-acetylglucosamine correlated with reduced Sp1 cooperative DNA binding with its collaborating factors in vivo.", "journal": "Bioscience, biotechnology, and biochemistry", "date": "2010", "authors": "Lim K, Chang HI", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "20699577", "url": "https://glygen.org/publication/PubMed/20699577" } ] }, { "title": "Expression and regulation of GPAT isoforms in cultured human keratinocytes and rodent epidermis.", "journal": "Journal of lipid research", "date": "2010", "authors": "Lu B, Jiang YJ, Kim P, Moser A, Elias PM, Grunfeld C, Feingold KR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "20719759", "url": "https://glygen.org/publication/PubMed/20719759" } ] }, { "title": "Sp1 phosphorylation is involved in myelin basic protein gene transcription.", "journal": "Journal of neuroscience research", "date": "2010", "authors": "Guo L, Eviatar-Ribak T, Miskimins R", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" } ], "reference": [ { "type": "PubMed", "id": "20882567", "url": "https://glygen.org/publication/PubMed/20882567" } ] }, { "title": "ELOVL1 production of C24 acyl-CoAs is linked to C24 sphingolipid synthesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Ohno Y, Suto S, Yamanaka M, Mizutani Y, Mitsutake S, Igarashi Y, Sassa T, Kihara A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "20937905", "url": "https://glygen.org/publication/PubMed/20937905" } ] }, { "title": "Transforming growth factor-beta-inducible early response gene 1 is a novel substrate for atypical protein kinase Cs.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2011", "authors": "Alemu EA, Sjottem E, Outzen H, Larsen KB, Holm T, Bjorkoy G, Johansen T", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" } ], "reference": [ { "type": "PubMed", "id": "20953893", "url": "https://glygen.org/publication/PubMed/20953893" } ] }, { "title": "Mithramycin A suppresses expression of the human melanoma-associated gene ABCB8.", "journal": "Molecular genetics and genomics : MGG", "date": "2011", "authors": "Sachrajda I, Ratajewski M", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "reference": [ { "type": "PubMed", "id": "21046154", "url": "https://glygen.org/publication/PubMed/21046154" } ] }, { "title": "Stress-induced expression of the p75 neurotrophin receptor is regulated by O-GlcNAcylation of the Sp1 transcription factor.", "journal": "Journal of neurochemistry", "date": "2011", "authors": "Kommaddi RP, Dickson KM, Barker PA", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "21105874", "url": "https://glygen.org/publication/PubMed/21105874" } ] }, { "title": "Histone H3K27ac separates active from poised enhancers and predicts developmental state.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Creyghton MP, Cheng AW, Welstead GG, Kooistra T, Carey BW, Steine EJ, Hanna J, Lodato MA, Frampton GM, Sharp PA, Boyer LA, Young RA, Jaenisch R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21106759", "url": "https://glygen.org/publication/PubMed/21106759" } ] }, { "title": "FOXA1 is a key determinant of estrogen receptor function and endocrine response.", "journal": "Nature genetics", "date": "2011", "authors": "Hurtado A, Holmes KA, Ross-Innes CS, Schmidt D, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21151129", "url": "https://glygen.org/publication/PubMed/21151129" } ] }, { "title": "The human U1 snRNA promoter correctly initiates transcription in vitro and is activated by PSE1.", "journal": "Genes & development", "date": "1990", "authors": "Gunderson SI, Knuth MW, Burgess RR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "2125285", "url": "https://glygen.org/publication/PubMed/2125285" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "Histone demethylase JMJD2B functions as a co-factor of estrogen receptor in breast cancer proliferation and mammary gland development.", "journal": "PloS one", "date": "2011", "authors": "Kawazu M, Saso K, Tong KI, McQuire T, Goto K, Son DO, Wakeham A, Miyagishi M, Mak TW, Okada H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21445275", "url": "https://glygen.org/publication/PubMed/21445275" } ] }, { "title": "Intracellular estrogen receptor-binding fragment-associated antigen 9 exerts in vivo tumor-promoting effects via its coiled-coil region.", "journal": "International journal of oncology", "date": "2011", "authors": "Maeyama Y, Otsu M, Kubo S, Yamano T, Iimura Y, Onodera M, Kondo S, Sakiyama Y, Ariga T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21573489", "url": "https://glygen.org/publication/PubMed/21573489" } ] }, { "title": "Combining high-energy C-trap dissociation and electron transfer dissociation for protein O-GlcNAc modification site assignment.", "journal": "Journal of proteome research", "date": "2011", "authors": "Zhao P, Viner R, Teo CF, Boons GJ, Horn D, Wells L", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "21740066", "url": "https://glygen.org/publication/PubMed/21740066" } ] }, { "title": "Cooperative transcriptional activation by Klf4, Meis2, and Pbx1.", "journal": "Mol. Cell. Biol.", "date": "2011", "authors": "Bjerke GA, Hyman-Walsh C, Wotton D", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "reference": [ { "type": "PubMed", "id": "21746878", "url": "https://glygen.org/publication/PubMed/21746878" } ] }, { "title": "Cellular content of UDP-N-acetylhexosamines controls hyaluronan synthase 2 expression and correlates with O-linked N-acetylglucosamine modification of transcription factors YY1 and SP1.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Jokela TA, Makkonen KM, Oikari S, Karna R, Koli E, Hart GW, Tammi RH, Carlberg C, Tammi MI", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "21795679", "url": "https://glygen.org/publication/PubMed/21795679" } ] }, { "title": "Identification of a novel Sp1 splice variant as a strong transcriptional activator.", "journal": "Biochemical and biophysical research communications", "date": "2011-08-19", "authors": "Infantino Vittoria, Convertini Paolo, Iacobazzi Francesco, Pisano Isabella, Scarcia Pasquale, Iacobazzi Vito", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "reference": [ { "type": "PubMed", "id": "21798247", "url": "https://glygen.org/publication/PubMed/21798247" } ] }, { "title": "Strong association between c-myb and oestrogen-receptor expression in human breast cancer.", "journal": "Oncogene", "date": "1990", "authors": "Guerin M, Sheng ZM, Andrieu N, Riou G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "2181374", "url": "https://glygen.org/publication/PubMed/2181374" } ] }, { "title": "Estrogen induces c-myc gene expression via an upstream enhancer activated by the estrogen receptor and the AP-1 transcription factor.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2011", "authors": "Wang C, Mayer JA, Mazumdar A, Fertuck K, Kim H, Brown M, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21835891", "url": "https://glygen.org/publication/PubMed/21835891" } ] }, { "title": "Cellular reprogramming by the conjoint action of ERalpha, FOXA1, and GATA3 to a ligand-inducible growth state.", "journal": "Molecular systems biology", "date": "2011", "authors": "Kong SL, Li G, Loh SL, Sung WK, Liu ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21878914", "url": "https://glygen.org/publication/PubMed/21878914" } ] }, { "title": "FOXA1: master of steroid receptor function in cancer.", "journal": "The EMBO journal", "date": "2011", "authors": "Augello MA, Hickey TE, Knudsen KE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21934649", "url": "https://glygen.org/publication/PubMed/21934649" } ] }, { "title": "Gene regulation by cohesin in cancer: is the ring an unexpected party to proliferation?", "journal": "Molecular cancer research : MCR", "date": "2011", "authors": "Rhodes JM, McEwan M, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21940756", "url": "https://glygen.org/publication/PubMed/21940756" } ] }, { "title": "Pioneer transcription factors: establishing competence for gene expression.", "journal": "Genes & development", "date": "2011", "authors": "Zaret KS, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22056668", "url": "https://glygen.org/publication/PubMed/22056668" } ] }, { "title": "Ser7 phosphorylation of the CTD recruits the RPAP2 Ser5 phosphatase to snRNA genes.", "journal": "Molecular cell", "date": "2012", "authors": "Egloff S, Zaborowska J, Laitem C, Kiss T, Murphy S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "22137580", "url": "https://glygen.org/publication/PubMed/22137580" } ] }, { "title": "ZEB2 upregulates integrin \u03b15 expression through cooperation with Sp1 to induce invasion during epithelial-mesenchymal transition of human cancer cells.", "journal": "Carcinogenesis", "date": "2012-03", "authors": "Nam Eun-Hee, Lee Yunhee, Park Young-Kyu, Lee Jung Weon, Kim Semi", "evidence": [ { "database": "Reactome", "id": "R-HSA-9762293", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9762293" } ], "reference": [ { "type": "PubMed", "id": "22227038", "url": "https://glygen.org/publication/PubMed/22227038" } ] }, { "title": "Control of the RNA polymerase II phosphorylation state in promoter regions by CTD interaction domain-containing proteins RPRD1A and RPRD1B.", "journal": "Transcription", "date": "2011", "authors": "Ni Z, Olsen JB, Guo X, Zhong G, Ruan ED, Marcon E, Young P, Guo H, Li J, Moffat J, Emili A, Greenblatt JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "22231121", "url": "https://glygen.org/publication/PubMed/22231121" } ] }, { "title": "snRNA 3' end formation requires heterodimeric association of integrator subunits.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Albrecht TR, Wagner EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "22252320", "url": "https://glygen.org/publication/PubMed/22252320" } ] }, { "title": "Extensive promoter-centered chromatin interactions provide a topological basis for transcription regulation.", "journal": "Cell", "date": "2012", "authors": "Li G, Ruan X, Auerbach RK, Sandhu KS, Zheng M, Wang P, Poh HM, Goh Y, Lim J, Zhang J, Sim HS, Peh SQ, Mulawadi FH, Ong CT, Orlov YL, Hong S, Zhang Z, Landt S, Raha D, Euskirchen G, Wei CL, Ge W, Wang H, Davis C, Fisher-Aylor KI, Mortazavi A, Gerstein M, Gingeras T, Wold B, Sun Y, Fullwood MJ, Cheung E, Liu E, Sung WK, Snyder M, Ruan Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22265404", "url": "https://glygen.org/publication/PubMed/22265404" } ] }, { "title": "Nrf2 protein up-regulates antiapoptotic protein Bcl-2 and prevents cellular apoptosis.", "journal": "The Journal of biological chemistry", "date": "2012-03-23", "authors": "Niture Suryakant K, Jaiswal Anil K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818030", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818030" } ], "reference": [ { "type": "PubMed", "id": "22275372", "url": "https://glygen.org/publication/PubMed/22275372" } ] }, { "title": "Impaired transforming growth factor-beta (TGF-beta) transcriptional activity and cell proliferation control of a menin in-frame deletion mutant associated with multiple endocrine neoplasia type 1 (MEN1).", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Canaff L, Vanbellinghen JF, Kaji H, Goltzman D, Hendy GN", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "22275377", "url": "https://glygen.org/publication/PubMed/22275377" } ] }, { "title": "A novel TBP-TAF complex on RNA polymerase II-transcribed snRNA genes.", "journal": "Transcription", "date": "2012", "authors": "Zaborowska J, Taylor A, Roeder RG, Murphy S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "22441827", "url": "https://glygen.org/publication/PubMed/22441827" } ] }, { "title": "Estrogen receptor-alpha recruits P-TEFb to overcome transcriptional pausing in intron 1 of the MYB gene.", "journal": "Nucleic acids research", "date": "2012", "authors": "Mitra P, Pereira LA, Drabsch Y, Ramsay RG, Gonda TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22492511", "url": "https://glygen.org/publication/PubMed/22492511" } ] }, { "title": "Non-overlapping progesterone receptor cistromes contribute to cell-specific transcriptional outcomes.", "journal": "PloS one", "date": "2012", "authors": "Clarke CL, Graham JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22545144", "url": "https://glygen.org/publication/PubMed/22545144" } ] }, { "title": "Identification and functional characterization of human glycerol-3-phosphate acyltransferase 1 gene promoters.", "journal": "Biochemical and biophysical research communications", "date": "2012", "authors": "Harada N, Fujimoto E, Okuyama M, Sakaue H, Nakaya Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "22634312", "url": "https://glygen.org/publication/PubMed/22634312" } ] }, { "title": "The elements of human cyclin D1 promoter and regulation involved.", "journal": "Clinical epigenetics", "date": "2011", "authors": "Guo ZY, Hao XH, Tan FF, Pei X, Shang LM, Jiang XL, Yang F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22704330", "url": "https://glygen.org/publication/PubMed/22704330" } ] }, { "title": "The transcription factor Sp1 is responsible for aging-dependent altered nucleocytoplasmic trafficking.", "journal": "Aging cell", "date": "2012", "authors": "Kim SY, Kang HT, Han JA, Park SC", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "23013401", "url": "https://glygen.org/publication/PubMed/23013401" } ] }, { "title": "Cohesin is required for activation of MYC by estradiol.", "journal": "PloS one", "date": "2012", "authors": "McEwan MV, Eccles MR, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23145106", "url": "https://glygen.org/publication/PubMed/23145106" } ] }, { "title": "Genomic study of RNA polymerase II and III SNAPc-bound promoters reveals a gene transcribed by both enzymes and a broad use of common activators.", "journal": "PLoS genetics", "date": "2012", "authors": "James Faresse N, Canella D, Praz V, Michaud J, Romascano D, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "23166507", "url": "https://glygen.org/publication/PubMed/23166507" } ] }, { "title": "GATA3 acts upstream of FOXA1 in mediating ESR1 binding by shaping enhancer accessibility.", "journal": "Genome research", "date": "2013", "authors": "Theodorou V, Stark R, Menon S, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23172872", "url": "https://glygen.org/publication/PubMed/23172872" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Cooperating transcription factors mediate the function of estrogen receptor.", "journal": "Chromosoma", "date": "2013", "authors": "Fiorito E, Katika MR, Hurtado A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23192763", "url": "https://glygen.org/publication/PubMed/23192763" } ] }, { "title": "Nrf2-induced antiapoptotic Bcl-xL protein enhances cell survival and drug resistance.", "journal": "Free radical biology & medicine", "date": "2013-04", "authors": "Niture Suryakant K, Jaiswal Anil K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818030", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818030" } ], "reference": [ { "type": "PubMed", "id": "23275004", "url": "https://glygen.org/publication/PubMed/23275004" } ] }, { "title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.", "journal": "Journal of proteome research", "date": "2013", "authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "23301498", "url": "https://glygen.org/publication/PubMed/23301498" } ] }, { "title": "Oxygen-dependent expression of cytochrome c oxidase subunit 4-2 gene expression is mediated by transcription factors RBPJ, CXXC5 and CHCHD2.", "journal": "Nucleic acids research", "date": "2013", "authors": "Aras S, Pak O, Sommer N, Finley R Jr, Huttemann M, Weissmann N, Grossman LI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23303788", "url": "https://glygen.org/publication/PubMed/23303788" } ] }, { "title": "Endogenous purification reveals GREB1 as a key estrogen receptor regulatory factor.", "journal": "Cell reports", "date": "2013", "authors": "Mohammed H, D'Santos C, Serandour AA, Ali HR, Brown GD, Atkins A, Rueda OM, Holmes KA, Theodorou V, Robinson JL, Zwart W, Saadi A, Ross-Innes CS, Chin SF, Menon S, Stingl J, Palmieri C, Caldas C, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23403292", "url": "https://glygen.org/publication/PubMed/23403292" } ] }, { "title": "The lysine demethylase, KDM4B, is a key molecule in androgen receptor signalling and turnover.", "journal": "Nucleic acids research", "date": "2013", "authors": "Coffey K, Rogerson L, Ryan-Munden C, Alkharaif D, Stockley J, Heer R, Sahadevan K, O'Neill D, Jones D, Darby S, Staller P, Mantilla A, Gaughan L, Robson CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23435229", "url": "https://glygen.org/publication/PubMed/23435229" } ] }, { "title": "KDM4B is a master regulator of the estrogen receptor signalling cascade.", "journal": "Nucleic acids research", "date": "2013", "authors": "Gaughan L, Stockley J, Coffey K, O'Neill D, Jones DL, Wade M, Wright J, Moore M, Tse S, Rogerson L, Robson CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23723241", "url": "https://glygen.org/publication/PubMed/23723241" } ] }, { "title": "CXXC5 Associates with Smads to Mediate TNF-alpha Induced Apoptosis.", "journal": "Current molecular medicine", "date": "2013", "authors": "Wang X, Liao P, Fan X, Wan Y, Wang Y, Li Y, Jiang Z, Ye X, Mo X, Ocorr K, Deng Y, Wu X, Yuan W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23906331", "url": "https://glygen.org/publication/PubMed/23906331" } ] }, { "title": "The little elongation complex functions at initiation and elongation phases of snRNA gene transcription.", "journal": "Molecular cell", "date": "2013", "authors": "Hu D, Smith ER, Garruss AS, Mohaghegh N, Varberg JM, Lin C, Jackson J, Gao X, Saraf A, Florens L, Washburn MP, Eissenberg JC, Shilatifard A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "23932780", "url": "https://glygen.org/publication/PubMed/23932780" } ] }, { "title": "Human snRNA genes use polyadenylation factors to promote efficient transcription termination.", "journal": "Nucleic acids research", "date": "2014", "authors": "O'Reilly D, Kuznetsova OV, Laitem C, Zaborowska J, Dienstbier M, Murphy S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "24097444", "url": "https://glygen.org/publication/PubMed/24097444" } ] }, { "title": "Triptolide-induced cell death in pancreatic cancer is mediated by O-GlcNAc modification of transcription factor Sp1.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Banerjee S, Sangwan V, McGinn O, Chugh R, Dudeja V, Vickers SM, Saluja AK", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "24129563", "url": "https://glygen.org/publication/PubMed/24129563" } ] }, { "title": "ZEB2-Sp1 cooperation induces invasion by upregulating cadherin-11 and integrin \u03b15 expression.", "journal": "Carcinogenesis", "date": "2014-02", "authors": "Nam Eun-Hee, Lee Yunhee, Zhao Xue-Feng, Park Young-Kyu, Lee Jung Weon, Kim Semi", "evidence": [ { "database": "Reactome", "id": "R-HSA-9762293", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9762293" } ], "reference": [ { "type": "PubMed", "id": "24130169", "url": "https://glygen.org/publication/PubMed/24130169" } ] }, { "title": "Increased RCAS1 expression is associated with advanced histopathological stage and poor prognosis in patients with gastric adenocarcinoma.", "journal": "Disease markers", "date": "2013", "authors": "Giaginis C, Efkarpidis T, Alexandrou P, Patsouris E, Kouraklis G, Theocharis S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24167369", "url": "https://glygen.org/publication/PubMed/24167369" } ] }, { "title": "Nuclear receptor-mediated cell-autonomous oscillatory expression of the circadian transcription factor, neuronal PAS domain protein 2 (NPAS2).", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Matsumura R, Matsubara C, Node K, Takumi T, Akashi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "24196956", "url": "https://glygen.org/publication/PubMed/24196956" } ] }, { "title": "CBC-ARS2 stimulates 3'-end maturation of multiple RNA families and favors cap-proximal processing.", "journal": "Nature structural & molecular biology", "date": "2013", "authors": "Hallais M, Pontvianne F, Andersen PR, Clerici M, Lener D, Benbahouche Nel H, Gostan T, Vandermoere F, Robert MC, Cusack S, Verheggen C, Jensen TH, Bertrand E", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "24270878", "url": "https://glygen.org/publication/PubMed/24270878" } ] }, { "title": "An H2A histone isotype regulates estrogen receptor target genes by mediating enhancer-promoter-3'-UTR interactions in breast cancer cells.", "journal": "Nucleic acids research", "date": "2014", "authors": "Su CH, Tzeng TY, Cheng C, Hsu MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24371278", "url": "https://glygen.org/publication/PubMed/24371278" } ] }, { "title": "NRF2-mediated Notch pathway activation enhances hematopoietic reconstitution following myelosuppressive radiation.", "journal": "The Journal of clinical investigation", "date": "2014-02", "authors": "Kim Jung-Hyun, Thimmulappa Rajesh K, Kumar Vineet, Cui Wanchang, Kumar Sarvesh, Kombairaju Ponvijay, Zhang Hao, Margolick Joseph, Matsui William, Macvittie Thomas, Malhotra Sanjay V, Biswal Shyam", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818030", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818030" } ], "reference": [ { "type": "PubMed", "id": "24463449", "url": "https://glygen.org/publication/PubMed/24463449" } ] }, { "title": "Role for high-glucose-induced protein O-GlcNAcylation in stimulating cardiac fibroblast collagen synthesis.", "journal": "American journal of physiology. Cell physiology", "date": "2014", "authors": "Aguilar H, Fricovsky E, Ihm S, Schimke M, Maya-Ramos L, Aroonsakool N, Ceballos G, Dillmann W, Villarreal F, Ramirez-Sanchez I", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "24553187", "url": "https://glygen.org/publication/PubMed/24553187" } ] }, { "title": "Identification of miR-26 as a key mediator of estrogen stimulated cell proliferation by targeting CHD1, GREB1 and KPNA2.", "journal": "Breast cancer research : BCR", "date": "2014", "authors": "Tan S, Ding K, Li R, Zhang W, Li G, Kong X, Qian P, Lobie PE, Zhu T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24735615", "url": "https://glygen.org/publication/PubMed/24735615" } ] }, { "title": "Regulation of keratinocyte differentiation by O-GlcNAcylation.", "journal": "Journal of dermatological science", "date": "2014", "authors": "Sohn KC, Lee EJ, Shin JM, Lim EH, No Y, Lee JY, Yoon TY, Lee YH, Im M, Lee Y, Seo YJ, Lee JH, Kim CD", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "24802710", "url": "https://glygen.org/publication/PubMed/24802710" } ] }, { "title": "HOXC8 promotes breast tumorigenesis by transcriptionally facilitating cadherin-11 expression.", "journal": "Oncotarget", "date": "2014-05-15", "authors": "Li Yong, Chao Fengmei, Huang Bei, Liu Dahai, Kim Jaejik, Huang Shuang", "evidence": [ { "database": "Reactome", "id": "R-HSA-9762293", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9762293" } ], "reference": [ { "type": "PubMed", "id": "24810778", "url": "https://glygen.org/publication/PubMed/24810778" } ] }, { "title": "Cohesin in cancer: chromosome segregation and beyond.", "journal": "Nature reviews. Cancer", "date": "2014", "authors": "Losada A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24854081", "url": "https://glygen.org/publication/PubMed/24854081" } ] }, { "title": "Apoptotic function of tumor-associated antigen RCAS1 in oral squamous cell carcinoma.", "journal": "Journal of translational medicine", "date": "2014", "authors": "Tanaka H, Toyoshima T, Sonoda K, Kitamura R, Sasaguri M, Kawano S, Matsubara R, Goto Y, Nakamura S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24885040", "url": "https://glygen.org/publication/PubMed/24885040" } ] }, { "title": "Interplay between nuclear factor erythroid 2-related factor 2 and amphiregulin during mechanical ventilation.", "journal": "American journal of respiratory cell and molecular biology", "date": "2014-11", "authors": "Reiss Lucy Kathleen, Fragoulis Athanassios, Siegl Stephanie, Platen Christopher, Kan Yuet Wai, Nautiyal Jaya, Parker Malcom, Pufe Thomas, Uhlig Ulrike, Martin Christian, Uhlig Stefan, Wruck Christoph Jan", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818030", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818030" } ], "reference": [ { "type": "PubMed", "id": "24921206", "url": "https://glygen.org/publication/PubMed/24921206" } ] }, { "title": "A functional interplay between ZNF217 and estrogen receptor alpha exists in luminal breast cancers.", "journal": "Molecular oncology", "date": "2014", "authors": "Nguyen NT, Vendrell JA, Poulard C, Gyorffy B, Goddard-Leon S, Bieche I, Corbo L, Le Romancer M, Bachelot T, Treilleux I, Cohen PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24973012", "url": "https://glygen.org/publication/PubMed/24973012" } ] }, { "title": "Monitoring protein O-linked beta-N-acetylglucosamine status via metabolic labeling and copper-free click chemistry.", "journal": "Analytical biochemistry", "date": "2014", "authors": "Teo CF, Wells L", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "24995865", "url": "https://glygen.org/publication/PubMed/24995865" } ] }, { "title": "RPRD1A and RPRD1B are human RNA polymerase II C-terminal domain scaffolds for Ser5 dephosphorylation.", "journal": "Nature structural & molecular biology", "date": "2014", "authors": "Ni Z, Xu C, Guo X, Hunter GO, Kuznetsova OV, Tempel W, Marcon E, Zhong G, Guo H, Kuo WW, Li J, Young P, Olsen JB, Wan C, Loppnau P, El Bakkouri M, Senisterra GA, He H, Huang H, Sidhu SS, Emili A, Murphy S, Mosley AL, Arrowsmith CH, Min J, Greenblatt JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "24997600", "url": "https://glygen.org/publication/PubMed/24997600" } ] }, { "title": "Consideration of GREB1 as a potential therapeutic target for hormone-responsive or endocrine-resistant cancers.", "journal": "Expert opinion on therapeutic targets", "date": "2014", "authors": "Hodgkinson KM, Vanderhyden BC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24998469", "url": "https://glygen.org/publication/PubMed/24998469" } ] }, { "title": "Uncovering global SUMOylation signaling networks in a site-specific manner.", "journal": "Nat. Struct. Mol. Biol.", "date": "2014", "authors": "Hendriks IA, D'Souza RC, Yang B, Verlaan-de Vries M, Mann M, Vertegaal AC", "evidence": [ { "database": "UniProtKB", "id": "H3BUU5", "url": "https://www.uniprot.org/uniprot/H3BUU5" } ], "reference": [ { "type": "PubMed", "id": "25218447", "url": "https://glygen.org/publication/PubMed/25218447" } ] }, { "title": "The SARS-coronavirus membrane protein induces apoptosis via interfering with PDK1-PKB/Akt signalling.", "journal": "The Biochemical journal", "date": "2014", "authors": "Tsoi H, Li L, Chen ZS, Lau KF, Tsui SK, Chan HY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9735871", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9735871" } ], "reference": [ { "type": "PubMed", "id": "25271362", "url": "https://glygen.org/publication/PubMed/25271362" } ] }, { "title": "Serum receptor-binding cancer antigen expressed on SiSo cells (RCAS1) as a diagnostic and prognostic marker for non-small cell lung cancer.", "journal": "Tumori", "date": "2014", "authors": "Xu C, Yu LK, Zhang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25296600", "url": "https://glygen.org/publication/PubMed/25296600" } ] }, { "title": "O-GlcNAc modification of transcription factor Sp1 mediates hyperglycemia-induced VEGF-A upregulation in retinal cells.", "journal": "Investigative ophthalmology & visual science", "date": "2014", "authors": "Donovan K, Alekseev O, Qi X, Cho W, Azizkhan-Clifford J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "25352121", "url": "https://glygen.org/publication/PubMed/25352121" } ] }, { "title": "EBAG9 modulates host immune defense against tumor formation and metastasis by regulating cytotoxic activity of T lymphocytes.", "journal": "Oncogenesis", "date": "2014", "authors": "Miyazaki T, Ikeda K, Horie-Inoue K, Kondo T, Takahashi S, Inoue S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25365482", "url": "https://glygen.org/publication/PubMed/25365482" } ] }, { "title": "CXXC5 regulates differentiation of C2C12 myoblasts into myocytes.", "journal": "Journal of muscle research and cell motility", "date": "2014", "authors": "Li G, Ye X, Peng X, Deng Y, Yuan W, Li Y, Mo X, Wang X, Wan Y, Liu X, Chen T, Jiang Z, Fan X, Wu X, Wang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25433557", "url": "https://glygen.org/publication/PubMed/25433557" } ] }, { "title": "The Role of the O-GlcNAc Modification in Regulating Eukaryotic Gene Expression.", "journal": "Current signal transduction therapy", "date": "2010", "authors": "Brimble S, Wollaston-Hayden EE, Teo CF, Morris AC, Wells L", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "P08047", "url": "https://oglcnac.org/atlas/detail/P08047" } ], "reference": [ { "type": "PubMed", "id": "25484640", "url": "https://glygen.org/publication/PubMed/25484640" } ] }, { "title": "Cohesin modulates transcription of estrogen-responsive genes.", "journal": "Biochimica et biophysica acta", "date": "2015", "authors": "Antony J, Dasgupta T, Rhodes JM, McEwan MV, Print CG, O'Sullivan JM, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25542856", "url": "https://glygen.org/publication/PubMed/25542856" } ] }, { "title": "CXXC5 is a negative-feedback regulator of the Wnt/beta-catenin pathway involved in osteoblast differentiation.", "journal": "Cell death and differentiation", "date": "2015", "authors": "Kim HY, Yoon JY, Yun JH, Cho KW, Lee SH, Rhee YM, Jung HS, Lim HJ, Lee H, Choi J, Heo JN, Lee W, No KT, Min D, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25633194", "url": "https://glygen.org/publication/PubMed/25633194" } ] }, { "title": "Two Faces of Cathepsin D: Physiological Guardian Angel and Pathological Demon.", "journal": "Biology and medicine (Aligarh)", "date": "2014", "authors": "Khalkhali-Ellis Z, Hendrix MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25663755", "url": "https://glygen.org/publication/PubMed/25663755" } ] }, { "title": "Expression of RCAS1 correlates with urothelial bladder cancer malignancy.", "journal": "International journal of molecular sciences", "date": "2015", "authors": "Jozwicki W, Brozyna AA, Siekiera J, Slominski AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25674852", "url": "https://glygen.org/publication/PubMed/25674852" } ] }, { "title": "The Integrator complex controls the termination of transcription at diverse classes of gene targets.", "journal": "Cell research", "date": "2015", "authors": "Skaar JR, Ferris AL, Wu X, Saraf A, Khanna KK, Florens L, Washburn MP, Hughes SH, Pagano M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "25675981", "url": "https://glygen.org/publication/PubMed/25675981" } ] }, { "title": "Structure of a biologically active estrogen receptor-coactivator complex on DNA.", "journal": "Molecular cell", "date": "2015", "authors": "Yi P, Wang Z, Feng Q, Pintilie GD, Foulds CE, Lanz RB, Ludtke SJ, Schmid MF, Chiu W, O'Malley BW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25728767", "url": "https://glygen.org/publication/PubMed/25728767" } ] }, { "title": "The Dishevelled-binding protein CXXC5 negatively regulates cutaneous wound healing.", "journal": "The Journal of experimental medicine", "date": "2015", "authors": "Lee SH, Kim MY, Kim HY, Lee YM, Kim H, Nam KA, Roh MR, Min do S, Chung KY, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26056233", "url": "https://glygen.org/publication/PubMed/26056233" } ] }, { "title": "Progesterone receptor modulates ERalpha action in breast cancer.", "journal": "Nature", "date": "2015", "authors": "Mohammed H, Russell IA, Stark R, Rueda OM, Hickey TE, Tarulli GA, Serandour AA, Birrell SN, Bruna A, Saadi A, Menon S, Hadfield J, Pugh M, Raj GV, Brown GD, D'Santos C, Robinson JL, Silva G, Launchbury R, Perou CM, Stingl J, Caldas C, Tilley WD, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26153859", "url": "https://glygen.org/publication/PubMed/26153859" } ] }, { "title": "MiR-26b/KPNA2 axis inhibits epithelial ovarian carcinoma proliferation and metastasis through downregulating OCT4.", "journal": "Oncotarget", "date": "2015", "authors": "Lin J, Zhang L, Huang H, Huang Y, Huang L, Wang J, Huang S, He L, Zhou Y, Jia W, Yun J, Luo R, Zheng M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26204489", "url": "https://glygen.org/publication/PubMed/26204489" } ] }, { "title": "CXXC5 plays a role as a transcription activator for myelin genes on oligodendrocyte differentiation.", "journal": "Glia", "date": "2016", "authors": "Kim MY, Kim HY, Hong J, Kim D, Lee H, Cheong E, Lee Y, Roth J, Kim DG, Min do S, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26462610", "url": "https://glygen.org/publication/PubMed/26462610" } ] }, { "title": "Trefoil factor family peptides--friends or foes?", "journal": "Biomolecular concepts", "date": "2015", "authors": "Busch M, Dunker N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26479350", "url": "https://glygen.org/publication/PubMed/26479350" } ] }, { "title": "O-Linked N-acetylglucosaminylation of Sp1 interferes with Sp1 activation of glycolytic genes.", "journal": "Biochemical and biophysical research communications", "date": "2015", "authors": "Lim K, Yoon BH, Ha CH", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "26499076", "url": "https://glygen.org/publication/PubMed/26499076" } ] }, { "title": "Steroid Receptors Reprogram FoxA1 Occupancy through Dynamic Chromatin Transitions.", "journal": "Cell", "date": "2016", "authors": "Swinstead EE, Miranda TB, Paakinaho V, Baek S, Goldstein I, Hawkins M, Karpova TS, Ball D, Mazza D, Lavis LD, Grimm JB, Morisaki T, Grontved L, Presman DM, Hager GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "27062924", "url": "https://glygen.org/publication/PubMed/27062924" } ] }, { "title": "Activation of AKT pathway by Nrf2/PDGFA feedback loop contributes to HCC progression.", "journal": "Oncotarget", "date": "2016-10-04", "authors": "Liu Danyang, Zhang Yonglong, Wei Yingze, Liu Guoyuan, Liu Yufeng, Gao Qiongmei, Zou Liping, Zeng Wenjiao, Zhang Nong", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818030", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818030" } ], "reference": [ { "type": "PubMed", "id": "27588483", "url": "https://glygen.org/publication/PubMed/27588483" } ] }, { "title": "Global Analysis of O-GlcNAc Glycoproteins in Activated Human T Cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2016", "authors": "Lund PJ, Elias JE, Davis MM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "27655845", "url": "https://glygen.org/publication/PubMed/27655845" } ] }, { "title": "Estradiol-Estrogen Receptor alpha Mediates the Expression of the CXXC5 Gene through the Estrogen Response Element-Dependent Signaling Pathway.", "journal": "Scientific reports", "date": "2016", "authors": "Yasar P, Ayaz G, Muyan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "27886276", "url": "https://glygen.org/publication/PubMed/27886276" } ] }, { "title": "Western blot data using two distinct anti-O-GlcNAc monoclonal antibodies showing unique glycosylation status on cellular proteins under 2-deoxy-d-glucose treatment.", "journal": "Data in brief", "date": "2017", "authors": "Okuda T", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "28054006", "url": "https://glygen.org/publication/PubMed/28054006" } ] }, { "title": "Synthesis of a Highly Azide-Reactive and Thermosensitive Biofunctional Reagent for Efficient Enrichment and Large-Scale Identification of O-GlcNAc Proteins by Mass Spectrometry.", "journal": "Analytical chemistry", "date": "2017", "authors": "Zhang W, Liu T, Dong H, Bai H, Tian F, Shi Z, Chen M, Wang J, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "28510447", "url": "https://glygen.org/publication/PubMed/28510447" } ] }, { "title": "Membrane and Nuclear Estrogen Receptor Alpha Actions: From Tissue Specificity to Medical Implications.", "journal": "Physiological reviews", "date": "2017", "authors": "Arnal JF, Lenfant F, Metivier R, Flouriot G, Henrion D, Adlanmerini M, Fontaine C, Gourdy P, Chambon P, Katzenellenbogen B, Katzenellenbogen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "28539435", "url": "https://glygen.org/publication/PubMed/28539435" } ] }, { "title": "Estrogen-responsive element of the human pS2 gene is an imperfectly palindromic sequence.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Berry M, Nunez AM, Chambon P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "2919170", "url": "https://glygen.org/publication/PubMed/2919170" } ] }, { "title": "TGF-beta1 up-regulates cadherin-11 expression through Snail: A potential mechanism for human trophoblast cell differentiation.", "journal": "Cellular signalling", "date": "2018", "authors": "Cheng JC, Yi Y, Chang HM, Leung PCK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9762293", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9762293" } ], "reference": [ { "type": "PubMed", "id": "29269046", "url": "https://glygen.org/publication/PubMed/29269046" } ] }, { "title": "Interleukin enhancer-binding factor 3 and HOXC8 co-activate cadherin 11 transcription to promote breast cancer cells proliferation and migration.", "journal": "Oncotarget", "date": "2017-12-08", "authors": "Zhang Yang, Yang Chenchen, Zhang Mingsheng, Liu Houli, Gong Chen, Zhang Jie, Xu Shanshan, Zou Jin, Kai Yuanzhong, Li Yong", "evidence": [ { "database": "Reactome", "id": "R-HSA-9762293", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9762293" } ], "reference": [ { "type": "PubMed", "id": "29296180", "url": "https://glygen.org/publication/PubMed/29296180" } ] }, { "title": "Mapping and Quantification of Over 2000 O-linked Glycopeptides in Activated Human T Cells with Isotope-Targeted Glycoproteomics (Isotag).", "journal": "Molecular & cellular proteomics : MCP", "date": "2018", "authors": "Woo CM, Lund PJ, Huang AC, Davis MM, Bertozzi CR, Pitteri SJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" }, { "database": "O-GlcNAc Atlas", "id": "P08047", "url": "https://oglcnac.org/atlas/detail/P08047" }, { "database": "GlyGen", "id": "GLY_000142", "url": "https://data.glygen.org/GLY_000142" } ], "reference": [ { "type": "PubMed", "id": "29351928", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "title": "Cap trimethylation of U snRNA is cytoplasmic and dependent on U snRNP protein binding.", "journal": "Cell", "date": "1986", "authors": "Mattaj IW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "2944599", "url": "https://glygen.org/publication/PubMed/2944599" } ] }, { "title": "FOXF1 Inhibits Pulmonary Fibrosis by Preventing CDH2-CDH11 Cadherin Switch in Myofibroblasts.", "journal": "Cell reports", "date": "2018", "authors": "Black M, Milewski D, Le T, Ren X, Xu Y, Kalinichenko VV, Kalin TV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9762293", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9762293" } ], "reference": [ { "type": "PubMed", "id": "29642003", "url": "https://glygen.org/publication/PubMed/29642003" } ] }, { "title": "Combinatorial regulation of hepatic cytoplasmic signaling and nuclear transcriptional events by the OGT/REV-ERBalpha complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2018", "authors": "Berthier A, Vinod M, Porez G, Steenackers A, Alexandre J, Yamakawa N, Gheeraert C, Ploton M, Marechal X, Dubois-Chevalier J, Hovasse A, Schaeffer-Reiss C, Cianferani S, Rolando C, Bray F, Duez H, Eeckhoute J, Lefebvre T, Staels B, Lefebvre P", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "30397120", "url": "https://glygen.org/publication/PubMed/30397120" } ] }, { "title": "Transcriptional regulation of c-myc oncogene expression by estrogen in hormone-responsive human breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Dubik D, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3045126", "url": "https://glygen.org/publication/PubMed/3045126" } ] }, { "title": "The evolution of the 9aaTAD domain in Sp2 proteins: inactivation with valines and intron reservoirs.", "journal": "Cell. Mol. Life Sci.", "date": "2020", "authors": "Piskacek Martin, Havelka Marek, Jendruchova Kristina, Knight Andrea, Keegan Liam P", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "reference": [ { "type": "PubMed", "id": "31375868", "url": "https://glygen.org/publication/PubMed/31375868" } ] }, { "title": "O-glycosylation of eukaryotic transcription factors: implications for mechanisms of transcriptional regulation.", "journal": "Cell", "date": "1988", "authors": "Jackson SP, Tjian R", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "GlyConnect", "id": "605", "url": "https://glyconnect.expasy.org/browser/proteins/605" } ], "reference": [ { "type": "PubMed", "id": "3139301", "url": "https://glygen.org/publication/PubMed/3139301" } ] }, { "title": "Analysis of Sp1 in vivo reveals multiple transcriptional domains, including a novel glutamine-rich activation motif.", "journal": "Cell", "date": "1988", "authors": "Courey A J, Tjian R", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "reference": [ { "type": "PubMed", "id": "3142690", "url": "https://glygen.org/publication/PubMed/3142690" } ] }, { "title": "O-GlcNAc Transferase Regulates Angiogenesis in Idiopathic Pulmonary Arterial Hypertension.", "journal": "International journal of molecular sciences", "date": "2019", "authors": "Barnes JW, Tian L, Krick S, Helton ES, Denson RS, Comhair SAA, Dweik RA", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "31847126", "url": "https://glygen.org/publication/PubMed/31847126" } ] }, { "title": "Glutamine Links Obesity to Inflammation in Human White Adipose Tissue.", "journal": "Cell metabolism", "date": "2020", "authors": "Petrus P, Lecoutre S, Dollet L, Wiel C, Sulen A, Gao H, Tavira B, Laurencikiene J, Rooyackers O, Checa A, Douagi I, Wheelock CE, Arner P, McCarthy M, Bergo MO, Edgar L, Choudhury RP, Aouadi M, Krook A, Ryden M", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "31866443", "url": "https://glygen.org/publication/PubMed/31866443" } ] }, { "title": "TGF-beta1 Increases GDNF Production by Upregulating the Expression of GDNF and Furin in Human Granulosa-Lutein Cells.", "journal": "Cells", "date": "2020", "authors": "Yin J, Chang HM, Yi Y, Yao Y, Leung PCK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796" } ], "reference": [ { "type": "PubMed", "id": "31936902", "url": "https://glygen.org/publication/PubMed/31936902" } ] }, { "title": "Fibrinolytic abnormalities in acute respiratory distress syndrome (ARDS) and versatility of thrombolytic drugs to treat COVID-19.", "journal": "Journal of thrombosis and haemostasis : JTH", "date": "2020", "authors": "Whyte CS, Morrow GB, Mitchell JL, Chowdary P, Mutch NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9735871", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9735871" } ], "reference": [ { "type": "PubMed", "id": "32329246", "url": "https://glygen.org/publication/PubMed/32329246" } ] }, { "title": "Charactering tumor microenvironment reveals stromal-related transcription factors promote tumor carcinogenesis in gastric cancer.", "journal": "Cancer medicine", "date": "2020-07", "authors": "Liu Haining, Ni Shujuan, Wang Hanbo, Zhang Qiongyan, Weng Weiwei", "evidence": [ { "database": "Reactome", "id": "R-HSA-9762293", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9762293" } ], "reference": [ { "type": "PubMed", "id": "32463580", "url": "https://glygen.org/publication/PubMed/32463580" } ] }, { "title": "LLGL1 Regulates Gemcitabine Resistance by Modulating the ERK-SP1-OSMR Pathway in Pancreatic Ductal Adenocarcinoma.", "journal": "Cellular and molecular gastroenterology and hepatology", "date": "2020", "authors": "Zhu YX, Li CH, Li G, Feng H, Xia T, Wong CH, Fung FKC, Tong JH, To KF, Chen R, Chen Y", "evidence": [ { "database": "iPTMnet", "id": "P08047", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047" } ], "reference": [ { "type": "PubMed", "id": "32615164", "url": "https://glygen.org/publication/PubMed/32615164" } ] }, { "title": "A transcriptional arrest mechanism involved in controlling constitutive levels of mouse c-myb mRNA.", "journal": "Oncogene", "date": "1988", "authors": "Watson RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3281094", "url": "https://glygen.org/publication/PubMed/3281094" } ] }, { "title": "Genome-wide CRISPR Screens Reveal Host Factors Critical for SARS-CoV-2 Infection.", "journal": "Cell", "date": "2021", "authors": "Wei J, Alfajaro MM, DeWeirdt PC, Hanna RE, Lu-Culligan WJ, Cai WL, Strine MS, Zhang SM, Graziano VR, Schmitz CO, Chen JS, Mankowski MC, Filler RB, Ravindra NG, Gasque V, de Miguel FJ, Patil A, Chen H, Oguntuyo KY, Abriola L, Surovtseva YV, Orchard RC, Lee B, Lindenbach BD, Politi K, van Dijk D, Kadoch C, Simon MD, Yan Q, Doench JG, Wilen CB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9735871", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9735871" } ], "reference": [ { "type": "PubMed", "id": "33147444", "url": "https://glygen.org/publication/PubMed/33147444" } ] }, { "title": "Isolation of cDNA encoding transcription factor Sp1 and functional analysis of the DNA binding domain.", "journal": "Cell", "date": "1987", "authors": "Kadonaga J T, Carner K R, Masiarz F R, Tjian R", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "reference": [ { "type": "PubMed", "id": "3319186", "url": "https://glygen.org/publication/PubMed/3319186" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "Target protein deglycosylation in living cells by a nanobody-fused split O-GlcNAcase.", "journal": "Nature chemical biology", "date": "2021", "authors": "Ge Y, Ramirez DH, Yang B, D'Souza AK, Aonbangkhen C, Wong S, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "33686291", "url": "https://glygen.org/publication/PubMed/33686291" } ] }, { "title": "NRF2 Enables EGFR Signaling in Melanoma Cells.", "journal": "International journal of molecular sciences", "date": "2021-04-07", "authors": "Kre\u00df Julia Katharina Charlotte, Jessen Christina, Marquardt Andr\u00e9, Hufnagel Anita, Meierjohann Svenja", "evidence": [ { "database": "Reactome", "id": "R-HSA-9818030", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818030" } ], "reference": [ { "type": "PubMed", "id": "33916908", "url": "https://glygen.org/publication/PubMed/33916908" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Regulation of O-Linked N-Acetyl Glucosamine Transferase (OGT) through E6 Stimulation of the Ubiquitin Ligase Activity of E6AP.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Peng K, Liu R, Jia C, Wang Y, Jeong GH, Zhou L, Hu R, Kiyokawa H, Yin J, Zhao B", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "34638625", "url": "https://glygen.org/publication/PubMed/34638625" } ] }, { "title": "Differential expression of c-myb mRNA in murine B lymphomas by a block to transcription elongation.", "journal": "Science (New York, N.Y.)", "date": "1987", "authors": "Bender TP, Thompson CB, Kuehl WM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3498214", "url": "https://glygen.org/publication/PubMed/3498214" } ] }, { "title": "Spatiotemporal Activation of Protein O-GlcNAcylation in Living Cells.", "journal": "Journal of the American Chemical Society", "date": "2022", "authors": "He J, Fan Z, Tian Y, Yang W, Zhou Y, Zhu Q, Zhang W, Qin W, Yi W", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "35138101", "url": "https://glygen.org/publication/PubMed/35138101" } ] }, { "title": "Stimulation of c-myc oncogene expression associated with estrogen-induced proliferation of human breast cancer cells.", "journal": "Cancer research", "date": "1987", "authors": "Dubik D, Dembinski TC, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3677090", "url": "https://glygen.org/publication/PubMed/3677090" } ] }, { "title": "KDM4C-mediated senescence defense is a targetable vulnerability in gastric cancer harboring TP53 mutations.", "journal": "Clinical epigenetics", "date": "2023-10-17", "authors": "Wang Kaiqing, Gong Zhicheng, Chen Yanyan, Zhang Meimei, Wang Suzeng, Yao Surui, Liu Zhihui, Huang Zhaohui, Fei Bojian", "evidence": [ { "database": "RefSeq", "id": "NP_001238754", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001238754" } ], "reference": [ { "type": "PubMed", "id": "37848946", "url": "https://glygen.org/publication/PubMed/37848946" } ] }, { "title": "SP1 transcriptionally upregulates the expression of APOC3 in KGN cells to promote disease progression by regulating TLR2/NF-\u03baB signalling pathway.", "journal": "Endokrynologia Polska", "date": "2023", "authors": "Qi Na, Wen Liyang, Li Shiyan, Li Jia, Feng Cong", "evidence": [ { "database": "RefSeq", "id": "NP_001238754", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001238754" } ], "reference": [ { "type": "PubMed", "id": "37902017", "url": "https://glygen.org/publication/PubMed/37902017" } ] }, { "title": "Over-expression of cFos by the Transcription Factors NFATc2 and Sp1 in Pancreatic Cancer Cells.", "journal": "Anticancer research", "date": "2023-11", "authors": "Malsy Manuela, Graf Bernhard, Bruendl Elisabeth, Maier-Stocker Constantin, Bundscherer Anika", "evidence": [ { "database": "RefSeq", "id": "NP_001238754", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001238754" } ], "reference": [ { "type": "PubMed", "id": "37909980", "url": "https://glygen.org/publication/PubMed/37909980" } ] }, { "title": "Effect of NFATc2- and Sp1-mediated TNFalpha Regulation on the Proliferation and Migration Behavior of Pancreatic Cancer Cells.", "journal": "Cancer genomics & proteomics", "date": "2023-12", "authors": "Malsy Manuela, Graf Bernhard, Bruendl Elisabeth, Maier-Stocker Constantin, Bundscherer Anika", "evidence": [ { "database": "RefSeq", "id": "NP_001238754", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001238754" } ], "reference": [ { "type": "PubMed", "id": "38035702", "url": "https://glygen.org/publication/PubMed/38035702" } ] }, { "title": "SP1-activated USP27X-AS1 promotes hepatocellular carcinoma progression via USP7-mediated AKT stabilisation.", "journal": "Clinical and translational medicine", "date": "2024-01", "authors": "Su Chen, Zhang Haoquan, Mo Jie, Liao Zhibin, Zhang Bixiang, Zhu Peng", "evidence": [ { "database": "RefSeq", "id": "NP_001238754", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001238754" } ], "reference": [ { "type": "PubMed", "id": "38279869", "url": "https://glygen.org/publication/PubMed/38279869" } ] }, { "title": "Transforming p21ras mutants and c-Ets-2 activate the cyclin D1 promoter through distinguishable regions.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Albanese C, Johnson J, Watanabe G, Eklund N, Vu D, Arnold A, Pestell RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7559524", "url": "https://glygen.org/publication/PubMed/7559524" } ] }, { "title": "Human fatty acid synthase: properties and molecular cloning.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Jayakumar A, Tai MH, Huang WY, al-Feel W, Hsu M, Abu-Elheiga L, Chirala SS, Wakil SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "7567999", "url": "https://glygen.org/publication/PubMed/7567999" } ] }, { "title": "ERF: an ETS domain protein with strong transcriptional repressor activity, can suppress ets-associated tumorigenesis and is regulated by phosphorylation during cell cycle and mitogenic stimulation.", "journal": "The EMBO journal", "date": "1995", "authors": "Sgouras DN, Athanasiou MA, Beal GJ Jr, Fisher RJ, Blair DG, Mavrothalassitis GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559585" } ], "reference": [ { "type": "PubMed", "id": "7588608", "url": "https://glygen.org/publication/PubMed/7588608" } ] }, { "title": "Interaction of virion protein Vpr of human immunodeficiency virus type 1 with cellular transcription factor Sp1 and trans-activation of viral long terminal repeat.", "journal": "J. Biol. Chem.", "date": "1995", "authors": "Wang L, Mukherjee S, Jia F, Narayan O, Zhao L J", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "reference": [ { "type": "PubMed", "id": "7592727", "url": "https://glygen.org/publication/PubMed/7592727" } ] }, { "title": "Sterol regulation of fatty acid synthase promoter. Coordinate feedback regulation of two major lipid pathways.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Bennett MK, Lopez JM, Sanchez HB, Osborne TF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "7592729", "url": "https://glygen.org/publication/PubMed/7592729" } ] }, { "title": "Transcriptional regulation by lovastatin and 25-hydroxycholesterol in HepG2 cells and molecular cloning and expression of the cDNA for the human hepatic squalene synthase.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Jiang G, McKenzie TL, Conrad DG, Shechter I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "7685352", "url": "https://glygen.org/publication/PubMed/7685352" } ] }, { "title": "A TBP-TAF complex required for transcription of human snRNA genes by RNA polymerase II and III.", "journal": "Nature", "date": "1995", "authors": "Henry RW, Sadowski CL, Kobayashi R, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "7715707", "url": "https://glygen.org/publication/PubMed/7715707" } ] }, { "title": "Human acetyl-CoA carboxylase: characterization, molecular cloning, and evidence for two isoforms.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Abu-Elheiga L, Jayakumar A, Baldini A, Chirala SS, Wakil SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "7732023", "url": "https://glygen.org/publication/PubMed/7732023" } ] }, { "title": "Human liver mitochondrial carnitine palmitoyltransferase I: characterization of its cDNA and chromosomal localization and partial analysis of the gene.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Britton CH, Schultz RA, Zhang B, Esser V, Foster DW, McGarry JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "7892212", "url": "https://glygen.org/publication/PubMed/7892212" } ] }, { "title": "Partial characterization of a cDNA for human stearoyl-CoA desaturase and changes in its mRNA expression in some normal and malignant tissues.", "journal": "International journal of cancer", "date": "1994", "authors": "Li J, Ding SF, Habib NA, Fermor BF, Wood CB, Gilmour RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "7909540", "url": "https://glygen.org/publication/PubMed/7909540" } ] }, { "title": "Characterization of the proximal estrogen-responsive element of human cathepsin D gene.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1994", "authors": "Augereau P, Miralles F, Cavailles V, Gaudelet C, Parker M, Rochefort H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7935485", "url": "https://glygen.org/publication/PubMed/7935485" } ] }, { "title": "Interaction of proteins with transcriptionally active estrogen receptors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Cavailles V, Dauvois S, Danielian PS, Parker MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7937828", "url": "https://glygen.org/publication/PubMed/7937828" } ] }, { "title": "A human promyelocyte mRNA transiently induced by TPA is homologous to yeast IPP isomerase.", "journal": "Genomics", "date": "1994", "authors": "Xuan JW, Kowalski J, Chambers AF, Denhardt DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "8020941", "url": "https://glygen.org/publication/PubMed/8020941" } ] }, { "title": "Estrogen receptor-Sp1 complexes mediate estrogen-induced cathepsin D gene expression in MCF-7 human breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Krishnan V, Wang X, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8195246", "url": "https://glygen.org/publication/PubMed/8195246" } ] }, { "title": "Estrogen receptor-associated proteins: possible mediators of hormone-induced transcription.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Halachmi S, Marden E, Martin G, MacKay H, Abbondanza C, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8197458", "url": "https://glygen.org/publication/PubMed/8197458" } ] }, { "title": "Common and unique transcription factor requirements of human U1 and U6 snRNA genes.", "journal": "The EMBO journal", "date": "1993", "authors": "Bernues J, Simmen KA, Lewis JD, Gunderson SI, Polycarpou-Schwarz M, Moncollin V, Egly JM, Mattaj IW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "8253082", "url": "https://glygen.org/publication/PubMed/8253082" } ] }, { "title": "Targeting TBP to a non-TATA box cis-regulatory element: a TBP-containing complex activates transcription from snRNA promoters through the PSE.", "journal": "Genes & development", "date": "1993", "authors": "Sadowski CL, Henry RW, Lobo SM, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "8339931", "url": "https://glygen.org/publication/PubMed/8339931" } ] }, { "title": "Cathepsin D gene is controlled by a mixed promoter, and estrogens stimulate only TATA-dependent transcription in breast cancer cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Cavailles V, Augereau P, Rochefort H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8419924", "url": "https://glygen.org/publication/PubMed/8419924" } ] }, { "title": "Ras-mediated phosphorylation of a conserved threonine residue enhances the transactivation activities of c-Ets1 and c-Ets2.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Yang BS, Hauser CA, Henkel G, Colman MS, Van Beveren C, Stacey KJ, Hume DA, Maki RA, Ostrowski MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559585" } ], "reference": [ { "type": "PubMed", "id": "8552081", "url": "https://glygen.org/publication/PubMed/8552081" } ] }, { "title": "The ubiquitously expressed human CYP51 encodes lanosterol 14 alpha-demethylase, a cytochrome P450 whose expression is regulated by oxysterols.", "journal": "Archives of biochemistry and biophysics", "date": "1996", "authors": "Stromstedt M, Rozman D, Waterman MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "8619637", "url": "https://glygen.org/publication/PubMed/8619637" } ] }, { "title": "Molecular cloning and expression of the cDNAs encoding human and yeast mevalonate pyrophosphate decarboxylase.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Toth MJ, Huwyler L", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "8626466", "url": "https://glygen.org/publication/PubMed/8626466" } ] }, { "title": "Transcriptional regulation of squalene epoxidase by sterols and inhibitors in HeLa cells.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Nakamura Y, Sakakibara J, Izumi T, Shibata A, Ono T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "8626488", "url": "https://glygen.org/publication/PubMed/8626488" } ] }, { "title": "The serotonin 1a receptor gene contains a TATA-less promoter that responds to MAZ and Sp1.", "journal": "J. Biol. Chem.", "date": "1996", "authors": "Parks C L, Shenk T", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "reference": [ { "type": "PubMed", "id": "8626793", "url": "https://glygen.org/publication/PubMed/8626793" } ] }, { "title": "The Oct-1 POU-specific domain can stimulate small nuclear RNA gene transcription by stabilizing the basal transcription complex SNAPc.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Mittal V, Cleary MA, Herr W, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "8628262", "url": "https://glygen.org/publication/PubMed/8628262" } ] }, { "title": "A direct role for sterol regulatory element binding protein in activation of 3-hydroxy-3-methylglutaryl coenzyme A reductase gene.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Vallett SM, Sanchez HB, Rosenfeld JM, Osborne TF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "8647822", "url": "https://glygen.org/publication/PubMed/8647822" } ] }, { "title": "Molecular cloning of human phosphomevalonate kinase and identification of a consensus peroxisomal targeting sequence.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Chambliss KL, Slaughter CA, Schreiner R, Hoffmann GF, Gibson KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "8663599", "url": "https://glygen.org/publication/PubMed/8663599" } ] }, { "title": "The transcription factors Sp1 and Oct-1 interact physically to regulate human U2 snRNA gene expression.", "journal": "Nucleic acids research", "date": "1996", "authors": "Strom AC, Forsberg M, Lillhager P, Westin G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "8668525", "url": "https://glygen.org/publication/PubMed/8668525" } ] }, { "title": "Synergistic binding of sterol regulatory element-binding protein and NF-Y to the farnesyl diphosphate synthase promoter is critical for sterol-regulated expression of the gene.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Ericsson J, Jackson SM, Edwards PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "8798690", "url": "https://glygen.org/publication/PubMed/8798690" } ] }, { "title": "p300 is a component of an estrogen receptor coactivator complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Hanstein B, Eckner R, DiRenzo J, Halachmi S, Liu H, Searcy B, Kurokawa R, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8876171", "url": "https://glygen.org/publication/PubMed/8876171" } ] }, { "title": "Molecular cloning and mapping of a human cDNA (SC5DL) encoding a protein homologous to fungal sterol-C5-desaturase.", "journal": "Cytogenetics and cell genetics", "date": "1996", "authors": "Matsushima M, Inazawa J, Takahashi E, Suzumori K, Nakamura Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "8976377", "url": "https://glygen.org/publication/PubMed/8976377" } ] }, { "title": "Staf, a promiscuous activator for enhanced transcription by RNA polymerases II and III.", "journal": "The EMBO journal", "date": "1997", "authors": "Schaub M, Myslinski E, Schuster C, Krol A, Carbon P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "9009278", "url": "https://glygen.org/publication/PubMed/9009278" } ] }, { "title": "Molecular characterization of two mammalian bHLH-PAS domain proteins selectively expressed in the central nervous system.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Zhou YD, Barnard M, Tian H, Li X, Ring HZ, Francke U, Shelton J, Richardson J, Russell DW, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "9012850", "url": "https://glygen.org/publication/PubMed/9012850" } ] }, { "title": "Structures of zinc finger domains from transcription factor Sp1. Insights into sequence-specific protein-DNA recognition.", "journal": "J. Biol. Chem.", "date": "1997", "authors": "Narayan V A, Kriwacki R W, Caradonna J P", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "reference": [ { "type": "PubMed", "id": "9065444", "url": "https://glygen.org/publication/PubMed/9065444" } ] }, { "title": "Mitotic arrest with nocodazole induces selective changes in the level of O-linked N-acetylglucosamine and accumulation of incompletely processed N-glycans on proteins from HT29 cells.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Haltiwanger RS, Philipsberg GA", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "9079710", "url": "https://glygen.org/publication/PubMed/9079710" } ] }, { "title": "Human acetyl-CoA carboxylase 2. Molecular cloning, characterization, chromosomal mapping, and evidence for two isoforms.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Abu-Elheiga L, Almarza-Ortega DB, Baldini A, Wakil SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "9099716", "url": "https://glygen.org/publication/PubMed/9099716" } ] }, { "title": "Reduced O glycosylation of Sp1 is associated with increased proteasome susceptibility.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Han I, Kudlow JE", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "9111324", "url": "https://glygen.org/publication/PubMed/9111324" } ] }, { "title": "Casein kinase II-mediated phosphorylation of the C terminus of Sp1 decreases its DNA binding activity.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Armstrong SA, Barry DA, Leggett RW, Mueller CR", "evidence": [ { "database": "iPTMnet", "id": "P08047-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08047-1" } ], "reference": [ { "type": "PubMed", "id": "9153193", "url": "https://glygen.org/publication/PubMed/9153193" } ] }, { "title": "Differential in vivo activation of the class II and class III snRNA genes by the POU-specific domain of Oct-1.", "journal": "Nucleic acids research", "date": "1997", "authors": "Murphy S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "9153304", "url": "https://glygen.org/publication/PubMed/9153304" } ] }, { "title": "Characterization of a trimeric complex containing Oct-1, SNAPc, and DNA.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Ford E, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "9188510", "url": "https://glygen.org/publication/PubMed/9188510" } ] }, { "title": "Identification of a functional imperfect estrogen-responsive element in the 5'-promoter region of the human cathepsin D gene.", "journal": "Biochemistry", "date": "1997", "authors": "Wang F, Porter W, Xing W, Archer TK, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9201922", "url": "https://glygen.org/publication/PubMed/9201922" } ] }, { "title": "Molecular basis of agonism and antagonism in the oestrogen receptor.", "journal": "Nature", "date": "1997", "authors": "Brzozowski AM, Pike AC, Dauter Z, Hubbard RE, Bonn T, Engstrom O, Ohman L, Greene GL, Gustafsson JA, Carlquist M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9338790", "url": "https://glygen.org/publication/PubMed/9338790" } ] }, { "title": "O glycosylation of an Sp1-derived peptide blocks known Sp1 protein interactions.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Roos MD, Su K, Baker JR, Kudlow JE", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047#ptm_processing" }, { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "9343410", "url": "https://glygen.org/publication/PubMed/9343410" } ] }, { "title": "Nucleosome positioning and transcription-associated chromatin alterations on the human estrogen-responsive pS2 promoter.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Sewack GF, Hansen U", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9388265", "url": "https://glygen.org/publication/PubMed/9388265" } ] }, { "title": "5'-Capping enzymes are targeted to pre-mRNA by binding to the phosphorylated carboxy-terminal domain of RNA polymerase II.", "journal": "Genes & development", "date": "1997", "authors": "McCracken S, Fong N, Rosonina E, Yankulov K, Brothers G, Siderovski D, Hessel A, Foster S, Shuman S, Bentley DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "9407024", "url": "https://glygen.org/publication/PubMed/9407024" } ] }, { "title": "Modulation of O-linked N-acetylglucosamine levels on nuclear and cytoplasmic proteins in vivo using the peptide O-GlcNAc-beta-N-acetylglucosaminidase inhibitor O-(2-acetamido-2-deoxy-D-glucopyranosylidene)amino-N-phenylcarbamate.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Haltiwanger RS, Grove K, Philipsberg GA", "evidence": [ { "database": "O-GlcNAc Database", "id": "P08047", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P08047" } ], "reference": [ { "type": "PubMed", "id": "9452489", "url": "https://glygen.org/publication/PubMed/9452489" } ] }, { "title": "The SV40 capsid protein VP3 cooperates with the cellular transcription factor Sp1 in DNA-binding and in regulating viral promoter activity.", "journal": "J. Mol. Biol.", "date": "1998", "authors": "Gordon-Shaag A, Ben-Nun-Shaul O, Kasamatsu H, Oppenheim A B, Oppenheim A", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "reference": [ { "type": "PubMed", "id": "9466902", "url": "https://glygen.org/publication/PubMed/9466902" } ] }, { "title": "Multiple DNA elements for sterol regulatory element-binding protein and NF-Y are responsible for sterol-regulated transcription of the genes for human 3-hydroxy-3-methylglutaryl coenzyme A synthase and squalene synthase.", "journal": "Journal of biochemistry", "date": "1998", "authors": "Inoue J, Sato R, Maeda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "9604010", "url": "https://glygen.org/publication/PubMed/9604010" } ] }, { "title": "Functional and physical interactions between the estrogen receptor Sp1 and nuclear aryl hydrocarbon receptor complexes.", "journal": "Nucleic acids research", "date": "1998", "authors": "Wang F, Hoivik D, Pollenz R, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9611253", "url": "https://glygen.org/publication/PubMed/9611253" } ] }, { "title": "Mutations in the human sterol delta7-reductase gene at 11q12-13 cause Smith-Lemli-Opitz syndrome.", "journal": "American journal of human genetics", "date": "1998", "authors": "Wassif CA, Maslen C, Kachilele-Linjewile S, Lin D, Linck LM, Connor WE, Steiner RD, Porter FD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "9634533", "url": "https://glygen.org/publication/PubMed/9634533" } ] }, { "title": "c-Myc or cyclin D1 mimics estrogen effects on cyclin E-Cdk2 activation and cell cycle reentry.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Prall OW, Rogan EM, Musgrove EA, Watts CK, Sutherland RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9671459", "url": "https://glygen.org/publication/PubMed/9671459" } ] }, { "title": "ZNF76 and ZNF143 are two human homologs of the transcriptional activator Staf.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Myslinski E, Krol A, Carbon P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "9705341", "url": "https://glygen.org/publication/PubMed/9705341" } ] }, { "title": "Upstream stimulatory factors mediate estrogen receptor activation of the cathepsin D promoter.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1998", "authors": "Xing W, Archer TK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9731700", "url": "https://glygen.org/publication/PubMed/9731700" } ] }, { "title": "The nuclear receptors peroxisome proliferator-activated receptor alpha and Rev-erbalpha mediate the species-specific regulation of apolipoprotein A-I expression by fibrates.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Vu-Dac N, Chopin-Delannoy S, Gervois P, Bonnelye E, Martin G, Fruchart JC, Laudet V, Staels B", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "9748239", "url": "https://glygen.org/publication/PubMed/9748239" } ] }, { "title": "Differential stimulation of cholesterol and unsaturated fatty acid biosynthesis in cells expressing individual nuclear sterol regulatory element-binding proteins.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Pai JT, Guryev O, Brown MS, Goldstein JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2426168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168" } ], "reference": [ { "type": "PubMed", "id": "9748295", "url": "https://glygen.org/publication/PubMed/9748295" } ] }, { "title": "The Oct-1 POU domain activates snRNA gene transcription by contacting a region in the SNAPc largest subunit that bears sequence similarities to the Oct-1 coactivator OBF-1.", "journal": "Genes & development", "date": "1998", "authors": "Ford E, Strubin M, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "9832505", "url": "https://glygen.org/publication/PubMed/9832505" } ] } ], "pathway": [ { "id": "hsa:6667", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:6667", "resource": "KEGG Pathway" }, { "id": "R-HSA-1989781", "name": "PPARA activates gene expression", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781", "resource": "Reactome", "description": "PPARA activates gene expression" }, { "id": "R-HSA-2173796", "name": "SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173796", "resource": "Reactome", "description": "SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription" }, { "id": "R-HSA-2426168", "name": "Activation of gene expression by SREBF (SREBP)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168", "resource": "Reactome", "description": "Activation of gene expression by SREBF (SREBP)" }, { "id": "R-HSA-2559585", "name": "Oncogene Induced Senescence", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559585", "resource": "Reactome", "description": "Oncogene Induced Senescence" }, { "id": "R-HSA-6807505", "name": "RNA polymerase II transcribes snRNA genes", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505", "resource": "Reactome", "description": "RNA polymerase II transcribes snRNA genes" }, { "id": "R-HSA-9018519", "name": "Estrogen-dependent gene expression", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519", "resource": "Reactome", "description": "Estrogen-dependent gene expression" }, { "id": "R-HSA-9735871", "name": "SARS-CoV-1 targets host intracellular signalling and regulatory pathways", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9735871", "resource": "Reactome", "description": "SARS-CoV-1 targets host intracellular signalling and regulatory pathways" }, { "id": "R-HSA-9762293", "name": "Regulation of CDH11 gene transcription", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9762293", "resource": "Reactome", "description": "Regulation of CDH11 gene transcription" }, { "id": "R-HSA-9818030", "name": "NFE2L2 regulating tumorigenic genes", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818030", "resource": "Reactome", "description": "NFE2L2 regulating tumorigenic genes" } ], "orthologs": [ { "uniprot_canonical_ac": "O89090-1", "protein_name": "Transcription factor Sp1", "gene_name": "Sp1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSDQDHSMDEVTAVVKIEKDVGGNNGGSGNGGGAAFSQTRSSSTGSSSSSGGGGGQESQPSPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGNSTNGSNGSESSKNRTVSGGQYVVAATPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIIPNRGSGGNIIAAMPNLLQQAVPLQGLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAGTISSSGSQESSSQPVTSGTAISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTSSGSSGTSSQGQTPQRVGGLQGSDSLNIQQNQTSGGSLQGSQQKEGEQSQQTQQQQILIQPQLVQGGQALQALQAAPLSGQTFTTQAISQETLQNLQLQAVQNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHQLPGLPLAIANTPGDHGTQLGLHGSGGDGIHDETAGGEGENSSDLQPQAGRRTRREACTCPYCKDSEGRASGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCNWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSGAGSEGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVTELQSINISGNGF", "length": 784 }, "evidence": [ { "id": "45928208", "url": "http://www.informatics.jax.org/homology/45928208", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q01714-1", "protein_name": "Transcription factor Sp1", "gene_name": "Sp1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSDQDHSMDEVTAVKIEKGVGGNNGGSGNGGGAAFSQTRSSSTGSSSSSGGGGGQESQPSPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGNSTNGSNGSESSKNRTVSGGQYVVAATPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQGLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAGTISSSGSQESGSQPVTSGTAISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTSSGSSGTSSQGQTSQRVGGLQGSDSLNIQQNQTSGGSLQGSQQKEGEQSQQTQQQQILIQPQLVQGGQALQALQAAPLSGQTFTTQAISQETLQNLQLQAVQNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHQLPGLPLAIANTPGDHGAQLGLHGPGGDGIHDETAGGEEGENSPDPQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCNWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVTELQSINISGNGF", "length": 786 }, "evidence": [ { "id": "45928208", "url": "http://www.informatics.jax.org/homology/45928208", "database": "MGI" }, { "id": "P08047", "url": "https://omabrowser.org/oma/group/P08047/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 17, "go_terms": [ { "name": "positive regulation of vascular endothelial cell proliferation", "id": "GO:1905564", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905564", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "positive regulation of gene expression", "id": "GO:0010628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "cellular response to insulin stimulus", "id": "GO:0032869", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032869", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "positive regulation of amyloid-beta formation", "id": "GO:1902004", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902004", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "regulation of DNA-templated transcription", "id": "GO:0006355", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006355", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "positive regulation of angiogenesis", "id": "GO:0045766", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045766", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "rhythmic process", "id": "GO:0048511", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048511", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "positive regulation of blood vessel endothelial cell migration", "id": "GO:0043536", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043536", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "cellular response to estrogen stimulus", "id": "GO:0071391", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071391", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "response to hydroperoxide", "id": "GO:0033194", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033194", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "cellular response to zinc ion starvation", "id": "GO:0034224", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034224", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "positive regulation of hydrogen sulfide biosynthetic process", "id": "GO:1904828", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904828", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "positive regulation by host of viral transcription", "id": "GO:0043923", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043923", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "cellular response to wortmannin", "id": "GO:1904568", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904568", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 19, "go_terms": [ { "name": "molecular adaptor activity", "id": "GO:0060090", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060090", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity", "id": "GO:0003700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003700", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "histone deacetylase binding", "id": "GO:0042826", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042826", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "double-stranded DNA binding", "id": "GO:0003690", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003690", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "RNA polymerase II transcription regulatory region sequence-specific DNA binding", "id": "GO:0000977", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000977", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "transcription cis-regulatory region binding", "id": "GO:0000976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000976", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "sequence-specific DNA binding", "id": "GO:0043565", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043565", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "DNA-binding transcription activator activity, RNA polymerase II-specific", "id": "GO:0001228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001228", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "RNA polymerase II-specific DNA-binding transcription factor binding", "id": "GO:0061629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061629", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "bHLH transcription factor binding", "id": "GO:0043425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043425", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "transcription coregulator binding", "id": "GO:0001221", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001221", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "histone acetyltransferase binding", "id": "GO:0035035", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035035", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "sequence-specific double-stranded DNA binding", "id": "GO:1990837", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990837", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "transcription repressor complex", "id": "GO:0017053", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017053", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "euchromatin", "id": "GO:0000791", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000791", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" }, { "name": "protein-DNA complex", "id": "GO:0032993", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032993", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 129, "end_pos": 131, "annotation": "n_glycosylation_sequon" }, { "start_pos": 132, "end_pos": 134, "annotation": "n_glycosylation_sequon" }, { "start_pos": 139, "end_pos": 141, "annotation": "n_glycosylation_sequon" }, { "start_pos": 263, "end_pos": 265, "annotation": "n_glycosylation_sequon" }, { "start_pos": 340, "end_pos": 342, "annotation": "n_glycosylation_sequon" }, { "start_pos": 373, "end_pos": 375, "annotation": "n_glycosylation_sequon" }, { "start_pos": 499, "end_pos": 501, "annotation": "n_glycosylation_sequon" }, { "start_pos": 533, "end_pos": 535, "annotation": "n_glycosylation_sequon" }, { "start_pos": 779, "end_pos": 781, "annotation": "n_glycosylation_sequon" }, { "start_pos": 79, "end_pos": 81, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Acetylated. Acetylation/deacetylation events affect transcriptional activity. Deacetylation leads to an increase in the expression the 12(s)-lipooxygenase gene though recruitment of p300 to the promoter.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "16478997", "url": "https://glygen.org/publication/PubMed/16478997" } ] }, { "annotation": "Phosphorylated on multiple serine and threonine residues. Phosphorylation is coupled to ubiquitination, sumoylation and proteolytic processing. Phosphorylation on Ser-59 enhances proteolytic cleavage. Phosphorylation on Ser-7 enhances ubiquitination and protein degradation. Hyperphosphorylation on Ser-101 in response to DNA damage has no effect on transcriptional activity. MAPK1/MAPK3-mediated phosphorylation on Thr-453 and Thr-739 enhances VEGF transcription but, represses FGF2-triggered PDGFR-alpha transcription. Also implicated in the repression of RECK by ERBB2. Hyperphosphorylated on Thr-278 and Thr-739 during mitosis by MAPK8 shielding SP1 from degradation by the ubiquitin-dependent pathway. Phosphorylated in the zinc-finger domain by calmodulin-activated PKCzeta. Phosphorylation on Ser-641 by PKCzeta is critical for TSA-activated LHR gene expression through release of its repressor, p107. Phosphorylation on Thr-668, Ser-670 and Thr-681 is stimulated by angiotensin II via the AT1 receptor inducing increased binding to the PDGF-D promoter. This phosphorylation is increased in injured artey wall. Ser-59 and Thr-681 can both be dephosphorylated by PP2A during cell-cycle interphase. Dephosphorylation on Ser-59 leads to increased chromatin association during interphase and increases the transcriptional activity. On insulin stimulation, sequentially glycosylated and phosphorylated on several C-terminal serine and threonine residues.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "17049555", "url": "https://glygen.org/publication/PubMed/17049555" }, { "database": "PubMed", "id": "18239466", "url": "https://glygen.org/publication/PubMed/18239466" }, { "database": "PubMed", "id": "18619531", "url": "https://glygen.org/publication/PubMed/18619531" }, { "database": "PubMed", "id": "18258854", "url": "https://glygen.org/publication/PubMed/18258854" }, { "database": "PubMed", "id": "11904305", "url": "https://glygen.org/publication/PubMed/11904305" }, { "database": "PubMed", "id": "14593115", "url": "https://glygen.org/publication/PubMed/14593115" }, { "database": "PubMed", "id": "16332679", "url": "https://glygen.org/publication/PubMed/16332679" }, { "database": "PubMed", "id": "18171990", "url": "https://glygen.org/publication/PubMed/18171990" }, { "database": "PubMed", "id": "18199680", "url": "https://glygen.org/publication/PubMed/18199680" }, { "database": "PubMed", "id": "16377629", "url": "https://glygen.org/publication/PubMed/16377629" }, { "database": "PubMed", "id": "16943418", "url": "https://glygen.org/publication/PubMed/16943418" } ] }, { "annotation": "Ubiquitinated. Ubiquitination occurs on the C-terminal proteolytically-cleaved peptide and is triggered by phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "P08047", "url": "https://www.uniprot.org/uniprot/P08047" }, { "database": "PubMed", "id": "18239466", "url": "https://glygen.org/publication/PubMed/18239466" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 120, 126, 128, 134, 254, 265, 271, 273, 276, 312, 394, 421, 424, 446, 453, 455, 491, 507, 510, 517, 612, 640, 641, 698, 702 ], "snv_sites": [ 27, 32, 40, 77, 120, 126, 128, 134, 271, 276, 325, 332, 394, 421, 446, 455, 498, 510, 517, 558, 612 ], "glycation_sites": [], "phosphorylation_sites": [ 2, 7, 40, 41, 42, 43, 46, 48, 56, 59, 101, 278, 375, 453, 579, 612, 617, 640, 641, 651, 668, 670, 681, 698, 702, 728, 732, 739 ], "sequon_annotation_sites": [ { "start_pos": 129, "end_pos": 131 }, { "start_pos": 132, "end_pos": 134 }, { "start_pos": 139, "end_pos": 141 }, { "start_pos": 263, "end_pos": 265 }, { "start_pos": 340, "end_pos": 342 }, { "start_pos": 373, "end_pos": 375 }, { "start_pos": 499, "end_pos": 501 }, { "start_pos": 533, "end_pos": 535 }, { "start_pos": 779, "end_pos": 781 }, { "start_pos": 79, "end_pos": 81 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 37 }, { "field": "total_sites", "count": 26 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 32 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 6 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 31 }, { "field": "total_sites", "count": 26 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 26 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 43 }, { "field": "total_sites", "count": 28 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 26 }, { "field": "total_sites", "count": 21 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 21 }, { "field": "total_sites", "count": 17 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 375 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }