{ "uniprot_canonical_ac": "P07996-1", "uniprot_ac": "P07996", "uniprot_id": "TSP1_HUMAN", "mass": { "chemical_mass": 129383.0, "monoisotopic_mass": 129383.0 }, "refseq": { "ac": "NP_003237", "name": "thrombospondin-1 precursor", "summary": "The protein encoded by this gene is a subunit of a disulfide-linked homotrimeric protein. This protein is an adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. This protein can bind to fibrinogen, fibronectin, laminin, type V collagen and integrins alpha-V/beta-1. This protein has been shown to play roles in platelet aggregation, angiogenesis, and tumorigenesis. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003237" }, "gene_names": [ { "name": "THBS1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P07996", "id": "P07996" }, { "name": "THBS1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003237", "id": "NP_003237" }, { "name": "THBS; THBS-1; TSP; TSP-1; TSP1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003237", "id": "NP_003237" }, { "name": "TSP1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P07996", "id": "P07996" }, { "name": "TSP", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P07996", "id": "P07996" } ], "protein_names": [ { "name": "Thrombospondin-1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P07996" }, { "name": "Glycoprotein G", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07996" }, { "name": "thrombospondin-1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003237", "id": "NP_003237" }, { "name": "thrombospondin-1p180; thrombospondin-p50; glycoprotein G", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003237", "id": "NP_003237" } ], "function": [ { "annotation": "A-296G variant of THBS1 gene (rs1478605) is associated with a lower frequency of stroke in a Brazilian population with sickle cell anemia.", "evidence": [ { "database": "RefSeq", "id": "NP_003237", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003237" }, { "database": "PubMed", "id": "38006767", "url": "https://glygen.org/publication/PubMed/38006767" } ] }, { "annotation": "Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions (PubMed:2430973, PubMed:6489349, PubMed:15014436, PubMed:18285447). Multifunctional, involved in inflammation, angiogenesis, wound healing, reactive oxygen species (ROS) signaling, nitrous oxide (NO) signaling, apoptosis, senescence, aging, cellular self-renewal, stemness, and cardiovascular and metabolic homeostasis (PubMed:14568985, PubMed:1371676, PubMed:10613822, PubMed:11134179, PubMed:24511121, PubMed:29042481, PubMed:32679764). Negatively modulates dendritic cell activation and cytokine release, as part of an autocrine feedback loop, contributing to the resolution of inflammation and immune homeostasis (PubMed:14568985). Ligand for receptor CD47 (PubMed:8550562, PubMed:19004835). Modulates nitrous oxide (NO) signaling via CD47, hence playing a role as a pressor agent, supporting blood pressure (By similarity). Plays a role in endothelial cell senescence, acting via CD47, by increasing the abundance and activation of NADPH oxidase NOX1, and so generating excess ROS (PubMed:29042481). Inhibits stem cell self-renewal, acting via CD47 signaling, probably by regulation of the stem cell transcription factors POU5F1/OCT4, SOX2, MYC/c-Myc and KLF4 (By similarity). Negatively modulates wound healing, acting via CD47 (By similarity). Ligand for receptor CD36 (PubMed:1371676, PubMed:10613822, PubMed:11134179). Involved in inducing apoptosis in podocytes in response to elevated free fatty acids, acting via CD36 (By similarity). Plays a role in suppressing angiogenesis, acting, depending on context, via CD36 or CD47 (PubMed:1371676, PubMed:10613822, PubMed:32679764, PubMed:11134179). Promotes cellular senescence in a TP53-CDKN1A-RB1 signaling-dependent manner (PubMed:29042481). Ligand for immunoglobulin-like cell surface receptor SIRPA (PubMed:24511121). Involved in ROS signaling in non-phagocytic cells, stimulating NADPH oxidase-derived ROS production, acting via interaction with SIRPA (PubMed:24511121). Plays a role in metabolic dysfunction in diet-induced obesity, perhaps acting by exacerbating adipose inflammatory activity; its effects may be mediated, at least in part, through enhanced adipocyte proliferation (By similarity). Plays a role in ER stress response, via its interaction with the activating transcription factor 6 alpha (ATF6) which produces adaptive ER stress response factors (By similarity). May be involved in age-related conditions, including metabolic dysregulation, during normal aging (PubMed:29042481, PubMed:32679764).", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996#function" }, { "database": "PubMed", "id": "15014436", "url": "https://glygen.org/publication/PubMed/15014436" }, { "database": "PubMed", "id": "6489349", "url": "https://glygen.org/publication/PubMed/6489349" }, { "database": "PubMed", "id": "19004835", "url": "https://glygen.org/publication/PubMed/19004835" }, { "database": "PubMed", "id": "8550562", "url": "https://glygen.org/publication/PubMed/8550562" }, { "database": "PubMed", "id": "24511121", "url": "https://glygen.org/publication/PubMed/24511121" }, { "database": "PubMed", "id": "18285447", "url": "https://glygen.org/publication/PubMed/18285447" }, { "database": "PubMed", "id": "1371676", "url": "https://glygen.org/publication/PubMed/1371676" }, { "database": "PubMed", "id": "10613822", "url": "https://glygen.org/publication/PubMed/10613822" }, { "database": "UniProtKB", "id": "P35441", "url": "https://www.uniprot.org/uniprot/P35441#function" }, { "database": "PubMed", "id": "11134179", "url": "https://glygen.org/publication/PubMed/11134179" }, { "database": "PubMed", "id": "14568985", "url": "https://glygen.org/publication/PubMed/14568985" }, { "database": "PubMed", "id": "29042481", "url": "https://glygen.org/publication/PubMed/29042481" }, { "database": "PubMed", "id": "2430973", "url": "https://glygen.org/publication/PubMed/2430973" }, { "database": "PubMed", "id": "32679764", "url": "https://glygen.org/publication/PubMed/32679764" } ] }, { "annotation": "Inhibitory receptor CD47 binding to plasma TSP1 suppresses NK-cell IFN-gamma production via activating the JAK/STAT3 pathway during HIV infection. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_003237", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003237" }, { "database": "PubMed", "id": "38037074", "url": "https://glygen.org/publication/PubMed/38037074" } ] }, { "annotation": "LncRNA MIR217HG aggravates pressure-overload induced cardiac remodeling by activating miR-138/THBS1 pathway.", "evidence": [ { "database": "RefSeq", "id": "NP_003237", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003237" }, { "database": "PubMed", "id": "38013141", "url": "https://glygen.org/publication/PubMed/38013141" } ] }, { "annotation": "Pericardial Adipose Tissue Thrombospondin-1 Associates With Antiangiogenesis in Ischemic Heart Disease.", "evidence": [ { "database": "RefSeq", "id": "NP_003237", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003237" }, { "database": "PubMed", "id": "37863116", "url": "https://glygen.org/publication/PubMed/37863116" } ] }, { "annotation": "The protein encoded by this gene is a subunit of a disulfide-linked homotrimeric protein. This protein is an adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. This protein can bind to fibrinogen, fibronectin, laminin, type V collagen and integrins alpha-V/beta-1. This protein has been shown to play roles in platelet aggregation, angiogenesis, and tumorigenesis. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_003237", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003237" } ] }, { "annotation": "Thrombospondin-1 promotes liver fibrosis by enhancing TGF-beta action in hepatic stellate cells.", "evidence": [ { "database": "RefSeq", "id": "NP_003237", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003237" }, { "database": "PubMed", "id": "38091840", "url": "https://glygen.org/publication/PubMed/38091840" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "P07996", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07996" } ], "glycoeffect": [], "start_pos": 1017, "end_pos": 1017, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "E", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "15", "chr_pos": "39593450", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "E1017", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:1793", "recommended_name": { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic cancer", "description": "An endocrine gland cancer located_in the pancreas." }, "synonyms": [ { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca body of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca head of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca tail of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of body of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of head of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of tail of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreas neoplasm", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic neoplasm", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic tumor", "description": "" } ] }, { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P07996", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07996" }, { "id": "rs1293323402", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1293323402" }, { "id": "rs1293323402", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1293323402" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1052, "end_pos": 1052, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "P", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NPT->NHT).", "chr_id": "15", "chr_pos": "39593556", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "P1052", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs1293323402", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1293323402" }, { "id": "rs1293323402", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1293323402" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1052, "end_pos": 1052, "sequence_org": "P", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPT->NLT).", "chr_id": "15", "chr_pos": "39593556", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P1052", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs775771024", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775771024" }, { "id": "rs775771024", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775771024" }, { "id": "rs775771024", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs775771024#frequency_tab" }, { "id": "rs775771024", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775771024" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1052, "end_pos": 1052, "sequence_org": "P", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPT->NTT).", "chr_id": "15", "chr_pos": "39593555", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P1052", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P07996", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07996" } ], "glycoeffect": [], "start_pos": 1077, "end_pos": 1077, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "W", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "15", "chr_pos": "39593630", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "R1077", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs777143065", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777143065" }, { "id": "rs777143065", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777143065" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 111, "end_pos": 111, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DHS->NHS).", "chr_id": "15", "chr_pos": "39582456", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D111", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P07996", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07996" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1140, "end_pos": 1140, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DKT->NKT).", "chr_id": "15", "chr_pos": "39594353", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "D1140", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs868248144", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs868248144" }, { "id": "rs868248144", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs868248144" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 131, "end_pos": 131, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SLT->NLT).", "chr_id": "15", "chr_pos": "39582517", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S131", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P07996", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07996" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 207, "end_pos": 207, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NDN->NDS).", "chr_id": "15", "chr_pos": "39582745", "ref_nt": "A", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "N207", "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1361656297", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1361656297" }, { "id": "rs1361656297", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1361656297" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 231, "end_pos": 231, "sequence_org": "G", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NKG->NKS).", "chr_id": "15", "chr_pos": "39583680", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "G231", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P07996", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07996" }, { "id": "rs1396795713", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1396795713" }, { "id": "rs1396795713", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1396795713" }, { "id": "rs1396795713", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1396795713" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 234, "end_pos": 234, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (SST->NST).", "chr_id": "15", "chr_pos": "39583690", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S234", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs749005843", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749005843" }, { "id": "rs749005843", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749005843" }, { "id": "rs749005843", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749005843" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 259, "end_pos": 259, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NYI->NYT).", "chr_id": "15", "chr_pos": "39584060", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I259", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1595507005", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1595507005" }, { "id": "rs1595507005", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1595507005" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 289, "end_pos": 289, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->P).", "chr_id": "15", "chr_pos": "39584149", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T289", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs752137476", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752137476" }, { "id": "rs752137476", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752137476" }, { "id": "rs752137476", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs752137476#frequency_tab" }, { "id": "rs752137476", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752137476" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 293, "end_pos": 293, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->M).", "chr_id": "15", "chr_pos": "39584162", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T293", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P07996", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07996" }, { "id": "rs1175503028", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1175503028" }, { "id": "rs1175503028", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1175503028" }, { "id": "rs1175503028", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1175503028" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 302, "end_pos": 302, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->I).", "chr_id": "15", "chr_pos": "39584301", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "T302", "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs1250985038", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1250985038" }, { "id": "rs1250985038", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1250985038" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 335, "end_pos": 335, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SCT->NCT).", "chr_id": "15", "chr_pos": "39584400", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S335", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P07996", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07996" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 360, "end_pos": 360, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "15", "chr_pos": "39585521", "ref_nt": "A", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "N360", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs371913448", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs371913448" }, { "id": "rs371913448", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371913448#frequency_tab" }, { "id": "rs371913448", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371913448" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 360, "end_pos": 360, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "15", "chr_pos": "39585522", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "N360", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs371913448", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs371913448" }, { "id": "rs371913448", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371913448" }, { "id": "rs371913448", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371913448#frequency_tab" }, { "id": "rs371913448", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371913448" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 360, "end_pos": 360, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->TAT).", "chr_id": "15", "chr_pos": "39585522", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "N360", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1163809174", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1163809174" }, { "id": "rs1163809174", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1163809174#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 362, "end_pos": 362, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->NAI).", "chr_id": "15", "chr_pos": "39585528", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T362", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1365197889", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1365197889" }, { "id": "rs1365197889", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1365197889#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 42, "end_pos": 42, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KGS->NGS).", "chr_id": "15", "chr_pos": "39582251", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K42", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1277615838", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1277615838" }, { "id": "rs1277615838", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1277615838" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 494, "end_pos": 494, "sequence_org": "G", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NGG->NGS).", "chr_id": "15", "chr_pos": "39588534", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "G494", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs746950582", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746950582" }, { "id": "rs746950582", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746950582" }, { "id": "rs746950582", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746950582" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 522, "end_pos": 522, "sequence_org": "P", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPT->NLT).", "chr_id": "15", "chr_pos": "39588619", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P522", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1461317869", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1461317869" }, { "id": "rs1461317869", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1461317869#frequency_tab" }, { "id": "rs1461317869", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1461317869" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 534, "end_pos": 534, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DVT->NVT).", "chr_id": "15", "chr_pos": "39588654", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D534", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs760043067", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760043067" }, { "id": "rs760043067", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760043067" }, { "id": "rs760043067", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs760043067" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 603, "end_pos": 603, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NHN->NHS).", "chr_id": "15", "chr_pos": "39589236", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N603", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs571287917", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs571287917" }, { "id": "rs571287917", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs571287917" }, { "id": "rs571287917", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs571287917" }, { "id": "rs571287917", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs571287917#frequency_tab" }, { "id": "rs571287917", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs571287917" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 638, "end_pos": 638, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->M).", "chr_id": "15", "chr_pos": "39589341", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.000599", "site_lbl": "T638", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P07996", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07996" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 652, "end_pos": 652, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DGT->NGT).", "chr_id": "15", "chr_pos": "39589832", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "D652", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs61757229", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61757229" }, { "id": "rs61757229", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs61757229" }, { "id": "rs61757229", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61757229" }, { "id": "rs61757229", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs61757229#frequency_tab" }, { "id": "rs61757229", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs61757229" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 708, "end_pos": 708, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->KAT).", "chr_id": "15", "chr_pos": "39590002", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "N708", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1255167511", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1255167511" }, { "id": "rs1255167511", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1255167511" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 708, "end_pos": 708, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "15", "chr_pos": "39590001", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N708", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P07996", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07996" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 710, "end_pos": 710, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NAT->NAN).", "chr_id": "15", "chr_pos": "39590007", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "T710", "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1352754154", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1352754154" }, { "id": "rs1352754154", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1352754154" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 722, "end_pos": 722, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NLP->NLS).", "chr_id": "15", "chr_pos": "39590534", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P722", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs764699626", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764699626" }, { "id": "rs764699626", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764699626" }, { "id": "rs764699626", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764699626" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 902, "end_pos": 902, "sequence_org": "G", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDG->NDS).", "chr_id": "15", "chr_pos": "39592739", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "G902", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 1019, "end_pos": 1021, "sequence_org": "DDD", "sequence_mut": "AAA", "comment": "Reduces attachment to cells and retention in extracellular matrix.", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" }, { "database": "PubMed", "id": "18285447", "url": "https://glygen.org/publication/PubMed/18285447" } ] }, { "start_pos": 1067, "end_pos": 1067, "sequence_org": "N", "sequence_mut": "K", "comment": "Loss of N-glycosylation site.", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" }, { "database": "PubMed", "id": "15014436", "url": "https://glygen.org/publication/PubMed/15014436" } ] }, { "start_pos": 926, "end_pos": 926, "sequence_org": "R", "sequence_mut": "V", "comment": "Reduces attachment to cells and retention in extracellular matrix (ECM); retention in ECM partially dependent on beta-1 integrin.", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" }, { "database": "PubMed", "id": "18285447", "url": "https://glygen.org/publication/PubMed/18285447" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "91.03", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137801", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137801" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "77.9", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000137801", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137801" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "92.14", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137801", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137801" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "96.29", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137801", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137801" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.11", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137801", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137801" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "98.57", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137801", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137801" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "90.45", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137801", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137801" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "87.59", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137801", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137801" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "90.27", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137801", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137801" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "98.97", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137801", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137801" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "92.96", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137801", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137801" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "93.23", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137801", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137801" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "98.18", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137801", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137801" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P07996", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07996" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P07996", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07996" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P07996", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07996" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P07996", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07996" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P07996", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07996" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P07996", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07996" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P07996", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07996" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P07996", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07996" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P07996", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07996" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P07996", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07996" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P07996", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07996" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P07996", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07996" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "common_name": "Human" } ], "gene": [ { "name": "THBS1", "url": "https://www.uniprot.org/uniprot/P07996", "locus": { "chromosome": "15", "start_pos": 39599466, "end_pos": 39581079, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000137801", "url": "https://www.ensembl.org/id/ENSG00000137801" } ] } } ], "crossref": [ { "id": "ENSG00000137801", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137801", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P07996", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07996", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd00054", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00054", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL4630810", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4630810", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "THBS1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=THBS1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "7057", "url": "https://www.ncbi.nlm.nih.gov/gene/7057", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "11785", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=11785", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P07996", "url": "https://www.ebi.ac.uk/intact/interactors/id:P07996*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000742", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000742", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000884", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000884", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001007", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001007", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001881", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001881", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003367", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003367", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008859", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008859", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013320", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013320", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017897", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017897", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR024731", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024731", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR028974", "url": "https://www.ebi.ac.uk/interpro/entry/IPR028974", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036383", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036383", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR048287", "url": "https://www.ebi.ac.uk/interpro/entry/IPR048287", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:7057", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7057", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "188060", "url": "http://www.omim.org/entry/188060", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P07996", "url": "https://www.nextprot.org/entry/NX_P07996", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P07996", "url": "https://oglcnac.org/atlas/detail/P07996", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P07996", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07996", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "AVPDDKF", "url": "https://omabrowser.org/oma/group/AVPDDKF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5345349at2759", "url": "http://www.orthodb.org/?query=5345349at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10199", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10199", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10199:SF78", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10199:SF78", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1LSL", "url": "https://www.rcsb.org/structure/1LSL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1UX6", "url": "https://www.rcsb.org/structure/1UX6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1Z78", "url": "https://www.rcsb.org/structure/1Z78", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1ZA4", "url": "https://www.rcsb.org/structure/1ZA4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2ERF", "url": "https://www.rcsb.org/structure/2ERF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2ES3", "url": "https://www.rcsb.org/structure/2ES3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2OUH", "url": "https://www.rcsb.org/structure/2OUH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2OUJ", "url": "https://www.rcsb.org/structure/2OUJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3R6B", "url": "https://www.rcsb.org/structure/3R6B", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5FOE", "url": "https://www.rcsb.org/structure/5FOE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7YYK", "url": "https://www.rcsb.org/structure/7YYK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00090", "url": "http://pfam.xfam.org/family/PF00090", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00093", "url": "http://pfam.xfam.org/family/PF00093", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02412", "url": "http://pfam.xfam.org/family/PF02412", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF05735", "url": "http://pfam.xfam.org/family/PF05735", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF12947", "url": "http://pfam.xfam.org/family/PF12947", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P07996", "url": "https://pharos.nih.gov/targets/P07996", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000054414", "url": "https://proconsortium.org/app/entry/PR:000054414", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054415", "url": "https://proconsortium.org/app/entry/PR:000054415", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054416", "url": "https://proconsortium.org/app/entry/PR:000054416", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054417", "url": "https://proconsortium.org/app/entry/PR:000054417", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054418", "url": "https://proconsortium.org/app/entry/PR:000054418", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054419", "url": "https://proconsortium.org/app/entry/PR:000054419", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P07996", "url": "http://purl.obolibrary.org/obo/PR_P07996", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5083635", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5083635", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5173214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5173214", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_003237", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003237", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P07996", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "A8MZG1", "url": "https://www.uniprot.org/uniprot/A8MZG1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A8MZG1-1", "url": "https://www.uniprot.org/uniprot/A8MZG1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07996-1", "url": "https://www.uniprot.org/uniprot/P07996-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07996-2", "url": "https://www.uniprot.org/uniprot/P07996-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGLAWGLGVLFLMHVCGTNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLLTLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRKVTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCSNATVPDGECCPRCWPSDSADDGWSPWSEWTSCSTSCGNGIQQRGRSCDSLNNRCEGSSVQTRTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARETKACKKDACPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCVGDVTENQICNKQDCPIDGCLSNPCFAGVKCTSYPDGSWKCGACPPGYSGNGIQCTDVDECKEVPDACFNHNGEHRCENTDPGYNCLPCPPRFTGSQPFGQGVEHATANKQVCKPRNPCTDGTHDCNKNAKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPNLPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYNHNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEHNPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDNDGIPDDKDNCRLVPNPDQKDSDGDGRGDACKDDFDHDSVPDIDDICPENVDISETDFRRFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYDKTYAGGRLGLFVFSQEMVFFSDLKYECRDP", "length": 1170, "header": "sp|P07996-1|TSP1_HUMAN Isoform 1 of Thrombospondin-1 OS=Homo sapiens OX=9606 GN=THBS1 PE=1 SV=2 CANONICAL=P07996-1" }, "isoforms": [ { "isoform_ac": "A8MZG1-1", "url": "", "sequence": { "sequence": "MGLAWGLGVLFLMHVCGTNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASL", "length": 94, "header": "tr|A8MZG1-1|A8MZG1_HUMAN Computationally mapped isoform of Thrombospondin 1 OS=Homo sapiens OX=9606 GN=THBS1 PE=1 SV=1 CANONICAL=P07996-1" }, "locus": { "chromosome": "15", "start_pos": 39582407, "end_pos": 39581858, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000397591.2", "url": "https://www.ensembl.org/id/ENST00000397591.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000380720.2", "url": "https://www.ensembl.org/id/ENSP00000380720.2" } ] } }, { "isoform_ac": "P07996-1", "url": "", "sequence": { "sequence": "MGLAWGLGVLFLMHVCGTNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLLTLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRKVTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCSNATVPDGECCPRCWPSDSADDGWSPWSEWTSCSTSCGNGIQQRGRSCDSLNNRCEGSSVQTRTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARETKACKKDACPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCVGDVTENQICNKQDCPIDGCLSNPCFAGVKCTSYPDGSWKCGACPPGYSGNGIQCTDVDECKEVPDACFNHNGEHRCENTDPGYNCLPCPPRFTGSQPFGQGVEHATANKQVCKPRNPCTDGTHDCNKNAKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPNLPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYNHNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEHNPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDNDGIPDDKDNCRLVPNPDQKDSDGDGRGDACKDDFDHDSVPDIDDICPENVDISETDFRRFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYDKTYAGGRLGLFVFSQEMVFFSDLKYECRDP", "length": 1170, "header": "sp|P07996-1|TSP1_HUMAN Isoform 1 of Thrombospondin-1 OS=Homo sapiens OX=9606 GN=THBS1 PE=1 SV=2 CANONICAL=P07996-1" }, "locus": { "chromosome": "15", "start_pos": 39595366, "end_pos": 39581858, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000260356.6", "url": "https://www.ensembl.org/id/ENST00000260356.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000260356.5", "url": "https://www.ensembl.org/id/ENSP00000260356.5" } ] } }, { "isoform_ac": "P07996-2", "url": "", "sequence": { "sequence": "MGLAWGLGVLFLMHVCGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLLTLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRKVTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCSNATVPDGECCPRCWPSDSADDGWSPWSEWTSCSTSCGNGIQQRGRSCDSLNNRCEGSSVQTRTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARETKACKKDACPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCVGDVTENQICNKQDCPIDGCLSNPCFAGVKCTSYPDGSWKCGACPPGYSGNGIQCTDVDECKEVPDACFNHNGEHRCENTDPGYNCLPCPPRFTGSQPFGQGVEHATANKQVCKPRNPCTDGTHDCNKNAKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPNLPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYNHNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEHNPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDNDGIPDDKDNCRLVPNPDQKDSDGDGRGDACKDDFDHDSVPDIDDICPENVDISETDFRRFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYDKTYAGGRLGLFVFSQEMVFFSDLKYECRDP", "length": 1085, "header": "sp|P07996-2|TSP1_HUMAN Isoform 2 of Thrombospondin-1 OS=Homo sapiens OX=9606 GN=THBS1 PE=1 SV=2 CANONICAL=P07996-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G37881RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1051, "start_aa": "Asn", "end_pos": 1051, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1051", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1051, "start_aa": "Asn", "end_pos": 1051, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1051", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G56784JY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1051, "start_aa": "Asn", "end_pos": 1051, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1051", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G03382KH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G04672QB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G09197ZW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "P07996", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G12313PD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14260UH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G16175ZV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "P07996", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20210JR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23453IV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G24835MQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25418HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G27126ED", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "P07996", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G31936TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G32332VU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G33609NS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G45495MK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G46902YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G48584BU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G50757KG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G51640FO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G54612UD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G55383ZG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "P07996", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G65092SV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66621EA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66766XF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70418MS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72398FA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72735IY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G78790NZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G80223IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82119TF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G83229XP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G84820NF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G89098OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1067, "start_aa": "Asn", "end_pos": 1067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1067", "evidence": [ { "id": "P07996", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P07996", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07996#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "15014436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15014436" }, { "id": "16740002", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16740002" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 150, "start_aa": "Thr", "end_pos": 150, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr150", "evidence": [ { "id": "P07996", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07996" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "22403705", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22403705" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "P07996", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P07996" } ] }, { "glytoucan_ac": "G08110WX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 248, "start_aa": "Asn", "end_pos": 248, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn248", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 248, "start_aa": "Asn", "end_pos": 248, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn248", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 248, "start_aa": "Asn", "end_pos": 248, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn248", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 248, "start_aa": "Asn", "end_pos": 248, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn248", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 248, "start_aa": "Asn", "end_pos": 248, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn248", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25418HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 248, "start_aa": "Asn", "end_pos": 248, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn248", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 248, "start_aa": "Asn", "end_pos": 248, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn248", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G51640FO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 248, "start_aa": "Asn", "end_pos": 248, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn248", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G65092SV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 248, "start_aa": "Asn", "end_pos": 248, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn248", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72667IM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 248, "start_aa": "Asn", "end_pos": 248, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn248", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G80223IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 248, "start_aa": "Asn", "end_pos": 248, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn248", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81198YO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 248, "start_aa": "Asn", "end_pos": 248, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn248", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 248, "start_aa": "Asn", "end_pos": 248, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn248", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 248, "start_aa": "Asn", "end_pos": 248, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn248", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 248, "start_aa": "Asn", "end_pos": 248, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn248", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G95977AE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 248, "start_aa": "Asn", "end_pos": 248, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn248", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G99966GV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 248, "start_aa": "Asn", "end_pos": 248, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn248", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 248, "start_aa": "Asn", "end_pos": 248, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn248", "evidence": [ { "id": "P07996", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07996#ptm_processing" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "16263699", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16263699" }, { "id": "18065761", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18065761" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 289, "start_aa": "Thr", "end_pos": 289, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr289", "evidence": [ { "id": "P07996", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "TIVTTLQDSIR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 289, "start_aa": "Thr", "end_pos": 299, "end_aa": "Arg", "evidence": [ { "id": "P07996", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 292, "start_aa": "Thr", "end_pos": 292, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr292", "evidence": [ { "id": "P07996", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 293, "start_aa": "Thr", "end_pos": 293, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr293", "evidence": [ { "id": "P07996", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "KVTEENKELANELR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 300, "start_aa": "Lys", "end_pos": 313, "end_aa": "Arg", "evidence": [ { "id": "P07996", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 302, "start_aa": "Thr", "end_pos": 302, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr302", "evidence": [ { "id": "P07996", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G03382KH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G10256JP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G12313PD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14260UH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20210JR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G22625SJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23453IV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25418HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G33609NS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39619TI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G45495MK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G46902YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G49874UX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G51640FO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G60177UT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G63381RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G65092SV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66621EA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70375MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72667IM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72735IY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G74430RZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G80223IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81198YO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82119TF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G87051GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "P07996", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G96577RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "P07996", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P07996", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07996#ptm_processing" } ] }, { "glytoucan_ac": "G70323CJ", "type": "C-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "W", "relation": "attached", "comment": "", "start_pos": 385, "start_aa": "Trp", "end_pos": 385, "end_aa": "Trp", "residue": "Trp", "site_lbl": "Trp385", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "11067851", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11067851" } ] }, { "glytoucan_ac": "", "type": "C-linked", "subtype": "C-mannosylation", "site_category": "reported", "site_seq": "W", "relation": "attached", "comment": "C-linked (Man) tryptophan C-mannosylation", "start_pos": 385, "start_aa": "Trp", "end_pos": 385, "end_aa": "Trp", "residue": "Trp", "site_lbl": "Trp385", "evidence": [ { "id": "P07996", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07996#ptm_processing" }, { "id": "11067851", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11067851" } ] }, { "glytoucan_ac": "G06038KF", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 394, "start_aa": "Ser", "end_pos": 394, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser394", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "11067851", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11067851" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-fucosylation", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (Fuc...) serine O-fucosylation", "start_pos": 394, "start_aa": "Ser", "end_pos": 394, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser394", "evidence": [ { "id": "P07996", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07996#ptm_processing" }, { "id": "11067851", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11067851" } ] }, { "glytoucan_ac": "G70323CJ", "type": "C-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "W", "relation": "attached", "comment": "", "start_pos": 438, "start_aa": "Trp", "end_pos": 438, "end_aa": "Trp", "residue": "Trp", "site_lbl": "Trp438", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "11067851", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11067851" } ] }, { "glytoucan_ac": "", "type": "C-linked", "subtype": "C-mannosylation", "site_category": "reported", "site_seq": "W", "relation": "attached", "comment": "C-linked (Man) tryptophan C-mannosylation", "start_pos": 438, "start_aa": "Trp", "end_pos": 438, "end_aa": "Trp", "residue": "Trp", "site_lbl": "Trp438", "evidence": [ { "id": "P07996", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07996#ptm_processing" }, { "id": "11067851", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11067851" } ] }, { "glytoucan_ac": "G70323CJ", "type": "C-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "W", "relation": "attached", "comment": "", "start_pos": 441, "start_aa": "Trp", "end_pos": 441, "end_aa": "Trp", "residue": "Trp", "site_lbl": "Trp441", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "11067851", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11067851" } ] }, { "glytoucan_ac": "", "type": "C-linked", "subtype": "C-mannosylation", "site_category": "reported", "site_seq": "W", "relation": "attached", "comment": "C-linked (Man) tryptophan C-mannosylation", "start_pos": 441, "start_aa": "Trp", "end_pos": 441, "end_aa": "Trp", "residue": "Trp", "site_lbl": "Trp441", "evidence": [ { "id": "P07996", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07996#ptm_processing" }, { "id": "11067851", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11067851" } ] }, { "glytoucan_ac": "G06038KF", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 450, "start_aa": "Thr", "end_pos": 450, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr450", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "11067851", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11067851" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-fucosylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (Fuc...) threonine O-fucosylation", "start_pos": 450, "start_aa": "Thr", "end_pos": 450, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr450", "evidence": [ { "id": "P07996", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07996#ptm_processing" }, { "id": "12391027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12391027" }, { "id": "11067851", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11067851" } ] }, { "glytoucan_ac": "G70323CJ", "type": "C-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "W", "relation": "attached", "comment": "", "start_pos": 498, "start_aa": "Trp", "end_pos": 498, "end_aa": "Trp", "residue": "Trp", "site_lbl": "Trp498", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "11067851", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11067851" } ] }, { "glytoucan_ac": "", "type": "C-linked", "subtype": "C-mannosylation", "site_category": "reported", "site_seq": "W", "relation": "attached", "comment": "C-linked (Man) tryptophan C-mannosylation", "start_pos": 498, "start_aa": "Trp", "end_pos": 498, "end_aa": "Trp", "residue": "Trp", "site_lbl": "Trp498", "evidence": [ { "id": "P07996", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07996#ptm_processing" }, { "id": "11067851", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11067851" } ] }, { "glytoucan_ac": "G06038KF", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 507, "start_aa": "Thr", "end_pos": 507, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr507", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "11067851", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11067851" } ] }, { "glytoucan_ac": "G96881BQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 507, "start_aa": "Thr", "end_pos": 507, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr507", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "11067851", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11067851" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-fucosylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (Fuc...) threonine O-fucosylation", "start_pos": 507, "start_aa": "Thr", "end_pos": 507, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr507", "evidence": [ { "id": "P07996", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07996#ptm_processing" }, { "id": "12391027", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12391027" }, { "id": "11067851", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11067851" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 521, "start_aa": "Asn", "end_pos": 521, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn521", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 521, "start_aa": "Asn", "end_pos": 521, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn521", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "CGACPPGYSGNGIQCTDVDECK", "relation": "attached", "comment": "", "start_pos": 572, "start_aa": "Cys", "end_pos": 593, "end_aa": "Lys", "evidence": [ { "id": "P07996", "database": "UniCarbKB", "url": "" }, { "id": "28035807", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.6b02887" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 580, "start_aa": "Ser", "end_pos": 580, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser580", "evidence": [ { "id": "P07996", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07996" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "22403705", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22403705" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "FTGSQPFGQGVEHATANK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 624, "start_aa": "Phe", "end_pos": 641, "end_aa": "Lys", "evidence": [ { "id": "P07996", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 638, "start_aa": "Thr", "end_pos": 638, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr638", "evidence": [ { "id": "P07996", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 708, "start_aa": "Asn", "end_pos": 708, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn708", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 708, "start_aa": "Asn", "end_pos": 708, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn708", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 708, "start_aa": "Asn", "end_pos": 708, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn708", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 708, "start_aa": "Asn", "end_pos": 708, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn708", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G80223IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 708, "start_aa": "Asn", "end_pos": 708, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn708", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 708, "start_aa": "Asn", "end_pos": 708, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn708", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 708, "start_aa": "Asn", "end_pos": 708, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn708", "evidence": [ { "id": "P07996", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07996#ptm_processing" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "glytoucan_ac": "G06038KF", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "11067851", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11067851" } ] }, { "glytoucan_ac": "G70323CJ", "type": "C-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "11067851", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11067851" } ] }, { "glytoucan_ac": "G96881BQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "594", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/594" }, { "id": "11067851", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11067851" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Proteomics Analysis of O-GalNAc Glycosylation in Human Serum by an Integrated Strategy", "journal": "Anal. Chem.", "date": "2017", "authors": "Qin H., Cheng K., Zhu J., Mao J., Wang F., Dong M., Chen R., Guo Z., Liang X., Ye M., Zou H.", "evidence": [ { "database": "UniCarbKB", "id": "P07996", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1021/acs.analchem.6b02887", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.6b02887" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology", "journal": "EMBO J", "date": "2013", "authors": "Steentoft C., Vakhrushev S.Y., Joshi H.J., Kong Y., Vester-Christensen M.B., Schjoldager K.T., Lavrsen K., Dabelsteen S., Pedersen N.B., Marcos-Silva L., Gupta R., Bennett E.P., Mandel U., Brunak S., Wandall H.H., Levery S.B., Clausen H.", "evidence": [ { "database": "UniCarbKB", "id": "P07996", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1038/emboj.2013.79", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "title": "Probing the O-Glycoproteome of Gastric Cancer Cell Lines for Biomarker Discovery", "journal": "Molecular & Cellular Proteomics", "date": "2015", "authors": "Campos D., Freitas D., Gomes J., Magalh\u00e3es A., Steentoft C., Gomes C., Vester-Christensen M. B., Ferreira J. A., Afonso L. P., Santos L. L., Pinto de Sousa J., Mandel U., Clausen H., Vakhrushev S. Y., Reis C. A.", "evidence": [ { "database": "UniCarbKB", "id": "P07996", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1074/mcp.M114.046862", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "title": "Isolation and characterization of a high molecular weight glycoprotein from human blood platelets.", "journal": "J. Biol. Chem.", "date": "1978", "authors": "Lawler JW, Slayter HS, Coligan JE", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "101549", "url": "https://glygen.org/publication/PubMed/101549" } ] }, { "title": "The integrin alpha9beta1 mediates adhesion to activated endothelial cells and transendothelial neutrophil migration through interaction with vascular cell adhesion molecule-1.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Taooka Y, Chen J, Yednock T, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10209034", "url": "https://glygen.org/publication/PubMed/10209034" } ] }, { "title": "Alpha 2 beta 1 integrin mediates dermal fibroblast attachment to type VII collagen via a 158-amino-acid segment of the NC1 domain.", "journal": "Experimental cell research", "date": "1999", "authors": "Chen M, O'Toole EA, Li YY, Woodley DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10366422", "url": "https://glygen.org/publication/PubMed/10366422" } ] }, { "title": "The leukocyte integrin alpha D beta 2 binds VCAM-1: evidence for a binding interface between I domain and VCAM-1.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Van der Vieren M, Crowe DT, Hoekstra D, Vazeux R, Hoffman PA, Grayson MH, Bochner BS, Gallatin WM, Staunton DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10438935", "url": "https://glygen.org/publication/PubMed/10438935" } ] }, { "title": "Mechanism of action and in vivo role of platelet-derived growth factor.", "journal": "Physiological reviews", "date": "1999", "authors": "Heldin CH, Westermark B", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "10508235", "url": "https://glygen.org/publication/PubMed/10508235" } ] }, { "title": "Characteristics of fibrinogen binding to the domain of CD11c, an alpha subunit of p150,95.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Nham SU", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10543983", "url": "https://glygen.org/publication/PubMed/10543983" } ] }, { "title": "The integrin alpha(9)beta(1) binds to a novel recognition sequence (SVVYGLR) in the thrombin-cleaved amino-terminal fragment of osteopontin.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Yokosaki Y, Matsuura N, Sasaki T, Murakami I, Schneider H, Higashiyama S, Saitoh Y, Yamakido M, Taooka Y, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10593924", "url": "https://glygen.org/publication/PubMed/10593924" } ] }, { "title": "Signaling through platelet integrin alpha IIb beta 3: inside-out, outside-in, and sideways.", "journal": "Thrombosis and haemostasis", "date": "1999", "authors": "Shattil SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10605720", "url": "https://glygen.org/publication/PubMed/10605720" } ] }, { "title": "Signals leading to apoptosis-dependent inhibition of neovascularization by thrombospondin-1.", "journal": "Nature medicine", "date": "2000-01", "authors": "Jim\u00e9nez B, Volpert O V, Crawford S E, Febbraio M, Silverstein R L, Bouck N", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "10613822", "url": "https://glygen.org/publication/PubMed/10613822" } ] }, { "title": "A mechanism of repression by acute myeloid leukemia-1, the target of multiple chromosomal translocations in acute leukemia.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Lutterbach B, Westendorf JJ, Linggi B, Isaac S, Seto E, Hiebert SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "10617663", "url": "https://glygen.org/publication/PubMed/10617663" } ] }, { "title": "Activation of integrin alpha(V)beta(3) regulates cell adhesion and migration to bone sialoprotein.", "journal": "Experimental cell research", "date": "2000", "authors": "Byzova TV, Kim W, Midura RJ, Plow EF", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10640428", "url": "https://glygen.org/publication/PubMed/10640428" } ] }, { "title": "A regulated interaction between alpha5beta1 integrin and osteopontin.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Barry ST, Ludbrook SB, Murrison E, Horgan CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10673366", "url": "https://glygen.org/publication/PubMed/10673366" } ] }, { "title": "Distinct recognition of collagen subtypes by alpha(1)beta(1) and alpha(2)beta(1) integrins. Alpha(1)beta(1) mediates cell adhesion to type XIII collagen.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Nykvist P, Tu H, Ivaska J, Kapyla J, Pihlajaniemi T, Heino J", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10713152", "url": "https://glygen.org/publication/PubMed/10713152" } ] }, { "title": "Cell contact-dependent activation of alpha3beta1 integrin modulates endothelial cell responses to thrombospondin-1.", "journal": "Molecular biology of the cell", "date": "2000", "authors": "Chandrasekaran L, He CZ, Al-Barazi H, Krutzsch HC, Iruela-Arispe ML, Roberts DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10982388", "url": "https://glygen.org/publication/PubMed/10982388" } ] }, { "title": "C-mannosylation and O-fucosylation of the thrombospondin type 1 module.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Hofsteenge J, Huwiler KG, Macek B, Hess D, Lawler J, Mosher DF, Peter-Katalinic J", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996#ptm_processing" }, { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" }, { "database": "Reactome", "id": "R-HSA-5173214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5173214" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "reference": [ { "type": "PubMed", "id": "11067851", "url": "https://glygen.org/publication/PubMed/11067851" } ] }, { "title": "Histidine-rich glycoprotein inhibits the antiangiogenic effect of thrombospondin-1.", "journal": "The Journal of clinical investigation", "date": "2001-01", "authors": "Simantov R, Febbraio M, Crombie R, Asch A S, Nachman R L, Silverstein R L", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "11134179", "url": "https://glygen.org/publication/PubMed/11134179" } ] }, { "title": "Interaction of endostatin with integrins implicated in angiogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Rehn M, Veikkola T, Kukk-Valdre E, Nakamura H, Ilmonen M, Lombardo C, Pihlajaniemi T, Alitalo K, Vuori K", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11158588", "url": "https://glygen.org/publication/PubMed/11158588" } ] }, { "title": "alpha11beta1 integrin is a receptor for interstitial collagens involved in cell migration and collagen reorganization on mesenchymal nonmuscle cells.", "journal": "Developmental biology", "date": "2001", "authors": "Tiger CF, Fougerousse F, Grundstrom G, Velling T, Gullberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11518510", "url": "https://glygen.org/publication/PubMed/11518510" } ] }, { "title": "Selective binding of collagen subtypes by integrin alpha 1I, alpha 2I, and alpha 10I domains.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Tulla M, Pentikainen OT, Viitasalo T, Kapyla J, Impola U, Nykvist P, Nissinen L, Johnson MS, Heino J", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11572855", "url": "https://glygen.org/publication/PubMed/11572855" } ] }, { "title": "Distinct glycoprotein Ib/V/IX and integrin alpha IIbbeta 3-dependent calcium signals cooperatively regulate platelet adhesion under flow.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Nesbitt WS, Kulkarni S, Giuliano S, Goncalves I, Dopheide SM, Yap CL, Harper IS, Salem HH, Jackson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11713259", "url": "https://glygen.org/publication/PubMed/11713259" } ] }, { "title": "Interactions of thrombospondins with alpha4beta1 integrin and CD47 differentially modulate T cell behavior.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Li Z, Calzada MJ, Sipes JM, Cashel JA, Krutzsch HC, Annis DS, Mosher DF, Roberts DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11980922", "url": "https://glygen.org/publication/PubMed/11980922" } ] }, { "title": "BAY 43-9006: preclinical data.", "journal": "Current pharmaceutical design", "date": "2002", "authors": "Wilhelm S, Chien DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "12369853", "url": "https://glygen.org/publication/PubMed/12369853" } ] }, { "title": "Crystal structure of the TSP-1 type 1 repeats: a novel layered fold and its biological implication.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Tan K, Duquette M, Liu JH, Dong Y, Zhang R, Joachimiak A, Lawler J, Wang JH", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996#ptm_processing" }, { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "12391027", "url": "https://glygen.org/publication/PubMed/12391027" } ] }, { "title": "Biophysical characterization, including disulfide bond assignments, of the anti-angiogenic type 1 domains of human thrombospondin-1.", "journal": "Biochemistry", "date": "2002", "authors": "Huwiler Kristin G, Vestling Martha M, Annis Douglas S, Mosher Deane F", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "12450399", "url": "https://glygen.org/publication/PubMed/12450399" } ] }, { "title": "Molecular cloning and characterization of the GATA1 cofactor human FOG1 and assessment of its binding to GATA1 proteins carrying D218 substitutions.", "journal": "Human genetics", "date": "2003", "authors": "Freson K, Thys C, Wittewrongel C, Vermylen J, Hoylaerts MF, Van Geet C", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "12483298", "url": "https://glygen.org/publication/PubMed/12483298" } ] }, { "title": "alpha 11beta 1 integrin recognizes the GFOGER sequence in interstitial collagens.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Zhang WM, Kapyla J, Puranen JS, Knight CG, Tiger CF, Pentikainen OT, Johnson MS, Farndale RW, Heino J, Gullberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "12496264", "url": "https://glygen.org/publication/PubMed/12496264" } ] }, { "title": "In vivo antitumor activity of SU11248, a novel tyrosine kinase inhibitor targeting vascular endothelial growth factor and platelet-derived growth factor receptors: determination of a pharmacokinetic/pharmacodynamic relationship.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2003", "authors": "Mendel DB, Laird AD, Xin X, Louie SG, Christensen JG, Li G, Schreck RE, Abrams TJ, Ngai TJ, Lee LB, Murray LJ, Carver J, Chan E, Moss KG, Haznedar JO, Sukbuntherng J, Blake RA, Sun L, Tang C, Miller T, Shirazian S, McMahon G, Cherrington JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "12538485", "url": "https://glygen.org/publication/PubMed/12538485" } ] }, { "title": "RUNX1 and GATA-1 coexpression and cooperation in megakaryocytic differentiation.", "journal": "Blood", "date": "2003", "authors": "Elagib KE, Racke FK, Mogass M, Khetawat R, Delehanty LL, Goldfarb AN", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "12576332", "url": "https://glygen.org/publication/PubMed/12576332" } ] }, { "title": "Bidirectional integrin alphaIIbbeta3 signalling regulating platelet adhesion under flow: contribution of protein kinase C.", "journal": "The Biochemical journal", "date": "2003", "authors": "Giuliano S, Nesbitt WS, Rooney M, Jackson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "12585966", "url": "https://glygen.org/publication/PubMed/12585966" } ] }, { "title": "Human tumstatin and human endostatin exhibit distinct antiangiogenic activities mediated by alpha v beta 3 and alpha 5 beta 1 integrins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Sudhakar A, Sugimoto H, Yang C, Lively J, Zeisberg M, Kalluri R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "12682293", "url": "https://glygen.org/publication/PubMed/12682293" } ] }, { "title": "Cell adhesion to fibrillin-1 molecules and microfibrils is mediated by alpha 5 beta 1 and alpha v beta 3 integrins.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Bax DV, Bernard SE, Lomas A, Morgan A, Humphries J, Shuttleworth CA, Humphries MJ, Kielty CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "12807887", "url": "https://glygen.org/publication/PubMed/12807887" } ] }, { "title": "Syndecan-4 as a molecule involved in defense mechanisms.", "journal": "Glycoconjugate journal", "date": "2002", "authors": "Ishiguro K, Kojima T, Muramatsu T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "12975610", "url": "https://glygen.org/publication/PubMed/12975610" } ] }, { "title": "The extracellular glycoprotein SPARC interacts with platelet-derived growth factor (PDGF)-AB and -BB and inhibits the binding of PDGF to its receptors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Raines EW, Lane TF, Iruela-Arispe ML, Ross R, Sage EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "1311092", "url": "https://glygen.org/publication/PubMed/1311092" } ] }, { "title": "Thrombospondin sequence motif (CSVTCG) is responsible for CD36 binding.", "journal": "Biochemical and biophysical research communications", "date": "1992-02-14", "authors": "Asch A S, Silbiger S, Heimer E, Nachman R L", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "1371676", "url": "https://glygen.org/publication/PubMed/1371676" } ] }, { "title": "Isolation of dense granules from human platelets.", "journal": "Methods in enzymology", "date": "1992", "authors": "Fukami MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "1435334", "url": "https://glygen.org/publication/PubMed/1435334" } ] }, { "title": "Thrombospondin 1 is an autocrine negative regulator of human dendritic cell activation.", "journal": "The Journal of experimental medicine", "date": "2003-10-20", "authors": "Doyen Virginie, Rubio Manuel, Braun Deborah, Nakajima Toshiaru, Abe Jun, Saito Hirohisa, Delespesse Guy, Sarfati Marika", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "14568985", "url": "https://glygen.org/publication/PubMed/14568985" } ] }, { "title": "Characterization of the proteins released from activated platelets leads to localization of novel platelet proteins in human atherosclerotic lesions.", "journal": "Blood", "date": "2004", "authors": "Coppinger JA, Cagney G, Toomey S, Kislinger T, Belton O, McRedmond JP, Cahill DJ, Emili A, Fitzgerald DJ, Maguire PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "14630798", "url": "https://glygen.org/publication/PubMed/14630798" } ] }, { "title": "Vitronectin's basic domain is a syndecan ligand which functions in trans to regulate vitronectin turnover.", "journal": "Cell communication & adhesion", "date": "2003", "authors": "Wilkins-Port CE, Sanderson RD, Tominna-Sebald E, McKeown-Longo PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "14681059", "url": "https://glygen.org/publication/PubMed/14681059" } ] }, { "title": "Syndecan-2 regulates transforming growth factor-beta signaling.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Chen L, Klass C, Woods A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "14976204", "url": "https://glygen.org/publication/PubMed/14976204" } ] }, { "title": "Structure of a thrombospondin C-terminal fragment reveals a novel calcium core in the type 3 repeats.", "journal": "The EMBO journal", "date": "2004", "authors": "Kvansakul M, Adams JC, Hohenester E", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996#ptm_processing" }, { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "15014436", "url": "https://glygen.org/publication/PubMed/15014436" } ] }, { "title": "The PDGF family: four gene products form five dimeric isoforms.", "journal": "Cytokine & growth factor reviews", "date": "2004", "authors": "Fredriksson L, Li H, Eriksson U", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "15207811", "url": "https://glygen.org/publication/PubMed/15207811" } ] }, { "title": "Endorepellin causes endothelial cell disassembly of actin cytoskeleton and focal adhesions through alpha2beta1 integrin.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Bix G, Fu J, Gonzalez EM, Macro L, Barker A, Campbell S, Zutter MM, Santoro SA, Kim JK, Hook M, Reed CC, Iozzo RV", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15240572", "url": "https://glygen.org/publication/PubMed/15240572" } ] }, { "title": "The nucleotide transporter MRP4 (ABCC4) is highly expressed in human platelets and present in dense granules, indicating a role in mediator storage.", "journal": "Blood", "date": "2004", "authors": "Jedlitschky G, Tirschmann K, Lubenow LE, Nieuwenhuis HK, Akkerman JW, Greinacher A, Kroemer HK", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "15297306", "url": "https://glygen.org/publication/PubMed/15297306" } ] }, { "title": "Functional assessment of alphaEbeta7/E-cadherin interactions in the steady state postnatal thymus.", "journal": "Clinical & developmental immunology", "date": "2004", "authors": "Prockop SE, Petrie HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15330449", "url": "https://glygen.org/publication/PubMed/15330449" } ] }, { "title": "Galectin-3 is induced in rheumatoid arthritis synovial fibroblasts after adhesion to cartilage oligomeric matrix protein.", "journal": "Annals of the rheumatic diseases", "date": "2005", "authors": "Neidhart M, Zaucke F, von Knoch R, Jungel A, Michel BA, Gay RE, Gay S", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15345499", "url": "https://glygen.org/publication/PubMed/15345499" } ] }, { "title": "The fibril-associated collagen IX provides a novel mechanism for cell adhesion to cartilaginous matrix.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Kapyla J, Jaalinoja J, Tulla M, Ylostalo J, Nissinen L, Viitasalo T, Vehvilainen P, Marjomaki V, Nykvist P, Saamanen AM, Farndale RW, Birk DE, Ala-Kokko L, Heino J", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15383545", "url": "https://glygen.org/publication/PubMed/15383545" } ] }, { "title": "The syndecan-1 ectodomain regulates alphavbeta3 integrin activity in human mammary carcinoma cells.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Beauvais DM, Burbach BJ, Rapraeger AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "15479743", "url": "https://glygen.org/publication/PubMed/15479743" } ] }, { "title": "Discovery of N-(2-chloro-6-methyl- phenyl)-2-(6-(4-(2-hydroxyethyl)- piperazin-1-yl)-2-methylpyrimidin-4- ylamino)thiazole-5-carboxamide (BMS-354825), a dual Src/Abl kinase inhibitor with potent antitumor activity in preclinical assays.", "journal": "Journal of medicinal chemistry", "date": "2004", "authors": "Lombardo LJ, Lee FY, Chen P, Norris D, Barrish JC, Behnia K, Castaneda S, Cornelius LA, Das J, Doweyko AM, Fairchild C, Hunt JT, Inigo I, Johnston K, Kamath A, Kan D, Klei H, Marathe P, Pang S, Peterson R, Pitt S, Schieven GL, Schmidt RJ, Tokarski J, Wen ML, Wityak J, Borzilleri RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "15615512", "url": "https://glygen.org/publication/PubMed/15615512" } ] }, { "title": "Loss of alpha10beta1 integrin expression leads to moderate dysfunction of growth plate chondrocytes.", "journal": "Journal of cell science", "date": "2005", "authors": "Bengtsson T, Aszodi A, Nicolae C, Hunziker EB, Lundgren-Akerlund E, Fassler R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15713743", "url": "https://glygen.org/publication/PubMed/15713743" } ] }, { "title": "Targeting the platelet-derived growth factor receptor alpha with a neutralizing human monoclonal antibody inhibits the growth of tumor xenografts: implications as a potential therapeutic target.", "journal": "Molecular cancer therapeutics", "date": "2005", "authors": "Loizos N, Xu Y, Huber J, Liu M, Lu D, Finnerty B, Rolser R, Malikzay A, Persaud A, Corcoran E, Deevi DS, Balderes P, Bassi R, Jimenez X, Joynes CJ, Mangalampalli VR, Steiner P, Tonra JR, Wu Y, Pereira DS, Zhu Z, Ludwig DL, Hicklin DJ, Bohlen P, Witte L, Kussie P", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "15767546", "url": "https://glygen.org/publication/PubMed/15767546" } ] }, { "title": "VLA-4-fibronectin interaction is required for the terminal differentiation of human bone marrow cells capable of spontaneous and high rate immunoglobulin secretion.", "journal": "The Journal of experimental medicine", "date": "1992", "authors": "Roldan E, Garcia-Pardo A, Brieva JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "1588291", "url": "https://glygen.org/publication/PubMed/1588291" } ] }, { "title": "Canstatin acts on endothelial and tumor cells via mitochondrial damage initiated through interaction with alphavbeta3 and alphavbeta5 integrins.", "journal": "Cancer research", "date": "2005", "authors": "Magnon C, Galaup A, Mullan B, Rouffiac V, Bouquet C, Bidart JM, Griscelli F, Opolon P, Perricaudet M", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15899827", "url": "https://glygen.org/publication/PubMed/15899827" } ] }, { "title": "Critical role of the fifth domain of E-cadherin for heterophilic adhesion with alpha E beta 7, but not for homophilic adhesion.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Shiraishi K, Tsuzaka K, Yoshimoto K, Kumazawa C, Nozaki K, Abe T, Tsubota K, Takeuchi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16002701", "url": "https://glygen.org/publication/PubMed/16002701" } ] }, { "title": "Cartilage oligomeric matrix protein/thrombospondin 5 supports chondrocyte attachment through interaction with integrins.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Chen FH, Thomas AO, Hecht JT, Goldring MB, Lawler J", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16051604", "url": "https://glygen.org/publication/PubMed/16051604" } ] }, { "title": "Human alpha1 type IV collagen NC1 domain exhibits distinct antiangiogenic activity mediated by alpha1beta1 integrin.", "journal": "The Journal of clinical investigation", "date": "2005", "authors": "Sudhakar A, Nyberg P, Keshamouni VG, Mannam AP, Li J, Sugimoto H, Cosgrove D, Kalluri R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16151532", "url": "https://glygen.org/publication/PubMed/16151532" } ] }, { "title": "Integrin alphaDbeta2, an adhesion receptor up-regulated on macrophage foam cells, exhibits multiligand-binding properties.", "journal": "Blood", "date": "2006", "authors": "Yakubenko VP, Yadav SP, Ugarova TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16239428", "url": "https://glygen.org/publication/PubMed/16239428" } ] }, { "title": "Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach.", "journal": "Molecular & cellular proteomics : MCP", "date": "2006", "authors": "Lewandrowski U, Moebius J, Walter U, Sickmann A", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996#ptm_processing" }, { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "16263699", "url": "https://glygen.org/publication/PubMed/16263699" } ] }, { "title": "Autocrine activation of PDGFRalpha promotes the progression of ovarian cancer.", "journal": "Oncogene", "date": "2006", "authors": "Matei D, Emerson RE, Lai YC, Baldridge LA, Rao J, Yiannoutsos C, Donner DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "16331269", "url": "https://glygen.org/publication/PubMed/16331269" } ] }, { "title": "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.", "journal": "Journal of proteome research", "date": "2005", "authors": "Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996#ptm_processing" }, { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "title": "PDGF-AA and PDGF-BB biosynthesis: proprotein processing in the Golgi complex and lysosomal degradation of PDGF-BB retained intracellularly.", "journal": "The Journal of cell biology", "date": "1992", "authors": "Ostman A, Thyberg J, Westermark B, Heldin CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "1639841", "url": "https://glygen.org/publication/PubMed/1639841" } ] }, { "title": "The structures of the thrombospondin-1 N-terminal domain and its complex with a synthetic pentameric heparin.", "journal": "Structure", "date": "2006", "authors": "Tan Kemin, Duquette Mark, Liu Jin-Huan, Zhang Rongguang, Joachimiak Andrzej, Wang Jia-huai, Lawler Jack", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "16407063", "url": "https://glygen.org/publication/PubMed/16407063" } ] }, { "title": "Potent inhibition of platelet-derived growth factor-induced responses in vascular smooth muscle cells by BMS-354825 (dasatinib).", "journal": "Molecular pharmacology", "date": "2006", "authors": "Chen Z, Lee FY, Bhalla KN, Wu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "16436588", "url": "https://glygen.org/publication/PubMed/16436588" } ] }, { "title": "Two distinct pathways for O-fucosylation of epidermal growth factor-like or thrombospondin type 1 repeats.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Luo Y, Nita-Lazar A, Haltiwanger RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5173214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5173214" } ], "reference": [ { "type": "PubMed", "id": "16464858", "url": "https://glygen.org/publication/PubMed/16464858" } ] }, { "title": "Preclinical and clinical development of the oral multikinase inhibitor sorafenib in cancer treatment.", "journal": "Drugs of today (Barcelona, Spain : 1998)", "date": "2005", "authors": "Strumberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "16474853", "url": "https://glygen.org/publication/PubMed/16474853" } ] }, { "title": "Physical association of the patient-specific GATA1 mutants with RUNX1 in acute megakaryoblastic leukemia accompanying Down syndrome.", "journal": "Leukemia", "date": "2006", "authors": "Xu G, Kanezaki R, Toki T, Watanabe S, Takahashi Y, Terui K, Kitabayashi I, Ito E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "16628190", "url": "https://glygen.org/publication/PubMed/16628190" } ] }, { "title": "Integrin alpha3beta1, a novel receptor for alpha3(IV) noncollagenous domain and a trans-dominant Inhibitor for integrin alphavbeta3.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Borza CM, Pozzi A, Borza DB, Pedchenko V, Hellmark T, Hudson BG, Zent R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16731529", "url": "https://glygen.org/publication/PubMed/16731529" } ] }, { "title": "Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.", "journal": "Journal of proteome research", "date": "2006", "authors": "Ramachandran P, Boontheung P, Xie Y, Sondej M, Wong DT, Loo JA", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996#ptm_processing" }, { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "16740002", "url": "https://glygen.org/publication/PubMed/16740002" } ] }, { "title": "Collagen XVI harbors an integrin alpha1 beta1 recognition site in its C-terminal domains.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Eble JA, Kassner A, Niland S, Morgelin M, Grifka J, Grassel S", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16754661", "url": "https://glygen.org/publication/PubMed/16754661" } ] }, { "title": "The synergy site of fibronectin is required for strong interaction with the platelet integrin alphaIIbbeta3.", "journal": "Annals of biomedical engineering", "date": "2006", "authors": "Chada D, Mather T, Nollert MU", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16933105", "url": "https://glygen.org/publication/PubMed/16933105" } ] }, { "title": "Laminin alpha1 chain LG4 module promotes cell attachment through syndecans and cell spreading through integrin alpha2beta1.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Hozumi K, Suzuki N, Nielsen PK, Nomizu M, Yamada Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "16945929", "url": "https://glygen.org/publication/PubMed/16945929" } ] }, { "title": "The short arm of laminin gamma2 chain of laminin-5 (laminin-332) binds syndecan-1 and regulates cellular adhesion and migration by suppressing phosphorylation of integrin beta4 chain.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Ogawa T, Tsubota Y, Hashimoto J, Kariya Y, Miyazaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "17314405", "url": "https://glygen.org/publication/PubMed/17314405" } ] }, { "title": "Critical residues of alphaX I-domain recognizing fibrinogen central domain.", "journal": "Biochemical and biophysical research communications", "date": "2007", "authors": "Lee JH, Choi J, Nham SU", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "17339034", "url": "https://glygen.org/publication/PubMed/17339034" } ] }, { "title": "Sunitinib: a VEGF and PDGF receptor protein kinase and angiogenesis inhibitor.", "journal": "Biochemical and biophysical research communications", "date": "2007", "authors": "Roskoski R Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "17367763", "url": "https://glygen.org/publication/PubMed/17367763" } ] }, { "title": "Platelet-derived growth factor receptor-alpha: a novel therapeutic target in human hepatocellular cancer.", "journal": "Molecular cancer therapeutics", "date": "2007", "authors": "Stock P, Monga D, Tan X, Micsenyi A, Loizos N, Monga SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "17604334", "url": "https://glygen.org/publication/PubMed/17604334" } ] }, { "title": "E7080, a novel inhibitor that targets multiple kinases, has potent antitumor activities against stem cell factor producing human small cell lung cancer H146, based on angiogenesis inhibition.", "journal": "International journal of cancer", "date": "2008", "authors": "Matsui J, Yamamoto Y, Funahashi Y, Tsuruoka A, Watanabe T, Wakabayashi T, Uenaka T, Asada M", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "17943726", "url": "https://glygen.org/publication/PubMed/17943726" } ] }, { "title": "Involvement of alpha(v)beta3 integrins in osteoclast function.", "journal": "Journal of bone and mineral metabolism", "date": "2007", "authors": "Nakamura I, Duong LT, Rodan SB, Rodan GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "17968485", "url": "https://glygen.org/publication/PubMed/17968485" } ] }, { "title": "TSG-6 binds via its CUB_C domain to the cell-binding domain of fibronectin and increases fibronectin matrix assembly.", "journal": "Matrix Biol.", "date": "2008", "authors": "Kuznetsova Svetlana A, Mahoney David J, Martin-Manso Gema, Ali Tariq, Nentwich Hilke A, Sipes John M, Zeng Bixi, Vogel Tikva, Day Anthony J, Roberts David D", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "18042364", "url": "https://glygen.org/publication/PubMed/18042364" } ] }, { "title": "Heparin-induced cis- and trans-dimerization modes of the thrombospondin-1 N-terminal domain.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Tan K, Duquette M, Liu JH, Shanmugasundaram K, Joachimiak A, Gallagher JT, Rigby AC, Wang JH, Lawler J", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996#ptm_processing" }, { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "18065761", "url": "https://glygen.org/publication/PubMed/18065761" } ] }, { "title": "Extracellular matrix retention of thrombospondin 1 is controlled by its conserved C-terminal region.", "journal": "Journal of cell science", "date": "2008-03-15", "authors": "Adams Josephine C, Bentley Amber A, Kvansakul Marc, Hatherley Deborah, Hohenester Erhard", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "18285447", "url": "https://glygen.org/publication/PubMed/18285447" } ] }, { "title": "Methylation of RUNX1 by PRMT1 abrogates SIN3A binding and potentiates its transcriptional activity.", "journal": "Genes & development", "date": "2008", "authors": "Zhao X, Jankovic V, Gural A, Huang G, Pardanani A, Menendez S, Zhang J, Dunne R, Xiao A, Erdjument-Bromage H, Allis CD, Tempst P, Nimer SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "18316480", "url": "https://glygen.org/publication/PubMed/18316480" } ] }, { "title": "BIBF 1120: triple angiokinase inhibitor with sustained receptor blockade and good antitumor efficacy.", "journal": "Cancer research", "date": "2008", "authors": "Hilberg F, Roth GJ, Krssak M, Kautschitsch S, Sommergruber W, Tontsch-Grunt U, Garin-Chesa P, Bader G, Zoephel A, Quant J, Heckel A, Rettig WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "18559524", "url": "https://glygen.org/publication/PubMed/18559524" } ] }, { "title": "Peters'-plus syndrome is a congenital disorder of glycosylation caused by a defect in the beta1,3-glucosyltransferase that modifies thrombospondin type 1 repeats.", "journal": "Annals of medicine", "date": "2009", "authors": "Heinonen TY, Maki M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5083635", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5083635" } ], "reference": [ { "type": "PubMed", "id": "18720094", "url": "https://glygen.org/publication/PubMed/18720094" } ] }, { "title": "Differential interactions of thrombospondin-1, -2, and -4 with CD47 and effects on cGMP signaling and ischemic injury responses.", "journal": "The Journal of biological chemistry", "date": "2009-01-09", "authors": "Isenberg Jeff S, Annis Douglas S, Pendrak Michael L, Ptaszynska Malgorzata, Frazier William A, Mosher Deane F, Roberts David D", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "19004835", "url": "https://glygen.org/publication/PubMed/19004835" } ] }, { "title": "A regulatory interplay between miR-27a and Runx1 during megakaryopoiesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Ben-Ami O, Pencovich N, Lotem J, Levanon D, Groner Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "19114653", "url": "https://glygen.org/publication/PubMed/19114653" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996#ptm_processing" }, { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "Molecular interplay between endostatin, integrins, and heparan sulfate.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Faye C, Moreau C, Chautard E, Jetne R, Fukai N, Ruggiero F, Humphries MJ, Olsen BR, Ricard-Blum S", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "19502598", "url": "https://glygen.org/publication/PubMed/19502598" } ] }, { "title": "Thrombospondin-1 is a transcriptional repression target of PRMT6.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Michaud-Levesque J, Richard S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "19509293", "url": "https://glygen.org/publication/PubMed/19509293" } ] }, { "title": "The first draft of the endostatin interaction network.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Faye C, Chautard E, Olsen BR, Ricard-Blum S", "evidence": [ { "database": "MatrixDB", "id": "GAG_4", "url": "http://matrixdb.univ-lyon1.fr/cgi-bin/current/newPort?type=biomolecule&value=GAG_4" } ], "reference": [ { "type": "PubMed", "id": "19542224", "url": "https://glygen.org/publication/PubMed/19542224" } ] }, { "title": "Response to a novel multitargeted tyrosine kinase inhibitor pazopanib in metastatic Merkel cell carcinoma.", "journal": "Journal of clinical oncology : official journal of the American Society of Clinical Oncology", "date": "2009", "authors": "Davids MS, Charlton A, Ng SS, Chong ML, Laubscher K, Dar M, Hodge J, Soong R, Goh BC", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "19564526", "url": "https://glygen.org/publication/PubMed/19564526" } ] }, { "title": "Novel B3GALTL mutation in Peters-plus Syndrome.", "journal": "Clinical genetics", "date": "2009", "authors": "Dassie-Ajdid J, Causse A, Poidvin A, Granier M, Kaplan J, Burglen L, Doummar D, Teisseire P, Vigouroux A, Malecaze F, Calvas P, Chassaing N", "evidence": [ { "database": "Reactome", "id": "R-HSA-5173214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5173214" } ], "reference": [ { "type": "PubMed", "id": "19796186", "url": "https://glygen.org/publication/PubMed/19796186" } ] }, { "title": "Cartilage oligomeric matrix protein promotes cell attachment via two independent mechanisms involving CD47 and alphaVbeta3 integrin.", "journal": "Molecular and cellular biochemistry", "date": "2010", "authors": "Rock MJ, Holden P, Horton WA, Cohn DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "20033473", "url": "https://glygen.org/publication/PubMed/20033473" } ] }, { "title": "Thrombospondin-induced adhesion of human platelets.", "journal": "The Journal of clinical investigation", "date": "1991", "authors": "Tuszynski GP, Kowalska MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "2010551", "url": "https://glygen.org/publication/PubMed/2010551" } ] }, { "title": "AML1 is overexpressed in patients with myeloproliferative neoplasms and mediates JAK2V617F-independent overexpression of NF-E2.", "journal": "Blood", "date": "2010", "authors": "Wang W, Schwemmers S, Hexner EO, Pahl HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "20339092", "url": "https://glygen.org/publication/PubMed/20339092" } ] }, { "title": "Lumican inhibits cell migration through alpha2beta1 integrin.", "journal": "Experimental cell research", "date": "2010", "authors": "Zeltz C, Brezillon S, Kapyla J, Eble JA, Bobichon H, Terryn C, Perreau C, Franz CM, Heino J, Maquart FX, Wegrowski Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "20705068", "url": "https://glygen.org/publication/PubMed/20705068" } ] }, { "title": "Targeting the {alpha} receptor for platelet-derived growth factor as a primary or combination therapy in a preclinical model of prostate cancer skeletal metastasis.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2010", "authors": "Russell MR, Liu Q, Fatatis A", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "20813817", "url": "https://glygen.org/publication/PubMed/20813817" } ] }, { "title": "Regulation of platelet myosin light chain (MYL9) by RUNX1: implications for thrombocytopenia and platelet dysfunction in RUNX1 haplodeficiency.", "journal": "Blood", "date": "2010", "authors": "Jalagadugula G, Mao G, Kaur G, Goldfinger LE, Dhanasekaran DN, Rao AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "20876458", "url": "https://glygen.org/publication/PubMed/20876458" } ] }, { "title": "Mechanism of platelet factor 4 (PF4) deficiency with RUNX1 haplodeficiency: RUNX1 is a transcriptional regulator of PF4.", "journal": "Journal of thrombosis and haemostasis : JTH", "date": "2011", "authors": "Aneja K, Jalagadugula G, Mao G, Singh A, Rao AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "21129147", "url": "https://glygen.org/publication/PubMed/21129147" } ] }, { "title": "Inhibition of PDGF, TGF-beta, and Abl signaling and reduction of liver fibrosis by the small molecule Bcr-Abl tyrosine kinase antagonist Nilotinib.", "journal": "Journal of hepatology", "date": "2011", "authors": "Liu Y, Wang Z, Kwong SQ, Lui ELH, Friedman SL, Li FR, Lam RWC, Zhang GC, Zhang H, Ye T", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "21251937", "url": "https://glygen.org/publication/PubMed/21251937" } ] }, { "title": "Platelet protein kinase C-theta deficiency with human RUNX1 mutation: PRKCQ is a transcriptional target of RUNX1.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2011", "authors": "Jalagadugula G, Mao G, Kaur G, Dhanasekaran DN, Rao AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "21252065", "url": "https://glygen.org/publication/PubMed/21252065" } ] }, { "title": "Activation of multiple proto-oncogenic tyrosine kinases in breast cancer via loss of the PTPN12 phosphatase.", "journal": "Cell", "date": "2011", "authors": "Sun T, Aceto N, Meerbrey KL, Kessler JD, Zhou C, Migliaccio I, Nguyen DX, Pavlova NN, Botero M, Huang J, Bernardi RJ, Schmitt E, Hu G, Li MZ, Dephoure N, Gygi SP, Rao M, Creighton CJ, Hilsenbeck SG, Shaw CA, Muzny D, Gibbs RA, Wheeler DA, Osborne CK, Schiff R, Bentires-Alj M, Elledge SJ, Westbrook TF", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "21376233", "url": "https://glygen.org/publication/PubMed/21376233" } ] }, { "title": "Down-regulation of the RUNX1-target gene NR4A3 contributes to hematopoiesis deregulation in familial platelet disorder/acute myelogenous leukemia.", "journal": "Blood", "date": "2011", "authors": "Bluteau D, Gilles L, Hilpert M, Antony-Debre I, James C, Debili N, Camara-Clayette V, Wagner-Ballon O, Cordette-Lagarde V, Robert T, Ripoche H, Gonin P, Swierczek S, Prchal J, Vainchenker W, Favier R, Raslova H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "21725049", "url": "https://glygen.org/publication/PubMed/21725049" } ] }, { "title": "Modification of EGF-like module 1 of thrombospondin-1, an animal extracellular protein, by O-linked N-acetylglucosamine.", "journal": "PloS one", "date": "2012", "authors": "Hoffmann BR, Liu Y, Mosher DF", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07996", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07996" } ], "reference": [ { "type": "PubMed", "id": "22403705", "url": "https://glygen.org/publication/PubMed/22403705" } ] }, { "title": "Tetrastatin, the NC1 domain of the alpha4(IV) collagen chain: a novel potent anti-tumor matrikine.", "journal": "PloS one", "date": "2012", "authors": "Brassart-Pasco S, Senechal K, Thevenard J, Ramont L, Devy J, Di Stefano L, Dupont-Deshorgue A, Brezillon S, Feru J, Jazeron JF, Diebold MD, Ricard-Blum S, Maquart FX, Monboisse JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "22539938", "url": "https://glygen.org/publication/PubMed/22539938" } ] }, { "title": "Structure of human POFUT2: insights into thrombospondin type 1 repeat fold and O-fucosylation.", "journal": "The EMBO journal", "date": "2012", "authors": "Chen CI, Keusch JJ, Klein D, Hess D, Hofsteenge J, Gut H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5173214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5173214" } ], "reference": [ { "type": "PubMed", "id": "22588082", "url": "https://glygen.org/publication/PubMed/22588082" } ] }, { "title": "Histone arginine methylation keeps RUNX1 target genes in an intermediate state.", "journal": "Oncogene", "date": "2013", "authors": "Herglotz J, Kuvardina ON, Kolodziej S, Kumar A, Hussong H, Grez M, Lausen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "22777353", "url": "https://glygen.org/publication/PubMed/22777353" } ] }, { "title": "Target-derived matricryptins organize cerebellar synapse formation through alpha3beta1 integrins.", "journal": "Cell reports", "date": "2012", "authors": "Su J, Stenbjorn RS, Gorse K, Su K, Hauser KF, Ricard-Blum S, Pihlajaniemi T, Fox MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "22884367", "url": "https://glygen.org/publication/PubMed/22884367" } ] }, { "title": "Stromal platelet-derived growth factor receptor alpha (PDGFRalpha) provides a therapeutic target independent of tumor cell PDGFRalpha expression in lung cancer xenografts.", "journal": "Molecular cancer therapeutics", "date": "2012", "authors": "Gerber DE, Gupta P, Dellinger MT, Toombs JE, Peyton M, Duignan I, Malaby J, Bailey T, Burns C, Brekken RA, Loizos N", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "22933705", "url": "https://glygen.org/publication/PubMed/22933705" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "Glycoproteomic analysis of the secretome of human endothelial cells.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M", "evidence": [ { "database": "UniCarbKB", "id": "P07996", "url": "" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "reference": [ { "type": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "title": "Endorepellin laminin-like globular 1/2 domains bind Ig3-5 of vascular endothelial growth factor (VEGF) receptor 2 and block pro-angiogenic signaling by VEGFA in endothelial cells.", "journal": "The FEBS journal", "date": "2013", "authors": "Willis CD, Poluzzi C, Mongiat M, Iozzo RV", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "23374253", "url": "https://glygen.org/publication/PubMed/23374253" } ] }, { "title": "Pazopanib inhibits the activation of PDGFRbeta-expressing astrocytes in the brain metastatic microenvironment of breast cancer cells.", "journal": "The American journal of pathology", "date": "2013", "authors": "Gril B, Palmieri D, Qian Y, Anwar T, Liewehr DJ, Steinberg SM, Andreu Z, Masana D, Fernandez P, Steeg PS, Vidal-Vanaclocha F", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "23583652", "url": "https://glygen.org/publication/PubMed/23583652" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology.", "journal": "The EMBO journal", "date": "2013", "authors": "Steentoft C, Vakhrushev SY, Joshi HJ, Kong Y, Vester-Christensen MB, Schjoldager KT, Lavrsen K, Dabelsteen S, Pedersen NB, Marcos-Silva L, Gupta R, Bennett EP, Mandel U, Brunak S, Wandall HH, Levery SB, Clausen H", "evidence": [ { "database": "UniCarbKB", "id": "P07996", "url": "" } ], "reference": [ { "type": "PubMed", "id": "23584533", "url": "https://glygen.org/publication/PubMed/23584533" } ] }, { "title": "High precision platelet releasate definition by quantitative reversed protein profiling--brief report.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2013", "authors": "Wijten P, van Holten T, Woo LL, Bleijerveld OB, Roest M, Heck AJ, Scholten A", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "23640497", "url": "https://glygen.org/publication/PubMed/23640497" } ] }, { "title": "Novel B3GALTL mutations in classic Peters plus syndrome and lack of mutations in a large cohort of patients with similar phenotypes.", "journal": "Clinical genetics", "date": "2014", "authors": "Weh E, Reis LM, Tyler RC, Bick D, Rhead WJ, Wallace S, McGregor TL, Dills SK, Chao MC, Murray JC, Semina EV", "evidence": [ { "database": "Reactome", "id": "R-HSA-5173214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5173214" } ], "reference": [ { "type": "PubMed", "id": "23889335", "url": "https://glygen.org/publication/PubMed/23889335" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "The structure of human thrombospondin, an adhesive glycoprotein with multiple calcium-binding sites and homologies with several different proteins.", "journal": "The Journal of cell biology", "date": "1986-11", "authors": "Lawler J, Hynes R O", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "2430973", "url": "https://glygen.org/publication/PubMed/2430973" } ] }, { "title": "Thrombospondin-1 activation of signal-regulatory protein-\u03b1 stimulates reactive oxygen species production and promotes renal ischemia reperfusion injury.", "journal": "Journal of the American Society of Nephrology : JASN", "date": "2014-06", "authors": "Yao Mingyi, Rogers Natasha M, Cs\u00e1nyi G\u00e1bor, Rodriguez Andres I, Ross Mark A, St Croix Claudette, Knupp Heather, Novelli Enrico M, Thomson Angus W, Pagano Patrick J, Isenberg Jeffrey S", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "24511121", "url": "https://glygen.org/publication/PubMed/24511121" } ] }, { "title": "An integrin receptor on normal and thrombasthenic platelets that binds thrombospondin.", "journal": "Blood", "date": "1989", "authors": "Lawler J, Hynes R O", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "2478219", "url": "https://glygen.org/publication/PubMed/2478219" } ] }, { "title": "Crenolanib, a PDGFR inhibitor, suppresses lung cancer cell proliferation and inhibits tumor growth in vivo.", "journal": "OncoTargets and therapy", "date": "2014", "authors": "Wang P, Song L, Ge H, Jin P, Jiang Y, Hu W, Geng N", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "25328409", "url": "https://glygen.org/publication/PubMed/25328409" } ] }, { "title": "Characterization of the promoter region of the human thrombospondin gene. DNA sequences within the first intron increase transcription.", "journal": "J. Biol. Chem.", "date": "1989", "authors": "Laherty C D, Gierman T M, Dixit V M", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "2544587", "url": "https://glygen.org/publication/PubMed/2544587" } ] }, { "title": "Peters plus syndrome mutations disrupt a noncanonical ER quality-control mechanism.", "journal": "Current biology : CB", "date": "2015", "authors": "Vasudevan D, Takeuchi H, Johar SS, Majerus E, Haltiwanger RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5173214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5173214" } ], "reference": [ { "type": "PubMed", "id": "25544610", "url": "https://glygen.org/publication/PubMed/25544610" } ] }, { "title": "The FLT3 and PDGFR inhibitor crenolanib is a substrate of the multidrug resistance protein ABCB1 but does not inhibit transport function at pharmacologically relevant concentrations.", "journal": "Investigational new drugs", "date": "2015", "authors": "Mathias TJ, Natarajan K, Shukla S, Doshi KA, Singh ZN, Ambudkar SV, Baer MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "25597754", "url": "https://glygen.org/publication/PubMed/25597754" } ] }, { "title": "Probing the O-glycoproteome of gastric cancer cell lines for biomarker discovery.", "journal": "Molecular & cellular proteomics : MCP", "date": "2015", "authors": "Campos D, Freitas D, Gomes J, Magalhaes A, Steentoft C, Gomes C, Vester-Christensen MB, Ferreira JA, Afonso LP, Santos LL, Pinto de Sousa J, Mandel U, Clausen H, Vakhrushev SY, Reis CA", "evidence": [ { "database": "UniCarbKB", "id": "P07996", "url": "" } ], "reference": [ { "type": "PubMed", "id": "25813380", "url": "https://glygen.org/publication/PubMed/25813380" } ] }, { "title": "Loss of RUNX1/AML1 arginine-methylation impairs peripheral T cell homeostasis.", "journal": "British journal of haematology", "date": "2015", "authors": "Mizutani S, Yoshida T, Zhao X, Nimer SD, Taniwaki M, Okuda T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8936459", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459" } ], "reference": [ { "type": "PubMed", "id": "26010396", "url": "https://glygen.org/publication/PubMed/26010396" } ] }, { "title": "TSP1-CD47 signaling is upregulated in clinical pulmonary hypertension and contributes to pulmonary arterial vasculopathy and dysfunction.", "journal": "Cardiovasc. Res.", "date": "2017", "authors": "Rogers Natasha M, Sharifi-Sanjani Maryam, Yao Mingyi, Ghimire Kedar, Bienes-Martinez Raquel, Mutchler Stephanie M, Knupp Heather E, Baust Jeffrey, Novelli Enrico M, Ross Mark, St Croix Claudette, Kutten Johannes C, Czajka Caitlin A, Sembrat John C, Rojas Mauricio, Labrousse-Arias David, Bachman Timothy N, Vanderpool Rebecca R, Zuckerbraun Brian S, Champion Hunter C, Mora Ana L, Straub Adam C, Bilonick Richard A, Calzada Maria J, Isenberg Jeffrey S", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "27742621", "url": "https://glygen.org/publication/PubMed/27742621" } ] }, { "title": "Proteomics Analysis of O-GalNAc Glycosylation in Human Serum by an Integrated Strategy.", "journal": "Analytical chemistry", "date": "2017", "authors": "Qin H, Cheng K, Zhu J, Mao J, Wang F, Dong M, Chen R, Guo Z, Liang X, Ye M, Zou H", "evidence": [ { "database": "UniCarbKB", "id": "P07996", "url": "" } ], "reference": [ { "type": "PubMed", "id": "28035807", "url": "https://glygen.org/publication/PubMed/28035807" } ] }, { "title": "Inhibition of the platelet-derived growth factor receptor beta (PDGFRB) using gene silencing, crenolanib besylate, or imatinib mesylate hampers the malignant phenotype of mesothelioma cell lines.", "journal": "Genes & cancer", "date": "2017", "authors": "Melaiu O, Catalano C, De Santi C, Cipollini M, Figlioli G, Pelle L, Barone E, Evangelista M, Guazzelli A, Boldrini L, Sensi E, Bonotti A, Foddis R, Cristaudo A, Mutti L, Fontanini G, Gemignani F, Landi S", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "28435517", "url": "https://glygen.org/publication/PubMed/28435517" } ] }, { "title": "The matricellular protein TSP1 promotes human and mouse endothelial cell senescence through CD47 and Nox1.", "journal": "Science signaling", "date": "2017-10-17", "authors": "Meijles Daniel N, Sahoo Sanghamitra, Al Ghouleh Imad, Amaral Jefferson H, Bienes-Martinez Raquel, Knupp Heather E, Attaran Shireen, Sembrat John C, Nouraie Seyed M, Rojas Mauricio M, Novelli Enrico M, Gladwin Mark T, Isenberg Jeffrey S, Cifuentes-Pagano Eugenia, Pagano Patrick J", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "29042481", "url": "https://glygen.org/publication/PubMed/29042481" } ] }, { "title": "A precision therapy against cancers driven by KIT/PDGFRA mutations.", "journal": "Science translational medicine", "date": "2017", "authors": "Evans EK, Gardino AK, Kim JL, Hodous BL, Shutes A, Davis A, Zhu XJ, Schmidt-Kittler O, Wilson D, Wilson K, DiPietro L, Zhang Y, Brooijmans N, LaBranche TP, Wozniak A, Gebreyohannes YK, Schoffski P, Heinrich MC, DeAngelo DJ, Miller S, Wolf B, Kohl N, Guzi T, Lydon N, Boral A, Lengauer C", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "29093181", "url": "https://glygen.org/publication/PubMed/29093181" } ] }, { "title": "The PDGF/PDGFR pathway as a drug target.", "journal": "Molecular aspects of medicine", "date": "2018", "authors": "Papadopoulos N, Lennartsson J", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "29137923", "url": "https://glygen.org/publication/PubMed/29137923" } ] }, { "title": "Complete thrombospondin mRNA sequence includes potential regulatory sites in the 3' untranslated region.", "journal": "J. Cell Biol.", "date": "1989", "authors": "Hennessy S W, Frazier B A, Kim D D, Deckwerth T L, Baumgartel D M, Rotwein P, Frazier W A", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "2918029", "url": "https://glygen.org/publication/PubMed/2918029" } ] }, { "title": "Triple Angiokinase Inhibitor Nintedanib Directly Inhibits Tumor Cell Growth and Induces Tumor Shrinkage via Blocking Oncogenic Receptor Tyrosine Kinases.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2018", "authors": "Hilberg F, Tontsch-Grunt U, Baum A, Le AT, Doebele RC, Lieb S, Gianni D, Voss T, Garin-Chesa P, Haslinger C, Kraut N", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "29263244", "url": "https://glygen.org/publication/PubMed/29263244" } ] }, { "title": "Mapping and Quantification of Over 2000 O-linked Glycopeptides in Activated Human T Cells with Isotope-Targeted Glycoproteomics (Isotag).", "journal": "Molecular & cellular proteomics : MCP", "date": "2018", "authors": "Woo CM, Lund PJ, Huang AC, Davis MM, Bertozzi CR, Pitteri SJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07996", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07996" }, { "database": "O-GlcNAc Atlas", "id": "P07996", "url": "https://oglcnac.org/atlas/detail/P07996" } ], "reference": [ { "type": "PubMed", "id": "29351928", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "title": "Large-scale intact glycopeptide identification by Mascot database search.", "journal": "Scientific reports", "date": "2018", "authors": "Bollineni RC, Koehler CJ, Gislefoss RE, Anonsen JH, Thiede B", "evidence": [ { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "reference": [ { "type": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "title": "The role of small molecule platelet-derived growth factor receptor (PDGFR) inhibitors in the treatment of neoplastic disorders.", "journal": "Pharmacological research", "date": "2018", "authors": "Roskoski R Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "29408302", "url": "https://glygen.org/publication/PubMed/29408302" } ] }, { "title": "Cell surface proteoglycan binds mouse mammary epithelial cells to fibronectin and behaves as a receptor for interstitial matrix.", "journal": "The Journal of cell biology", "date": "1988", "authors": "Saunders S, Bernfield M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "2963012", "url": "https://glygen.org/publication/PubMed/2963012" } ] }, { "title": "Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and alpha-1B-Glycoprotein.", "journal": "Analytical chemistry", "date": "2018", "authors": "Sun S, Hu Y, Jia L, Eshghi ST, Liu Y, Shah P, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P07996", "url": "" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "reference": [ { "type": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P07996", "url": "" }, { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Structural and clinical consequences of activation loop mutations in class III receptor tyrosine kinases.", "journal": "Pharmacology & therapeutics", "date": "2018", "authors": "Klug LR, Kent JD, Heinrich MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "29964125", "url": "https://glygen.org/publication/PubMed/29964125" } ] }, { "title": "Partial amino acid sequence of human thrombospondin as determined by analysis of cDNA clones: homology to malarial circumsporozoite proteins.", "journal": "Biochemistry", "date": "1986", "authors": "Kobayashi S, Eden-McCutchan F, Framson P, Bornstein P", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "3030396", "url": "https://glygen.org/publication/PubMed/3030396" } ] }, { "title": "Neomorphic PDGFRA extracellular domain driver mutations are resistant to PDGFRA targeted therapies.", "journal": "Nature communications", "date": "2018", "authors": "Ip CKM, Ng PKS, Jeong KJ, Shao SH, Ju Z, Leonard PG, Hua X, Vellano CP, Woessner R, Sahni N, Scott KL, Mills GB", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "30389923", "url": "https://glygen.org/publication/PubMed/30389923" } ] }, { "title": "Ripretinib (DCC-2618) Is a Switch Control Kinase Inhibitor of a Broad Spectrum of Oncogenic and Drug-Resistant KIT and PDGFRA Variants.", "journal": "Cancer cell", "date": "2019", "authors": "Smith BD, Kaufman MD, Lu WP, Gupta A, Leary CB, Wise SC, Rutkoski TJ, Ahn YM, Al-Ani G, Bulfer SL, Caldwell TM, Chun L, Ensinger CL, Hood MM, McKinley A, Patt WC, Ruiz-Soto R, Su Y, Telikepalli H, Town A, Turner BA, Vogeti L, Vogeti S, Yates K, Janku F, Abdul Razak AR, Rosen O, Heinrich MC, Flynn DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "31085175", "url": "https://glygen.org/publication/PubMed/31085175" } ] }, { "title": "Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes.", "journal": "Journal of proteome research", "date": "2020", "authors": "Zhu J, Lin YH, Dingess KA, Mank M, Stahl B, Heck AJR", "evidence": [ { "database": "GlyConnect", "id": "594", "url": "https://glyconnect.expasy.org/browser/proteins/594" } ], "reference": [ { "type": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "title": "CD47 Promotes Age-Associated Deterioration in Angiogenesis, Blood Flow and Glucose Homeostasis.", "journal": "Cells", "date": "2020-07-15", "authors": "Ghimire Kedar, Li Yao, Chiba Takuto, Julovi Sohel M, Li Jennifer, Ross Mark A, Straub Adam C, O'Connell Philip J, R\u00fcegg Curzio, Pagano Patrick J, Isenberg Jeffrey S, Rogers Natasha M", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "32679764", "url": "https://glygen.org/publication/PubMed/32679764" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07996", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07996" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07996", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07996" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Characterization of a cDNA encoding the heparin and collagen binding domains of human thrombospondin.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1986", "authors": "Dixit V M, Hennessy S W, Grant G A, Rotwein P, Frazier W A", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "3461443", "url": "https://glygen.org/publication/PubMed/3461443" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07996", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07996" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "Pericardial Adipose Tissue Thrombospondin-1 Associates With Antiangiogenesis in Ischemic Heart Disease.", "journal": "The American journal of cardiology", "date": "2024-01-01", "authors": "Ahmed Bulbul, Farb Melissa G, Karki Shakun, D'Alessandro Sophia, Edwards Niloo M, Gokce Noyan", "evidence": [ { "database": "RefSeq", "id": "NP_003237", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003237" } ], "reference": [ { "type": "PubMed", "id": "37863116", "url": "https://glygen.org/publication/PubMed/37863116" } ] }, { "title": "A-296G variant of THBS1 gene (rs1478605) is associated with a lower frequency of stroke in a Brazilian population with sickle cell anemia.", "journal": "Journal of stroke and cerebrovascular diseases : the official journal of National Stroke Association", "date": "2024-01", "authors": "Oliveira Jessica M F, Arcanjo Gabriela S, Domingos Igor F, Batista J\u00e9ssica V G F, Pereira-Martins Diego A, Batista Thais H C, Hatzlhofer Bet\u00e2nia L D, Falc\u00e3o Diego A, Diniz Madi V, Silva Alexsandro P, Pires B\u00e1rbara C V, Dos Anjos Ana C, Costa Fernando F, Araujo Aderson S, Lucena-Araujo Antonio R, Bezerra Marcos A", "evidence": [ { "database": "RefSeq", "id": "NP_003237", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003237" } ], "reference": [ { "type": "PubMed", "id": "38006767", "url": "https://glygen.org/publication/PubMed/38006767" } ] }, { "title": "LncRNA MIR217HG aggravates pressure-overload induced cardiac remodeling by activating miR-138/THBS1 pathway.", "journal": "Life sciences", "date": "2024-01-01", "authors": "Nie Xiang, Xie Rong, Fan Jiahui, Wang Dao Wen", "evidence": [ { "database": "RefSeq", "id": "NP_003237", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003237" } ], "reference": [ { "type": "PubMed", "id": "38013141", "url": "https://glygen.org/publication/PubMed/38013141" } ] }, { "title": "Inhibitory receptor CD47 binding to plasma TSP1 suppresses NK-cell IFN-\u03b3 production via activating the JAK/STAT3 pathway during HIV infection.", "journal": "Journal of translational medicine", "date": "2023-11-30", "authors": "Lang Bin, Wang Meiting, Zhang Zining, Fu Yajing, Han Xiaoxu, Hu Qinghai, Ding Haibo, Shang Hong, Jiang Yongjun", "evidence": [ { "database": "RefSeq", "id": "NP_003237", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003237" } ], "reference": [ { "type": "PubMed", "id": "38037074", "url": "https://glygen.org/publication/PubMed/38037074" } ] }, { "title": "Thrombospondin-1 promotes liver fibrosis by enhancing TGF-\u03b2 action in hepatic stellate cells.", "journal": "Biochemical and biophysical research communications", "date": "2024-01-22", "authors": "Imamori Makoto, Hosooka Tetsuya, Imi Yukiko, Hosokawa Yusei, Yamaguchi Kanji, Itoh Yoshito, Ogawa Wataru", "evidence": [ { "database": "RefSeq", "id": "NP_003237", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003237" } ], "reference": [ { "type": "PubMed", "id": "38091840", "url": "https://glygen.org/publication/PubMed/38091840" } ] }, { "title": "Cultured human fibroblasts synthesize and secrete thrombospondin and incorporate it into extracellular matrix.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1983", "authors": "Jaffe E A, Ruggiero J T, Leung L K, Doyle M J, McKeown-Longo P J, Mosher D F", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "6341993", "url": "https://glygen.org/publication/PubMed/6341993" } ] }, { "title": "Characterization of the proteins of isolated human platelet alpha-granules. Evidence for a separate alpha-granule-pool of the glycoproteins IIb and IIIa.", "journal": "Biochimica et biophysica acta", "date": "1981", "authors": "Gogstad GO, Hagen I, Korsmo R, Solum NO", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "6457647", "url": "https://glygen.org/publication/PubMed/6457647" } ] }, { "title": "Thrombospondin interactions with fibronectin and fibrinogen. Mutual inhibition in binding.", "journal": "European journal of biochemistry", "date": "1984-11-15", "authors": "Lahav J, Lawler J, Gimbrone M A", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "6489349", "url": "https://glygen.org/publication/PubMed/6489349" } ] }, { "title": "Interactions of thrombospondin with extracellular matrix proteins: selective binding to type V collagen.", "journal": "J. Cell Biol.", "date": "1984", "authors": "Mumby S M, Raugi G J, Bornstein P", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "6693501", "url": "https://glygen.org/publication/PubMed/6693501" } ] }, { "title": "Ca2+-mediated association of glycoprotein G (thrombin-sensitive protein, thrombospondin) with human platelets.", "journal": "J. Biol. Chem.", "date": "1980", "authors": "Phillips D R, Jennings L K, Prasanna H R", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "6777381", "url": "https://glygen.org/publication/PubMed/6777381" } ] }, { "title": "Solid-phase von Willebrand factor contains a conformationally active RGD motif that mediates endothelial cell adhesion through the alpha v beta 3 receptor.", "journal": "Blood", "date": "1993", "authors": "Denis C, Williams JA, Lu X, Meyer D, Baruch D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "7505120", "url": "https://glygen.org/publication/PubMed/7505120" } ] }, { "title": "Integrin alpha v beta 8. Interaction with vitronectin and functional divergence of the beta 8 cytoplasmic domain.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Nishimura SL, Sheppard D, Pytela R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "7525578", "url": "https://glygen.org/publication/PubMed/7525578" } ] }, { "title": "The integrin receptor alpha 8 beta 1 mediates interactions of embryonic chick motor and sensory neurons with tenascin-C.", "journal": "Neuron", "date": "1995", "authors": "Varnum-Finney B, Venstrom K, Muller U, Kypta R, Backus C, Chiquet M, Reichardt LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "7541634", "url": "https://glygen.org/publication/PubMed/7541634" } ] }, { "title": "CD31/PECAM-1 is a ligand for alpha v beta 3 integrin involved in adhesion of leukocytes to endothelium.", "journal": "The Journal of cell biology", "date": "1995", "authors": "Piali L, Hammel P, Uherek C, Bachmann F, Gisler RH, Dunon D, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "7542249", "url": "https://glygen.org/publication/PubMed/7542249" } ] }, { "title": "The human integrin alpha 8 beta 1 functions as a receptor for tenascin, fibronectin, and vitronectin.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Schnapp LM, Hatch N, Ramos DM, Klimanskaya IV, Sheppard D, Pytela R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "7559467", "url": "https://glygen.org/publication/PubMed/7559467" } ] }, { "title": "The alpha v beta 5 integrin receptor regulates receptor-mediated endocytosis of vitronectin.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Panetti TS, McKeown-Longo PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "7685013", "url": "https://glygen.org/publication/PubMed/7685013" } ] }, { "title": "Platelet adhesion to collagen types I through VIII under conditions of stasis and flow is mediated by GPIa/IIa (alpha 2 beta 1-integrin).", "journal": "Blood", "date": "1994", "authors": "Saelman EU, Nieuwenhuis HK, Hese KM, de Groot PG, Heijnen HF, Sage EH, Williams S, McKeown L, Gralnick HR, Sixma JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8118028", "url": "https://glygen.org/publication/PubMed/8118028" } ] }, { "title": "Interaction of type IV collagen with the isolated integrins alpha 1 beta 1 and alpha 2 beta 1.", "journal": "European journal of biochemistry", "date": "1993", "authors": "Kern A, Eble J, Golbik R, Kuhn K", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8344274", "url": "https://glygen.org/publication/PubMed/8344274" } ] }, { "title": "Platelet alpha-granules.", "journal": "Blood reviews", "date": "1993", "authors": "Harrison P, Cramer EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "8467233", "url": "https://glygen.org/publication/PubMed/8467233" } ] }, { "title": "Integrin-associated protein is a receptor for the C-terminal domain of thrombospondin.", "journal": "The Journal of biological chemistry", "date": "1996-01-05", "authors": "Gao A G, Lindberg F P, Finn M B, Blystone S D, Brown E J, Frazier W A", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "reference": [ { "type": "PubMed", "id": "8550562", "url": "https://glygen.org/publication/PubMed/8550562" } ] }, { "title": "Receptor-ligand interaction between CD44 and osteopontin (Eta-1).", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Weber GF, Ashkar S, Glimcher MJ, Cantor H", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8560266", "url": "https://glygen.org/publication/PubMed/8560266" } ] }, { "title": "Stimulation of fibroblast growth factor receptor-1 occupancy and signaling by cell surface-associated syndecans and glypican.", "journal": "The Journal of cell biology", "date": "1996", "authors": "Steinfeld R, Van Den Berghe H, David G", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "8609172", "url": "https://glygen.org/publication/PubMed/8609172" } ] }, { "title": "Differential effects of the integrins alpha9beta1, alphavbeta3, and alphavbeta6 on cell proliferative responses to tenascin. Roles of the beta subunit extracellular and cytoplasmic domains.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Yokosaki Y, Monis H, Chen J, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8798654", "url": "https://glygen.org/publication/PubMed/8798654" } ] }, { "title": "Identification of alpha v beta 3 as a heterotypic ligand for CD31/PECAM-1.", "journal": "Journal of cell science", "date": "1996", "authors": "Buckley CD, Doyonnas R, Newton JP, Blystone SD, Brown EJ, Watt SM, Simmons DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8838667", "url": "https://glygen.org/publication/PubMed/8838667" } ] }, { "title": "Type I, II, III, IV, V, and VI collagens serve as extracellular ligands for the isoforms of platelet-derived growth factor (AA, BB, and AB).", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Somasundaram R, Schuppan D", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "8900172", "url": "https://glygen.org/publication/PubMed/8900172" } ] }, { "title": "Osteopontin N-terminal domain contains a cryptic adhesive sequence recognized by alpha9beta1 integrin.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Smith LL, Cheung HK, Ling LE, Chen J, Sheppard D, Pytela R, Giachelli CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8910476", "url": "https://glygen.org/publication/PubMed/8910476" } ] }, { "title": "Multimerization of the cytoplasmic domain of syndecan-4 is required for its ability to activate protein kinase C.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Oh ES, Woods A, Couchman JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "9115237", "url": "https://glygen.org/publication/PubMed/9115237" } ] }, { "title": "The alpha v beta 3 integrin `vitronectin receptor`.", "journal": "The international journal of biochemistry & cell biology", "date": "1997", "authors": "Horton MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "9251239", "url": "https://glygen.org/publication/PubMed/9251239" } ] }, { "title": "Interaction of platelet-derived growth factor with thrombospondin 1.", "journal": "The Biochemical journal", "date": "1997", "authors": "Hogg PJ, Hotchkiss KA, Jimenez BM, Stathakis P, Chesterman CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "9334164", "url": "https://glygen.org/publication/PubMed/9334164" } ] }, { "title": "The alphavbeta5 integrin functions as an endocytic receptor for vitronectin.", "journal": "Journal of cell science", "date": "1998", "authors": "Memmo LM, McKeown-Longo P", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "9443892", "url": "https://glygen.org/publication/PubMed/9443892" } ] }, { "title": "Identification of the ligand binding site for the integrin alpha9 beta1 in the third fibronectin type III repeat of tenascin-C.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Yokosaki Y, Matsuura N, Higashiyama S, Murakami I, Obara M, Yamakido M, Shigeto N, Chen J, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "9565552", "url": "https://glygen.org/publication/PubMed/9565552" } ] }, { "title": "Signal transduction via platelet-derived growth factor receptors.", "journal": "Biochimica et biophysica acta", "date": "1998", "authors": "Heldin CH, Ostman A, Ronnstrand L", "evidence": [ { "database": "Reactome", "id": "R-HSA-186797", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797" } ], "reference": [ { "type": "PubMed", "id": "9739761", "url": "https://glygen.org/publication/PubMed/9739761" } ] }, { "title": "Effect of the interaction between fibronectin and VLA-4 on the proliferation of human B cells, especially a novel human B-cell line, OPM-3.", "journal": "British journal of haematology", "date": "1998", "authors": "Yoshida H, Nishiura T, Karasuno T, Matsumura I, Ishikawa J, Yoshimura M, Yokota T, Okajima Y, Ogawa M, Kanakura Y, Tomiyama Y, Matsuzawa Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "9858236", "url": "https://glygen.org/publication/PubMed/9858236" } ] } ], "pathway": [ { "id": "hsa:7057", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7057", "resource": "KEGG Pathway" }, { "id": "R-HSA-114608", "name": "Platelet degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608", "resource": "Reactome", "description": "Platelet degranulation" }, { "id": "R-HSA-186797", "name": "Signaling by PDGF", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-186797", "resource": "Reactome", "description": "Signaling by PDGF" }, { "id": "R-HSA-216083", "name": "Integrin cell surface interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083", "resource": "Reactome", "description": "Integrin cell surface interactions" }, { "id": "R-HSA-3000170", "name": "Syndecan interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170", "resource": "Reactome", "description": "Syndecan interactions" }, { "id": "R-HSA-5083635", "name": "Defective B3GALTL causes PpS", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5083635", "resource": "Reactome", "description": "Defective B3GALTL causes PpS" }, { "id": "R-HSA-5173214", "name": "O-glycosylation of TSR domain-containing proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5173214", "resource": "Reactome", "description": "O-glycosylation of TSR domain-containing proteins" }, { "id": "R-HSA-8936459", "name": "RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8936459", "resource": "Reactome", "description": "RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0G2JV24-1", "protein_name": "Thrombospondin 1", "gene_name": "Thbs1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MELLRGLGVLFLLHVCGSNRIPESGGDNGVFDIFELIGGARKVPGRRLVKGQDLSSPAFRIENANLIPPVPDDKFQDLLDAVWADKGFIFLASLRQMKKTRGTLLAVERKDNSGQIFSVVSNGKAGTLDLSLSLPGKQQVVSVEEALLATGQWKSITLFVQEDRAQLYIDCDKMESAELDVPIQSIFTRDLANVARLRVAKGDVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSATNVLLTLDNNVVNGSSPAIRTNYIGHKTKDLQAICGLSCDELSSMVLELRGLRTIVTTLQDSIRKVTEENRELASELRRPPLCFHNGVQYRNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCSNATVPDGECCPRCWPSDSADDGWSPWSEWTSCSATCGNGIQQRGRSCDSLNNRCEGSSVQTRTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARETKACKKDACPINGGWSPWSLWDICSVTCGGGVQRRSRLCNNPTPQFGGKDCVGDVTENQVCNKQDCPIDGCLSNPCFAGAKCTSYPDGSWKCGACPPGYSGNGIQCKDVDECKEVPDACFNHNGEHRCKNTDPGYNCLPCPPRFTGSQPFGRGVEHAMANKQVCKPRNPCTDGTHDCNKNAKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPNLPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYNHNPDQADTDNNGEGDACAVDIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEHNPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDNDGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDNVPDIDDICPENVDISETDFRRFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYDKTYAGGRLGLFVFSQEMVFFSDMKYECRDS", "length": 1171 }, "evidence": [ { "id": "P07996", "url": "https://omabrowser.org/oma/group/P07996/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P35441-1", "protein_name": "Thrombospondin-1", "gene_name": "Thbs1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MELLRGLGVLFLLHMCGSNRIPESGGDNGVFDIFELIGGARRGPGRRLVKGQDLSSPAFRIENANLIPAVPDDKFQDLLDAVWADKGFIFLASLRQMKKTRGTLLAVERKDNTGQIFSVVSNGKAGTLDLSLSLPGKQQVVSVEEALLATGQWKSITLFVQEDRAQLYIDCDKMESAELDVPIQSIFTRDLASVARLRVAKGDVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTNVLLTLDNNVVNGSSPAIRTNYIGHKTKDLQAICGLSCDELSSMVLELKGLRTIVTTLQDSIRKVTEENRELVSELKRPPLCFHNGVQYKNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCSNATVPDGECCPRCWPSDSADDGWSPWSEWTSCSATCGNGIQQRGRSCDSLNNRCEGSSVQTRTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARETKACKKDACPINGGWGPWSPWDICSVTCGGGVQRRSRLCNNPTPQFGGKDCVGDVTENQVCNKQDCPIDGCLSNPCFAGAKCTSYPDGSWKCGACPPGYSGNGIQCKDVDECKEVPDACFNHNGEHRCKNTDPGYNCLPCPPRFTGSQPFGRGVEHAMANKQVCKPRNPCTDGTHDCNKNAKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPNLPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYNHNPDQADTDKNGEGDACAVDIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEHNPDQLDSDSDLIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDNDGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDNVPDIDDICPENFDISETDFRRFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGYIRVVMYEGKKIMADSGPIYDKTYAGGRLGLFVFSQEMVFFSDMKYECRDS", "length": 1170 }, "evidence": [ { "id": "45920210", "url": "http://www.informatics.jax.org/homology/45920210", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 67, "go_terms": [ { "name": "positive regulation of macrophage activation", "id": "GO:0043032", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043032", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "negative regulation of cell migration involved in sprouting angiogenesis", "id": "GO:0090051", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090051", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "negative regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis", "id": "GO:1903588", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903588", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "positive regulation of transforming growth factor beta1 production", "id": "GO:0032914", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032914", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "inflammatory response", "id": "GO:0006954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "immune response", "id": "GO:0006955", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006955", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "cell adhesion", "id": "GO:0007155", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007155", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "negative regulation of cell population proliferation", "id": "GO:0008285", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008285", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "cell migration", "id": "GO:0016477", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016477", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "positive regulation of cell migration", "id": "GO:0030335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030335", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "negative regulation of apoptotic process", "id": "GO:0043066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "response to calcium ion", "id": "GO:0051592", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051592", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction", "id": "GO:0051897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051897", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "response to hypoxia", "id": "GO:0001666", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001666", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "apoptotic process", "id": "GO:0006915", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006915", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "positive regulation of endothelial cell migration", "id": "GO:0010595", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010595", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "cellular response to heat", "id": "GO:0034605", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034605", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "negative regulation of cysteine-type endopeptidase activity involved in apoptotic process", "id": "GO:0043154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043154", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "positive regulation of angiogenesis", "id": "GO:0045766", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045766", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "negative regulation of cell-matrix adhesion", "id": "GO:0001953", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001953", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "response to mechanical stimulus", "id": "GO:0009612", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009612", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "negative regulation of plasminogen activation", "id": "GO:0010757", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010757", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "response to progesterone", "id": "GO:0032570", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032570", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "positive regulation of MAP kinase activity", "id": "GO:0043406", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043406", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "positive regulation of smooth muscle cell proliferation", "id": "GO:0048661", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048661", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "negative regulation of fibrinolysis", "id": "GO:0051918", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051918", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "cellular response to growth factor stimulus", "id": "GO:0071363", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071363", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "negative regulation of endothelial cell proliferation", "id": "GO:0001937", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001937", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "negative regulation of blood vessel endothelial cell migration", "id": "GO:0043537", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043537", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "positive regulation of reactive oxygen species metabolic process", "id": "GO:2000379", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000379", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "negative regulation of angiogenesis", "id": "GO:0016525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016525", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "positive regulation of transforming growth factor beta receptor signaling pathway", "id": "GO:0030511", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030511", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "positive regulation of tumor necrosis factor production", "id": "GO:0032760", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032760", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "negative regulation of endothelial cell migration", "id": "GO:0010596", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010596", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "peptide cross-linking", "id": "GO:0018149", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018149", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "negative regulation of focal adhesion assembly", "id": "GO:0051895", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051895", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "response to glucose", "id": "GO:0009749", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009749", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "positive regulation of phosphorylation", "id": "GO:0042327", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042327", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "positive regulation of blood vessel endothelial cell migration", "id": "GO:0043536", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043536", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "positive regulation of translation", "id": "GO:0045727", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045727", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "sprouting angiogenesis", "id": "GO:0002040", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002040", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "positive regulation of blood coagulation", "id": "GO:0030194", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030194", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "positive regulation of extrinsic apoptotic signaling pathway via death domain receptors", "id": "GO:1902043", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902043", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "negative regulation of extrinsic apoptotic signaling pathway", "id": "GO:2001237", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001237", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "negative regulation of long-chain fatty acid import across plasma membrane", "id": "GO:0010748", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010748", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "engulfment of apoptotic cell", "id": "GO:0043652", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043652", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "positive regulation of endothelial cell apoptotic process", "id": "GO:2000353", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000353", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "response to xenobiotic stimulus", "id": "GO:0009410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009410", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "positive regulation of fibroblast migration", "id": "GO:0010763", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010763", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "cellular response to tumor necrosis factor", "id": "GO:0071356", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071356", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "negative regulation of interleukin-12 production", "id": "GO:0032695", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032695", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "response to endoplasmic reticulum stress", "id": "GO:0034976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034976", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "chronic inflammatory response", "id": "GO:0002544", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002544", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "behavioral response to pain", "id": "GO:0048266", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048266", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "negative regulation of fibroblast growth factor receptor signaling pathway", "id": "GO:0040037", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0040037", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "response to unfolded protein", "id": "GO:0006986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006986", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "negative regulation of nitric oxide mediated signal transduction", "id": "GO:0010751", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010751", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "positive regulation of chemotaxis", "id": "GO:0050921", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050921", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "response to testosterone", "id": "GO:0033574", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033574", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "response to magnesium ion", "id": "GO:0032026", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032026", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "positive regulation of macrophage chemotaxis", "id": "GO:0010759", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010759", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "negative regulation of dendritic cell antigen processing and presentation", "id": "GO:0002605", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002605", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "negative regulation of endothelial cell chemotaxis", "id": "GO:2001027", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001027", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "negative regulation of sprouting angiogenesis", "id": "GO:1903671", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903671", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "negative regulation of antigen processing and presentation of peptide or polysaccharide antigen via MHC class II", "id": "GO:0002581", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002581", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "negative regulation of cGMP-mediated signaling", "id": "GO:0010754", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010754", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 16, "go_terms": [ { "name": "protease binding", "id": "GO:0002020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002020", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "integrin binding", "id": "GO:0005178", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005178", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "heparin binding", "id": "GO:0008201", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008201", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "laminin binding", "id": "GO:0043236", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043236", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "endopeptidase inhibitor activity", "id": "GO:0004866", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004866", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "transforming growth factor beta binding", "id": "GO:0050431", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050431", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "phosphatidylserine binding", "id": "GO:0001786", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001786", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "proteoglycan binding", "id": "GO:0043394", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043394", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "fibronectin binding", "id": "GO:0001968", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001968", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "fibroblast growth factor binding", "id": "GO:0017134", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017134", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "low-density lipoprotein particle binding", "id": "GO:0030169", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030169", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "collagen V binding", "id": "GO:0070052", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070052", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "extracellular matrix structural constituent", "id": "GO:0005201", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005201", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "fibrinogen binding", "id": "GO:0070051", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070051", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 14, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "endoplasmic reticulum lumen", "id": "GO:0005788", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005788", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "secretory granule", "id": "GO:0030141", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030141", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "extracellular matrix", "id": "GO:0031012", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031012", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "platelet alpha granule lumen", "id": "GO:0031093", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031093", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "external side of plasma membrane", "id": "GO:0009897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "fibrinogen complex", "id": "GO:0005577", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005577", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "sarcoplasmic reticulum", "id": "GO:0016529", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016529", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "platelet alpha granule", "id": "GO:0031091", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031091", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" }, { "name": "collagen-containing extracellular matrix", "id": "GO:0062023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062023", "evidence": [ { "database": "UniProtKB", "id": "P07996", "url": "https://www.uniprot.org/uniprot/P07996" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "thrombospondin-1 N-glycosylated 1 (human)", "definition": "A thrombospondin-1 (human) that has been N-glycosylated at the residue equivalent to Asn-1067 of the amino acid sequence represented by UniProtKB:P07996-1, in which the glycan composition is represented by GlyTouCan:G09197ZW. Example: UniProtKB:P07996-1, Asn-1067, MOD:00160~GNO:G09197ZW. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054414", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054414" } ] }, { "name": "thrombospondin-1 N-glycosylated 2 (human)", "definition": "A thrombospondin-1 (human) that has been N-glycosylated at the residue equivalent to Asn-1067 of the amino acid sequence represented by UniProtKB:P07996-1, in which the glycan composition is represented by GlyTouCan:G16175ZV. Example: UniProtKB:P07996-1, Asn-1067, MOD:00160~GNO:G16175ZV. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054415", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054415" } ] }, { "name": "thrombospondin-1 N-glycosylated 3 (human)", "definition": "A thrombospondin-1 (human) that has been N-glycosylated at the residue equivalent to Asn-1067 of the amino acid sequence represented by UniProtKB:P07996-1, in which the glycan composition is represented by GlyTouCan:G22018FP. Example: UniProtKB:P07996-1, Asn-1067, MOD:00160~GNO:G22018FP. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054416", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054416" } ] }, { "name": "thrombospondin-1 N-glycosylated 4 (human)", "definition": "A thrombospondin-1 (human) that has been N-glycosylated at the residue equivalent to Asn-1067 of the amino acid sequence represented by UniProtKB:P07996-1, in which the glycan composition is represented by GlyTouCan:G27126ED. Example: UniProtKB:P07996-1, Asn-1067, MOD:00160~GNO:G27126ED. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054417", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054417" } ] }, { "name": "thrombospondin-1 N-glycosylated 5 (human)", "definition": "A thrombospondin-1 (human) that has been N-glycosylated at the residue equivalent to Asn-1067 of the amino acid sequence represented by UniProtKB:P07996-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P07996-1, Asn-1067, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:23345538, PMID:29671580]", "evidence": [ { "id": "PR:000054418", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054418" } ] }, { "name": "thrombospondin-1 N-glycosylated 6 (human)", "definition": "A thrombospondin-1 (human) that has been N-glycosylated at the residue equivalent to Asn-360 of the amino acid sequence represented by UniProtKB:P07996-1, in which the glycan composition is represented by GlyTouCan:G87051GH. Example: UniProtKB:P07996-1, Asn-360, MOD:00160~GNO:G87051GH. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054419", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054419" } ] } ], "site_annotation": [ { "start_pos": 1067, "end_pos": 1069, "annotation": "n_glycosylation_sequon" }, { "start_pos": 248, "end_pos": 250, "annotation": "n_glycosylation_sequon" }, { "start_pos": 360, "end_pos": 362, "annotation": "n_glycosylation_sequon" }, { "start_pos": 708, "end_pos": 710, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [ { "interactor_id": "G19059PI", "interaction_name": "matrixdb:Chondroitin Sulfate A(short label)", "interaction_type": "Glycosaminoglycan", "evidence": [ { "database": "MatrixDB", "id": "GAG_4", "url": "http://matrixdb.univ-lyon1.fr/cgi-bin/current/newPort?type=biomolecule&value=GAG_4" }, { "database": "PubMed", "id": "19542224", "url": "https://glygen.org/publication/PubMed/19542224" } ] } ], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 248, 360, 521, 708, 1051, 1067 ], "o_linked_sites": [ 150, 289, 292, 293, 300, 302, 394, 450, 507, 572, 580, 624, 638 ], "snv_sites": [ 42, 111, 131, 207, 231, 234, 259, 289, 293, 302, 335, 360, 362, 494, 522, 534, 603, 638, 652, 708, 710, 722, 902, 1017, 1052, 1077, 1140 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 1067, "end_pos": 1069 }, { "start_pos": 248, "end_pos": 250 }, { "start_pos": 360, "end_pos": 362 }, { "start_pos": 708, "end_pos": 710 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 180 }, { "field": "total_sites", "count": 21 }, { "field": "n_linked_glycans", "count": 90 }, { "field": "n_linked_glycan_sites", "count": 10 }, { "field": "o_linked_glycans", "count": 4 }, { "field": "o_linked_glycan_sites", "count": 14 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 11 }, { "field": "total_sites", "count": 11 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 3 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 169 }, { "field": "total_sites", "count": 21 }, { "field": "n_linked_glycans", "count": 90 }, { "field": "n_linked_glycan_sites", "count": 6 }, { "field": "o_linked_glycans", "count": 4 }, { "field": "o_linked_glycan_sites", "count": 11 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 32 }, { "field": "total_sites", "count": 27 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 10 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 22 }, { "field": "total_sites", "count": 19 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 184 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }