{ "uniprot_canonical_ac": "P07942-1", "uniprot_ac": "P07942", "uniprot_id": "LAMB1_HUMAN", "mass": { "chemical_mass": 198038.0, "monoisotopic_mass": 198038.0 }, "refseq": { "ac": "NP_002282", "name": "laminin subunit beta-1 precursor", "summary": "Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins are composed of 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, and B2, respectively) and they form a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Each laminin chain is a multidomain protein encoded by a distinct gene. Several isoforms of each chain have been described. Different alpha, beta and gamma chain isomers combine to give rise to different heterotrimeric laminin isoforms which are designated by Arabic numerals in the order of their discovery, i.e. alpha1beta1gamma1 heterotrimer is laminin 1. The biological functions of the different chains and trimer molecules are largely unknown, but some of the chains have been shown to differ with respect to their tissue distribution, presumably reflecting diverse functions in vivo. This gene encodes the beta chain isoform laminin, beta 1. The beta 1 chain has 7 structurally distinct domains which it shares with other beta chain isomers. The C-terminal helical region containing domains I and II are separated by domain alpha, domains III and V contain several EGF-like repeats, and domains IV and VI have a globular conformation. Laminin, beta 1 is expressed in most tissues that produce basement membranes, and is one of the 3 chains constituting laminin 1, the first laminin isolated from Engelbreth-Holm-Swarm (EHS) tumor. A sequence in the beta 1 chain that is involved in cell attachment, chemotaxis, and binding to the laminin receptor was identified and shown to have the capacity to inhibit metastasis. [provided by RefSeq, Aug 2011].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002282" }, "gene_names": [ { "name": "LAMB1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P07942", "id": "P07942" }, { "name": "CLM; LIS5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002282", "id": "NP_002282" }, { "name": "LAMB1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002282", "id": "NP_002282" } ], "protein_names": [ { "name": "Laminin subunit beta-1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P07942" }, { "name": "Laminin B1 chain", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07942" }, { "name": "Laminin-1 subunit beta", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07942" }, { "name": "Laminin-10 subunit beta", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07942" }, { "name": "Laminin-12 subunit beta", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07942" }, { "name": "Laminin-2 subunit beta", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07942" }, { "name": "Laminin-6 subunit beta", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07942" }, { "name": "Laminin-8 subunit beta", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07942" }, { "name": "laminin B1 chain; laminin, beta 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002282", "id": "NP_002282" }, { "name": "laminin subunit beta-1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002282", "id": "NP_002282" } ], "function": [ { "annotation": "Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Involved in the organization of the laminar architecture of cerebral cortex. It is probably required for the integrity of the basement membrane/glia limitans that serves as an anchor point for the endfeet of radial glial cells and as a physical barrier to migrating neurons. Radial glial cells play a central role in cerebral cortical development, where they act both as the proliferative unit of the cerebral cortex and a scaffold for neurons migrating toward the pial surface.", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942#function" }, { "database": "PubMed", "id": "23472759", "url": "https://glygen.org/publication/PubMed/23472759" } ] }, { "annotation": "Compound variants of FKTN, POMGNT1, and LAMB1 gene identified by prenatal whole-exome sequencing in three fetuses with congenital hydrocephalus.", "evidence": [ { "database": "RefSeq", "id": "NP_002282", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002282" }, { "database": "PubMed", "id": "35843586", "url": "https://glygen.org/publication/PubMed/35843586" } ] }, { "annotation": "End-Truncated LAMB1 Causes a Hippocampal Memory Defect and a Leukoencephalopathy.", "evidence": [ { "database": "RefSeq", "id": "NP_002282", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002282" }, { "database": "PubMed", "id": "34606115", "url": "https://glygen.org/publication/PubMed/34606115" } ] }, { "annotation": "Evaluation of JUN, FN1 and LAMB1 polymorphisms in pterygium in a Chinese Han population.", "evidence": [ { "database": "RefSeq", "id": "NP_002282", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002282" }, { "database": "PubMed", "id": "35445627", "url": "https://glygen.org/publication/PubMed/35445627" } ] }, { "annotation": "Lamin B1 is a potential therapeutic target and prognostic biomarker for hepatocellular carcinoma.", "evidence": [ { "database": "RefSeq", "id": "NP_002282", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002282" }, { "database": "PubMed", "id": "35436411", "url": "https://glygen.org/publication/PubMed/35436411" } ] }, { "annotation": "Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins are composed of 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, and B2, respectively) and they form a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Each laminin chain is a multidomain protein encoded by a distinct gene. Several isoforms of each chain have been described. Different alpha, beta and gamma chain isomers combine to give rise to different heterotrimeric laminin isoforms which are designated by Arabic numerals in the order of their discovery, i.e. alpha1beta1gamma1 heterotrimer is laminin 1. The biological functions of the different chains and trimer molecules are largely unknown, but some of the chains have been shown to differ with respect to their tissue distribution, presumably reflecting diverse functions in vivo. This gene encodes the beta chain isoform laminin, beta 1. The beta 1 chain has 7 structurally distinct domains which it shares with other beta chain isomers. The C-terminal helical region containing domains I and II are separated by domain alpha, domains III and V contain several EGF-like repeats, and domains IV and VI have a globular conformation. Laminin, beta 1 is expressed in most tissues that produce basement membranes, and is one of the 3 chains constituting laminin 1, the first laminin isolated from Engelbreth-Holm-Swarm (EHS) tumor. A sequence in the beta 1 chain that is involved in cell attachment, chemotaxis, and binding to the laminin receptor was identified and shown to have the capacity to inhibit metastasis. [provided by RefSeq, Aug 2011].", "evidence": [ { "database": "RefSeq", "id": "NP_002282", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002282" } ] }, { "annotation": "RNA Helicase DDX24 Stabilizes LAMB1 to Promote Hepatocellular Carcinoma Progression.", "evidence": [ { "database": "RefSeq", "id": "NP_002282", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002282" }, { "database": "PubMed", "id": "35763670", "url": "https://glygen.org/publication/PubMed/35763670" } ] } ], "disease": [ { "disease_id": "DOID:0112230", "recommended_name": { "id": "DOID:0112230", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0112230", "name": "lissencephaly 5", "description": "A lissencephaly characterized by hydrocephalus, seizures, severely delayed psychomotor development, and cobblestone changes in the cortex, more severe in the posterior region, and subcortical band heterotopia that has_material_basis_in homozygous or compound heterozygous mutation in the LAMB1 gene on chromosome 7q31.1." }, "synonyms": [ { "id": "DOID:0112230", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0112230", "name": "LIS5", "description": "" }, { "id": "MONDO:0014077", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014077", "name": "cobblestone lissencephaly without muscular or ocular involvement", "description": "Cobblestone lissencephaly without muscular or ocular involvement is a form of cobblestone lissencephaly characterized by a constellation of brain malformations which can either exist alone or in conjunction with minimal muscular and ocular abnormalities. The clinical features of the disease include severe developmental delay, increased head circumference, hydrocephalus and seizures." }, { "id": "MONDO:0014077", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014077", "name": "cobblestone lissencephaly without muscular or eye involvement", "description": "" }, { "id": "MONDO:0014077", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014077", "name": "cobblestone lissencephaly without muscular or ocular involvement", "description": "" }, { "id": "MONDO:0014077", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014077", "name": "lissencephaly type 2 without muscular or eye involvement", "description": "" }, { "id": "MONDO:0014077", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014077", "name": "lissencephaly type 2 without muscular or ocular involvement", "description": "" }, { "id": "MONDO:0014077", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014077", "name": "lissencephaly type 5", "description": "" }, { "id": "MONDO:0014077", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014077", "name": "LIS5", "description": "" }, { "id": "MONDO:0014077", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014077", "name": "lissencephaly 5", "description": "" }, { "id": "MIM:615191", "resource": "MIM", "url": "https://www.omim.org/entry/615191", "name": "Lissencephaly 5", "description": "Lissencephaly 5" } ], "evidence": [ { "id": "615191", "database": "MIM", "url": "https://www.omim.org/entry/615191" } ] } ], "snv": [ { "evidence": [ { "id": "rs778323211", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778323211" }, { "id": "rs778323211", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778323211" }, { "id": "rs778323211", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778323211" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 1043, "end_pos": 1043, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->NGF).", "chr_id": "7", "chr_pos": "107940310", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1043", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs751807101", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751807101" }, { "id": "rs751807101", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751807101" }, { "id": "rs751807101", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751807101" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1099, "end_pos": 1099, "sequence_org": "F", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NEF->NES).", "chr_id": "7", "chr_pos": "107951321", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "F1099", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs781647535", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781647535" }, { "id": "rs781647535", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781647535" }, { "id": "rs781647535", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781647535" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 1197, "end_pos": 1197, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->NRI).", "chr_id": "7", "chr_pos": "107940160", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1197", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1459655388", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1459655388" }, { "id": "rs1459655388", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1459655388" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 120, "end_pos": 120, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "7", "chr_pos": "107994952", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N120", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1158702022", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1158702022" }, { "id": "rs1158702022", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1158702022" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 122, "end_pos": 122, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->NVA).", "chr_id": "7", "chr_pos": "107994946", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T122", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1322639780", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1322639780" }, { "id": "rs1322639780", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1322639780" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1280, "end_pos": 1280, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "7", "chr_pos": "107937199", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1280", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs768415137", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768415137" }, { "id": "rs768415137", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768415137" }, { "id": "rs768415137", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs768415137#frequency_tab" }, { "id": "rs768415137", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768415137" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1296, "end_pos": 1296, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DNT->NNT).", "chr_id": "7", "chr_pos": "107937153", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D1296", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1266147752", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1266147752" }, { "id": "rs1266147752", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1266147752" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 1338, "end_pos": 1338, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->NAC).", "chr_id": "7", "chr_pos": "107935590", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1338", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs775182474", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775182474" }, { "id": "rs775182474", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775182474" }, { "id": "rs775182474", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775182474" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 1343, "end_pos": 1343, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->HST).", "chr_id": "7", "chr_pos": "107935576", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N1343", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs767196821", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767196821" }, { "id": "rs767196821", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767196821" }, { "id": "rs767196821", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767196821" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 1343, "end_pos": 1343, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "7", "chr_pos": "107935575", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N1343", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1392055212", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1392055212" }, { "id": "rs1392055212", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1392055212" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 1345, "end_pos": 1345, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->NSA).", "chr_id": "7", "chr_pos": "107935570", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1345", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs377625057", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs377625057" }, { "id": "rs377625057", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs377625057" }, { "id": "rs377625057", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs377625057#frequency_tab" }, { "id": "rs377625057", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs377625057" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 1487, "end_pos": 1487, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).", "chr_id": "7", "chr_pos": "107931434", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N1487", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs780013406", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780013406" }, { "id": "rs780013406", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780013406" }, { "id": "rs780013406", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780013406" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 1487, "end_pos": 1487, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "7", "chr_pos": "107931433", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N1487", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P07942", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07942" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 153, "end_pos": 153, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "L", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "7", "chr_pos": "107986329", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S153", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:1115", "recommended_name": { "id": "DOID:1115", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1115", "name": "sarcoma", "description": "A cell type cancer that has_material_basis_in abnormally proliferating cells derives from embryonic mesoderm." }, "synonyms": [ { "id": "DOID:1115", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1115", "name": "connective and soft tissue neoplasm", "description": "" }, { "id": "DOID:1115", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1115", "name": "tumor of soft tissue and skeleton", "description": "" } ] }, { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs777886628", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777886628" }, { "id": "rs777886628", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777886628" }, { "id": "rs777886628", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs777886628" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 1544, "end_pos": 1544, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->NLI).", "chr_id": "7", "chr_pos": "107929526", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1544", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1430407126", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1430407126" }, { "id": "rs1430407126", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1430407126#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1678, "end_pos": 1678, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "7", "chr_pos": "107926214", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1678", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P07942", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07942" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 272, "end_pos": 272, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "F", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NCF->NCS).", "chr_id": "7", "chr_pos": "107980673", "ref_nt": "A", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "F272", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1584525325", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1584525325" }, { "id": "rs1584525325", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1584525325" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 330, "end_pos": 330, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSN->NSS).", "chr_id": "7", "chr_pos": "107978058", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N330", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs775907650", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775907650" }, { "id": "rs775907650", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775907650" }, { "id": "rs775907650", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs775907650#frequency_tab" }, { "id": "rs775907650", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775907650" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 338, "end_pos": 338, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NCN->NCS).", "chr_id": "7", "chr_pos": "107975865", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N338", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1410324955", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1410324955" }, { "id": "rs1410324955", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1410324955#frequency_tab" }, { "id": "rs1410324955", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1410324955" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 356, "end_pos": 356, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->DVS).", "chr_id": "7", "chr_pos": "107980680", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N356", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs758179734", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758179734" }, { "id": "rs758179734", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758179734" }, { "id": "rs758179734", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs758179734#frequency_tab" }, { "id": "rs758179734", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758179734" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 358, "end_pos": 358, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->NVR).", "chr_id": "7", "chr_pos": "107975804", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S358", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs957623702", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs957623702" }, { "id": "rs957623702", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs957623702" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 370, "end_pos": 370, "sequence_org": "M", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NTM->NTT).", "chr_id": "7", "chr_pos": "107975769", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "M370", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1417553656", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1417553656" }, { "id": "rs1417553656", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1417553656" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 413, "end_pos": 413, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SYT->NYT).", "chr_id": "7", "chr_pos": "107975365", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S413", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs775620611", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775620611" }, { "id": "rs775620611", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775620611" }, { "id": "rs775620611", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775620611" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 519, "end_pos": 519, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->KNS).", "chr_id": "7", "chr_pos": "107972997", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N519", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1443932967", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1443932967" }, { "id": "rs1443932967", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1443932967#frequency_tab" }, { "id": "rs1443932967", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1443932967" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 519, "end_pos": 519, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->SNS).", "chr_id": "7", "chr_pos": "107972998", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N519", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs764980876", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764980876" }, { "id": "rs764980876", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764980876" }, { "id": "rs764980876", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764980876" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 521, "end_pos": 521, "sequence_org": "S", "sequence_mut": "*", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->NN*).", "chr_id": "7", "chr_pos": "107961561", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S521", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P07942", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07942" } ], "glycoeffect": [], "start_pos": 615, "end_pos": 615, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "C", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "7", "chr_pos": "107962919", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R615", "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] }, { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] }, { "disease_id": "DOID:2531", "recommended_name": { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes." }, "synonyms": [ { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematologic malignancy", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematologic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematological tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "blood cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic and lymphoid system tumor", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "malignant hematopoietic neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P07942", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07942" }, { "id": "rs373152146", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373152146" }, { "id": "rs373152146", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373152146" }, { "id": "rs373152146", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373152146" }, { "id": "rs373152146", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs373152146#frequency_tab" }, { "id": "rs373152146", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs373152146" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 679, "end_pos": 679, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "M", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NYT->NYM).", "chr_id": "7", "chr_pos": "107961279", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "T679", "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs1562990912", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1562990912" }, { "id": "rs1562990912", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1562990912" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 688, "end_pos": 688, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TSS->NSS).", "chr_id": "7", "chr_pos": "107961252", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T688", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1472494247", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1472494247" }, { "id": "rs1472494247", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1472494247" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 730, "end_pos": 730, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSA->NST).", "chr_id": "7", "chr_pos": "107960571", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A730", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P07942", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07942" } ], "glycoeffect": [], "start_pos": 905, "end_pos": 905, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "7", "chr_pos": "107955608", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "D905", "disease": [ { "disease_id": "DOID:1319", "recommended_name": { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." }, "synonyms": [ { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "tumor of the Brain", "description": "" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs748512722", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748512722" }, { "id": "rs748512722", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748512722" }, { "id": "rs748512722", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748512722" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 966, "end_pos": 966, "sequence_org": "P", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPS->NTS).", "chr_id": "7", "chr_pos": "107953713", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P966", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs770977919", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770977919" }, { "id": "rs770977919", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770977919" }, { "id": "rs770977919", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770977919" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 982, "end_pos": 982, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NNI->NNT).", "chr_id": "7", "chr_pos": "107953664", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I982", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "95.1", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091136", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091136" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "82.1", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091136", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091136" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "91.9", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091136", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091136" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "91.3", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091136", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091136" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.35", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091136", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091136" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "97.51", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091136", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091136" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "81.46", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091136", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091136" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "98.41", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091136", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091136" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "98.05", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091136", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091136" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "94.55", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091136", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091136" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "91.86", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091136", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091136" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "94.37", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091136", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091136" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "97.49", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091136", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091136" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P07942", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07942" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P07942", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07942" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P07942", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07942" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P07942", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07942" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P07942", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07942" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P07942", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07942" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P07942", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07942" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P07942", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07942" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P07942", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07942" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P07942", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07942" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P07942", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07942" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P07942", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07942" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "common_name": "Human" } ], "gene": [ { "name": "LAMB1", "url": "https://www.uniprot.org/uniprot/P07942", "locus": { "chromosome": "7", "start_pos": 107923799, "end_pos": 108003213, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000091136", "url": "https://www.ensembl.org/id/ENSG00000091136" } ] } } ], "crossref": [ { "id": "ENSG00000091136", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091136", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P07942", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07942", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd00055", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00055", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd22300", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd22300", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL2364187", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2364187", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "LAMB1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=LAMB1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "3912", "url": "https://www.ncbi.nlm.nih.gov/gene/3912", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "1442", "url": "https://glyconnect.expasy.org/browser/proteins/1442", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "6486", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=6486", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P07942", "url": "https://www.ebi.ac.uk/intact/interactors/id:P07942*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000742", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000742", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002049", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002049", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008211", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008211", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013015", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013015", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:3912", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3912", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "150240", "url": "http://www.omim.org/entry/150240", "database": "MIM", "categories": [ "Other" ] }, { "id": "615191", "url": "http://www.omim.org/entry/615191", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P07942", "url": "https://www.nextprot.org/entry/NX_P07942", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P07942", "url": "https://oglcnac.org/atlas/detail/P07942", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P07942", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07942", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "AMDFDQD", "url": "https://omabrowser.org/oma/group/AMDFDQD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "90222at2759", "url": "http://www.orthodb.org/?query=90222at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10574", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10574", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10574:SF233", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10574:SF233", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10574:SF274", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10574:SF274", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10574:SF298", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10574:SF298", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "5XAU", "url": "https://www.rcsb.org/structure/5XAU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7CEC", "url": "https://www.rcsb.org/structure/7CEC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8DMK", "url": "https://www.rcsb.org/structure/8DMK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00053", "url": "http://pfam.xfam.org/family/PF00053", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00055", "url": "http://pfam.xfam.org/family/PF00055", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF21199", "url": "http://pfam.xfam.org/family/PF21199", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P07942", "url": "https://pharos.nih.gov/targets/P07942", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000054413", "url": "https://proconsortium.org/app/entry/PR:000054413", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P07942", "url": "http://purl.obolibrary.org/obo/PR_P07942", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3000171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000171", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-373760", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-373760", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8874081", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8957275", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8957275", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_002282", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002282", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P07942", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "A0A7I2V2J0", "url": "https://www.uniprot.org/uniprot/A0A7I2V2J0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2J0-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V2J0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2R2", "url": "https://www.uniprot.org/uniprot/A0A7I2V2R2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2R2-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V2R2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2T9", "url": "https://www.uniprot.org/uniprot/A0A7I2V2T9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2T9-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V2T9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V378", "url": "https://www.uniprot.org/uniprot/A0A7I2V378", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V378-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V378-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3I5", "url": "https://www.uniprot.org/uniprot/A0A7I2V3I5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3I5-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3I5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3J7", "url": "https://www.uniprot.org/uniprot/A0A7I2V3J7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3J7-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3J7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V407", "url": "https://www.uniprot.org/uniprot/A0A7I2V407", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V407-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V407-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V4J9", "url": "https://www.uniprot.org/uniprot/A0A7I2V4J9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V4J9-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V4J9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5R0", "url": "https://www.uniprot.org/uniprot/A0A7I2V5R0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5R0-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V5R0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5T9", "url": "https://www.uniprot.org/uniprot/A0A7I2V5T9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5T9-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V5T9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5X5", "url": "https://www.uniprot.org/uniprot/A0A7I2V5X5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5X5-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V5X5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V682", "url": "https://www.uniprot.org/uniprot/A0A7I2V682", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V682-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V682-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9J296", "url": "https://www.uniprot.org/uniprot/C9J296", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9J296-1", "url": "https://www.uniprot.org/uniprot/C9J296-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7EPA6", "url": "https://www.uniprot.org/uniprot/E7EPA6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7EPA6-1", "url": "https://www.uniprot.org/uniprot/E7EPA6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PCS6", "url": "https://www.uniprot.org/uniprot/E9PCS6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PCS6-1", "url": "https://www.uniprot.org/uniprot/E9PCS6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3XAI2", "url": "https://www.uniprot.org/uniprot/G3XAI2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3XAI2-1", "url": "https://www.uniprot.org/uniprot/G3XAI2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07942-1", "url": "https://www.uniprot.org/uniprot/P07942-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGLLQLLAFSFLALCRARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSISCHFDMAVYLATGNVSGGVCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTGLIAGQCRCKLNVEGEHCDVCKEGFYDLSSEDPFGCKSCACNPLGTIPGGNPCDSETGHCYCKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCFAESGQCSCRPHMIGRQCNEVEPGYYFATLDHYLYEAEEANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFFIDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGRIPTSSRCGNTIPDDDNQVVSLSPGSRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGGSGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGSLSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPSGCKPCECHLQGSVNAFCNPVTGQCHCFQGVYARQCDRCLPGHWGFPSCQPCQCNGHADDCDPVTGECLNCQDYTMGHNCERCLAGYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCASGYFGNPSEVGGSCQPCQCHNNIDTTDPEACDKETGRCLKCLYHTEGEHCQFCRFGYYGDALQQDCRKCVCNYLGTVQEHCNGSDCQCDKATGQCLCLPNVIGQNCDRCAPNTWQLASGTGCDPCNCNAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDVECRACDCDPRGIETPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRFLEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDVTEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEFIKNSDIRGALDSITKYFQMSLEAEERVNASTTEPNSTVEQSALMRDRVEDVMMERESQFKEKQEEQARLLDELAGKLQSLDLSAAAEMTCGTPPGASCSETECGGPNCRTDEGERKCGGPGCGGLVTVAHNAWQKAMDLDQDVLSALAEVEQLSKMVSEAKLRADEAKQSAEDILLKTNATKEKMDKSNEELRNLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVESLSQVEVILQHSAADIARAEMLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDIQGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVKQSAEDVKKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLLKDLERKYEDNQRYLEDKAQELARLEGEVRSLLKDISQKVAVYSTCL", "length": 1786, "header": "sp|P07942-1|LAMB1_HUMAN Isoform 1 of Laminin subunit beta-1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2 CANONICAL=P07942-1" }, "isoforms": [ { "isoform_ac": "A0A7I2V2J0-1", "url": "", "sequence": { "sequence": "MGLLQLLAFSFLALCRARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSISCHFDMAVYLATGNVSGGVCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTGLIAGQCRCKLNVEGEHCDVCKEGFYDLSSEDPFGCKSCACNPLGTIPGGNPCDSETGHCYCKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCFAESGQCSCRPHMIGRQCNEVEPGYYFATLDHYLYEAEEANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFFIDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGRIPTSSRCGNTIPDDDNQVVSLSPGSRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGGSGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGSLSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPSGCKPCECHLQGSVNAFCNPVTGQCHCFQGVYARQCDRCLPGHWGFPSCQPCQCNGHADDCDPVTGECLNCQDYTMGHNCERCLAGYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCASGYFGNPSEVGGSCQPCQCHNNIDTTDPEACDKETGRCLKCLYHTEGEHCQFCRFGYYGDALQQDCRKCVCNYLGTVQEHCNGSDCQCDKATGQCLCLPNVIGQNCDRCAPNTWQLASGTGCDPCNCNAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDVECRGN", "length": 1132, "header": "tr|A0A7I2V2J0-1|A0A7I2V2J0_HUMAN Computationally mapped isoform of Laminin subunit beta 1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=1 CANONICAL=P07942-1" }, "locus": { "chromosome": "7", "start_pos": 108002885, "end_pos": 107937273, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677588.1", "url": "https://www.ensembl.org/id/ENST00000677588.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000502938.1", "url": "https://www.ensembl.org/id/ENSP00000502938.1" } ] } }, { "isoform_ac": "A0A7I2V2R2-1", "url": "", "sequence": { "sequence": "MGLLQLLAFSFLALCRARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSISCHFDMAVYLATGNVSGGVCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTGLIAGQCRCKLNVEGEHCDVCKEGFYDLSSEDPFGCKSCACNPLGTIPGGNPCDSETGHCYCKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCFAESGQCSCRPHMIGRQCNEVEPGYYFATLDHYLYEAEEANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFFIDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGRIPTSSRCGNTIPDDDNQVVSLSPGSRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGGSGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGSLSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPSGCKRAWLVTMATPSLGQEITAALALAQMVPTVDASLPGAATKILLLYSLPVFVILDTLVPDVTTVPQDTLAIHQKLGGRVSLASVTTTLTRQTQKPVTRRLGGVSSACTTRKGNTVSSAGLDTMVMPSSRTVESVSVITWAPCKSTVTALTASATKPLVSACVFLM", "length": 982, "header": "tr|A0A7I2V2R2-1|A0A7I2V2R2_HUMAN Computationally mapped isoform of Laminin subunit beta 1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=1 CANONICAL=P07942-1" }, "locus": { "chromosome": "7", "start_pos": 108002885, "end_pos": 107952125, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677144.1", "url": "https://www.ensembl.org/id/ENST00000677144.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503049.1", "url": "https://www.ensembl.org/id/ENSP00000503049.1" } ] } }, { "isoform_ac": "A0A7I2V2T9-1", "url": "", "sequence": { "sequence": "MGLLQLLAFSFLALCRARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSISCHFDMAVYLATGNVSGGVCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTGLIAGQCRCKLNVEGEHCDVCKEGFYDLSSEDPFGCKSCACNPLGTIPGGNPCDSETGHCYCKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCFAESGQCSCRPHMIGRQCNEVEPGYYFATLDHYLYEAEEANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFFIDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGRIPTSSRCGNTIPDDDNQVVSLSPGSRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGGSGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGSLSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPSGCKPCECHLQGSVNAFCNPVTGQCHCFQGVYARQCDRCLPGHWGFPSCQPCQCNGHADDCDPVTGECLNCQDYTMGHNCERCLAGYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCASGYFGNPSEVGGSCQPCQCHNNIDTTDPEACDKETGRCLKCLYHTEGEHCQFCRFGYYGDALQQDCRKCVCNYLGTVQEHCNGSDCQCDKATGQCLCLPNVIGQNCDRCAPNTWQLASGTGCDPCNCNAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDVECRACDCDPRGIETPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRFLEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDVTEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEFIKNSDIRGALDSITKYFQMSLEAEERVNASTTEPNSTVEQSALMRDRVEDVMMERESQFKEKQEEQARLLDELAGKLQSLDLSAAAEMHPC", "length": 1399, "header": "tr|A0A7I2V2T9-1|A0A7I2V2T9_HUMAN Computationally mapped isoform of Laminin subunit beta 1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=1 CANONICAL=P07942-1" }, "locus": { "chromosome": "7", "start_pos": 108002885, "end_pos": 107932485, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676574.1", "url": "https://www.ensembl.org/id/ENST00000676574.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503081.1", "url": "https://www.ensembl.org/id/ENSP00000503081.1" } ] } }, { "isoform_ac": "A0A7I2V378-1", "url": "", "sequence": { "sequence": "MGLLQLLAFSFLALCRARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQVWKM", "length": 75, "header": "tr|A0A7I2V378-1|A0A7I2V378_HUMAN Computationally mapped isoform of Laminin subunit beta 1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=1 CANONICAL=P07942-1" }, "locus": { "chromosome": "7", "start_pos": 108002885, "end_pos": 107994949, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678346.1", "url": "https://www.ensembl.org/id/ENST00000678346.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504349.1", "url": "https://www.ensembl.org/id/ENSP00000504349.1" } ] } }, { "isoform_ac": "A0A7I2V3I5-1", "url": "", "sequence": { "sequence": "MTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSISCHFDMAVYLATGNVSGGVCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTGLIAGQCRCKLNVEGEHCDVCKEGFYDLSSEDPFGCKSCACNPLGTIPGGNPCDSETGHCYCKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCFAESGQCSCRPHMIGRQCNEVEPGYYFATLDHYLYEAEEANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFFIDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGRIPTSSRCGNTIPDDDNQVVSLSPGSRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGGSGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGSLSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPSGCKPCECHLQGSVNAFCNPVTGQCHCFQGVYARQCDRCLPGHWGFPSCQPCQCNGHADDCDPVTGECLNCQDYTMGHNCERCLAGYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCASGYFGNPSEVGGSCQPCQCHNNIDTTDPEACDKETGRCLKCLYHTEGEHCQFCRFGYYGDALQQDCRKCVCNYLGTVQEHCNGSDCQCDKATGQCLCLPNVIGQNCDRCAPNTWQLASGTGCDPCNCNAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDVECRACDCDPRGIETPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRFLEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDVTEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEFIKNSDIRGALDSITKYFQMSLEAEERVNASTTEPNSTVEQSALMRDRVEDVMMERESQFKEKQEEQARLLDELAGKLQSLDLSAAAEMYCA", "length": 1262, "header": "tr|A0A7I2V3I5-1|A0A7I2V3I5_HUMAN Computationally mapped isoform of Laminin subunit beta 1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=1 CANONICAL=P07942-1" }, "locus": { "chromosome": "7", "start_pos": 107994898, "end_pos": 107932398, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677801.1", "url": "https://www.ensembl.org/id/ENST00000677801.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503438.1", "url": "https://www.ensembl.org/id/ENSP00000503438.1" } ] } }, { "isoform_ac": "A0A7I2V3J7-1", "url": "", "sequence": { "sequence": "MTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSISCHFDMAVYLATGNVSGGVCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTGLIAGQCRCKLNVEGEHCDVCKEGFYDLSSEDPFGCKSCACNPLGTIPGGNPCDSETGHCYCKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCFAESGQCSCRPHMIGRQCNEVEPGYYFATLDHYLYEAEEANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFFIDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGRIPTSSRCGNTIPDDDNQVVSLSPGSRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGGSGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGSLSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPSGCKPCECHLQGSVNAFCNPVTGQCHCFQGVYARQCDRCLPGHWGFPSCQPCQCNGHADDCDPVTGECLNCQDYTMGHNCERCLAGYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCASGYFGNPSEVGGSCQPCQCHNNIDTTDPEACDKETGRCLKCLYHTEGEHCQFCRFGYYGDALQQDCRKCVCNYLGTVQEHCNGSDCQCDKATGQCLCLPNVIGQNCDRCAPNTWQLASGTGCDPCNCNAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDVECRACDCDPRGIETPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRFLEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDVTEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEFIKNSDIREMGSCYAAQAGLELLDSSDPPVSDF", "length": 1203, "header": "tr|A0A7I2V3J7-1|A0A7I2V3J7_HUMAN Computationally mapped isoform of Laminin subunit beta 1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=1 CANONICAL=P07942-1" }, "locus": { "chromosome": "7", "start_pos": 107994898, "end_pos": 107936300, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678698.1", "url": "https://www.ensembl.org/id/ENST00000678698.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503198.1", "url": "https://www.ensembl.org/id/ENSP00000503198.1" } ] } }, { "isoform_ac": "A0A7I2V407-1", "url": "", "sequence": { "sequence": "MTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSISCHFDMAVYLATGNVSGGVCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTGLIAGQCRCKLNVEGEHCDVCKEGFYDLSSEDPFGCKSCACNPLGTIPGGNPCDSETGHCYCKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCFAESGQCSCRPHMIGRQCNEVEPGYYFATLDHYLYEAEEANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFFIDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGRIPTSSRCGNTIPDDDNQVVSLSPGSRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGGSGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGSLSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPSGCKPCECHLQGSVNAFCNPVTGQCHCFQGVYARQCDRCLPGHWGFPSCQPCQCNGHADDCDPVTGECLNCQDYTMGHNCERCLAGYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCASGYFGNPSEVGGSCQPCQCHNNIDTTDPEACDKETGRCLKCLYHTEGEHCQFCRFGYYGDALQQDCRKCVCNYLGTVQEHCNGSDCQCDKATGQCLCLPNVIGQNCDRCAPNTWQLASGTGCDPCNCNAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDVECRDVEDVTQFPDYPGSHNMCGEGRIYHLSPQFMLLTIMLYSSNLPLESLECRGRTKTIKR", "length": 1051, "header": "tr|A0A7I2V407-1|A0A7I2V407_HUMAN Computationally mapped isoform of Laminin subunit beta 1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=1 CANONICAL=P07942-1" }, "locus": { "chromosome": "7", "start_pos": 107994898, "end_pos": 107942447, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676920.1", "url": "https://www.ensembl.org/id/ENST00000676920.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503814.1", "url": "https://www.ensembl.org/id/ENSP00000503814.1" } ] } }, { "isoform_ac": "A0A7I2V4J9-1", "url": "", "sequence": { "sequence": "MGLLQLLAFSFLALCRARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSISCHFDMAVYLATGNVSGGVCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTGLIAGQCRCKLNVEGEHCDVCKEGFYDLSSEDPFGCKSCACNPLGTIPGGNPCDSETGHCYCKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCFAESGQCSCRPHMIGRQCNEVEPGYYFATLDHYLYEAEEANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFFIDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGRIPTSSRCGNTIPDDDNQVVSLSPGSRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGGSGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGSLSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPSGCKPCECHLQGSVNAFCNPVTGQCHCFQGVYARQCDRCLPGHWGFPSCQPCQCNGHADDCDPVTGECLNCQDYTMGHNCERCLAGYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCASGYFGNPSEVGGSCQPCQCHNNIDTTDPEACDKETGRCLKCLYHTEGEHCQFCRFGYYGDALQQDCRTCDCDPRGIETPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRFLEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDVTEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEFIKNSDIRGALDSITKYFQMSLEAEERVNASTTEPNSTVEQSALMRDRVEDVMMERESQFKEKQEEQARLLDELAGKLQSLDLSAAAEMTCGTPPGASCSETECGGPNCRTDEGERKCGGPGCGGLVTVAHNAWQKAMDLDQDVLSALAEVEQLSKMVSEAKLRADEAKQSAEDILLKTNATKEKMDKSNEELRNLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVESLSQVEVILQHSAADIARAEMLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDIQGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVKQSAEDVKKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLLKDLERKYEDNQRYLEDKAQELARLEGEVRSLLKDISQKVAVYSTCL", "length": 1682, "header": "tr|A0A7I2V4J9-1|A0A7I2V4J9_HUMAN Computationally mapped isoform of Laminin subunit beta 1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=1 CANONICAL=P07942-1" }, "locus": { "chromosome": "7", "start_pos": 108002885, "end_pos": 107923954, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677793.1", "url": "https://www.ensembl.org/id/ENST00000677793.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504020.1", "url": "https://www.ensembl.org/id/ENSP00000504020.1" } ] } }, { "isoform_ac": "A0A7I2V5R0-1", "url": "", "sequence": { "sequence": "MGLLQLLAFSFLALCRARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSISCHFDMAVYLATGNVSGGVCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTGLIAGQCRCKLNVEGEHCDVCKEGFYDLSSEDPFGCKSCACNPLGTIPGGNPCDSETGHCYCKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCFAESGQCSCRPHMIGRQCNEVEPGYYFATLDHYLYEAEEANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFFIDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGRIPTSSRCGNTIPDDDNQVVSLSPGSRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGGSGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGSLSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPSGCKPCECHLQGSVNAFCNPVTGQCHCFQGVYARQCDRCLPGHWGFPSCQPCQCNGHADDCDPVTGECLNCQDYTMGHNCERCLAGYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCASGYFGNPSEVGGSCQPCQCHNNIDTTDPEACDKETGRCLKCLYHTEGEHCQFCRFGYYGDALQQDCRKCVCNYLGTVQEHCNGSDCQCDKATGQCLCLPNVIGQNCDRCAPNTWQLASGTGCDPCNCNAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDVECRDVEDVTQFPDYPGSHNMCGEGRIYHLSPQFMLLTIMLYSSNLPLESLECRGRTKTIKR", "length": 1188, "header": "tr|A0A7I2V5R0-1|A0A7I2V5R0_HUMAN Computationally mapped isoform of Laminin subunit beta 1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=1 CANONICAL=P07942-1" }, "locus": { "chromosome": "7", "start_pos": 108002885, "end_pos": 107942447, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000679244.1", "url": "https://www.ensembl.org/id/ENST00000679244.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504656.1", "url": "https://www.ensembl.org/id/ENSP00000504656.1" } ] } }, { "isoform_ac": "A0A7I2V5T9-1", "url": "", "sequence": { "sequence": "MGLLQLLAFSFLALCRARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSISCHFDMAVYLATGNVSGGVCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTGLIAGQCRCKLNVEGEHCDVCKEGFYDLSSEDPFGCKCSLCLQSSGNNSWRESL", "length": 473, "header": "tr|A0A7I2V5T9-1|A0A7I2V5T9_HUMAN Computationally mapped isoform of Laminin subunit beta 1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=1 CANONICAL=P07942-1" }, "locus": { "chromosome": "7", "start_pos": 108002885, "end_pos": 107975053, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678704.1", "url": "https://www.ensembl.org/id/ENST00000678704.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504589.1", "url": "https://www.ensembl.org/id/ENSP00000504589.1" } ] } }, { "isoform_ac": "A0A7I2V5X5-1", "url": "", "sequence": { "sequence": "MGLLQLLAFSFLALCRARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSISCHFDMAVYLATGNVSGGVCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTGLIAGQCRCKLNVEGEHCDVCKEGFYDLSSEDPFGCKSCACNPLGTIPGGNPCDSETGHCYCKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCFAESGQCSCRPHMIGRQCNEVEPGYYFATLDHYLYEAEEANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFFIDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGRIPTSSRCGNTIPDDDNQVVSLSPGSRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGGSGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGSLSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPSGCKPCECHLQGSVNAFCNPVTGQCHCFQGVYARQCDRCLPGHWGFPSCQPCQCNGHADDCDPVTGECLNCQDYTMGHNCERCLAGYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCASGYFGNPSEVGGSCQPCQCHNNIDTTDPEACDKETGRCLKCLYHTEGEHCQFCRFGYYGDALQQDCRKCVCNYLGTVQEHCNGSDCQCDKATGQCLCLPNVIGQNCDRCAPNTWQLASGTGCDPCNCNAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDVECRACDCDPRGIETPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRFLEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDVTEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEFIKNSDIRGALDSITKYFQMSLEAEERVNASTTEPNSTVEQSALMRDRVEDVMMERESQFKEKQEEQARLLDELAGKLQSLDLSAAAEMTCGTPPGASCSETECGGPNCRTDEGERKCGGPGCGGLVTVAHNAWQKAMDLDQDVLSALAEVEQLSKMVSEAKLRADEAKQSAEDILLKTNATKEKMDKSNEELRNLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVESLSQVEVILQHSAADIARAEMLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDIQGTQNLLTSVGIHNHYMNGNTPTYTLTRKVHLLSMNRNSYNSTLKDSFNKSKLLR", "length": 1675, "header": "tr|A0A7I2V5X5-1|A0A7I2V5X5_HUMAN Computationally mapped isoform of Laminin subunit beta 1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=1 CANONICAL=P07942-1" }, "locus": { "chromosome": "7", "start_pos": 108002885, "end_pos": 107928926, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676777.1", "url": "https://www.ensembl.org/id/ENST00000676777.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504756.1", "url": "https://www.ensembl.org/id/ENSP00000504756.1" } ] } }, { "isoform_ac": "A0A7I2V682-1", "url": "", "sequence": { "sequence": "MGLLQLLAFSFLALCRARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSISCHFDMAVYLATGNVSGGVCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTGLIAGQCRCKLNVEGEHCDVCKEGFYDLSSEDPFGCKSCACNPLGTIPGGNPCDSETGHCYCKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCFAESGQCSCRPHMIGRQCNEVEPGYYFATLDHYLYEAEEANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFFIDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGRIPTSSRCGNTIPDDDNQVVSLSPGSRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGGSGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGSLSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPSGCKPCECHLQGSVNAFCNPVTGQCHCFQGVYARQCDRCLPGHWGFPSCQPCQCNGHADDCDPVTGECLNCQDYTMGHNCERCLAGYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCASGYFGNPSEVGGSCQPCQCHNNIDTTDPEACDKETGRCLKCLYHTEGEHCQFCRFGYYGDALQQDCRKCVCNYLGTVQEHCNGSDCQCDKATGQCLCLPNVIGQNCDRCAPNTWQLASGTGCDPCNCNAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDVECRACDCDPRGIETPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRFLEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDVTEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEFIKNSDIREMGSCYAAQAGLELLDSSDPPVSDF", "length": 1340, "header": "tr|A0A7I2V682-1|A0A7I2V682_HUMAN Computationally mapped isoform of Laminin subunit beta 1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=1 CANONICAL=P07942-1" }, "locus": { "chromosome": "7", "start_pos": 108002885, "end_pos": 107936300, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678892.1", "url": "https://www.ensembl.org/id/ENST00000678892.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504841.1", "url": "https://www.ensembl.org/id/ENSP00000504841.1" } ] } }, { "isoform_ac": "C9J296-1", "url": "", "sequence": { "sequence": "MGLLQLLAFSFLETAGPGASLEWRSLETTPEPQGLSMGSPSSGKRRPPRAPAPRPQRSAGDPRACTHTHSRFPSSQISTRTLTPRMRGLPRARGFTCVALCRARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSISCHFDMAVYLATGNVSGGVCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTGLIAGQCRCKLNVEGEHCDVCKEGFYDLSSEDPFGCKSCACNPLGTIPGGNPCDSETGHCYCKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCFAESGQCSCRPHMIGRQCNEVEPGYYFATLDHYLYEAEEANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFFIDNIPYSMEYDILIRYEPQ", "length": 705, "header": "tr|C9J296-1|C9J296_HUMAN Computationally mapped isoform of Laminin subunit beta 1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2 CANONICAL=P07942-1" }, "locus": { "chromosome": "7", "start_pos": 108002885, "end_pos": 107962905, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000439976.6", "url": "https://www.ensembl.org/id/ENST00000439976.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000412686.2", "url": "https://www.ensembl.org/id/ENSP00000412686.2" } ] } }, { "isoform_ac": "E7EPA6-1", "url": "", "sequence": { "sequence": "MGLLQLLAFSFLALCRARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSISCHFDMAVYLATGNVSGGVCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTGLIAGQCRCKLNVEGEHCDVCKEGFYDLSSEDPFGCKSCACNPLGTIPGGNPCDSETGHCYCKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCFAESGQCSCRPHMIGRQCNEVEPGYYFATLDHYLYEAEEANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFFIDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGRIPTSSRCGNTIPDDDNQVVSLSPGSRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGGSGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGSLSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPSGCKRRFLKSIVMHSFRLTQPLWQGSIAAEPMLPS", "length": 850, "header": "tr|E7EPA6-1|E7EPA6_HUMAN Computationally mapped isoform of Laminin subunit beta 1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=1 CANONICAL=P07942-1" }, "locus": { "chromosome": "7", "start_pos": 108002885, "end_pos": 107959599, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000393560.5", "url": "https://www.ensembl.org/id/ENST00000393560.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000377190.1", "url": "https://www.ensembl.org/id/ENSP00000377190.1" } ] } }, { "isoform_ac": "E9PCS6-1", "url": "", "sequence": { "sequence": "MGLLQLLAFSFLALCRARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTT", "length": 102, "header": "tr|E9PCS6-1|E9PCS6_HUMAN Computationally mapped isoform of Laminin subunit beta 1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2 CANONICAL=P07942-1" }, "locus": { "chromosome": "7", "start_pos": 108002885, "end_pos": 107998400, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000393559.2", "url": "https://www.ensembl.org/id/ENST00000393559.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000377189.2", "url": "https://www.ensembl.org/id/ENSP00000377189.2" } ] } }, { "isoform_ac": "G3XAI2-1", "url": "", "sequence": { "sequence": "MTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSISCHFDMAVYLATGNVSGGVCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTGLIAGQCRCKLNVEGEHCDVCKEGFYDLSSEDPFGCKSCACNPLGTIPGGNPCDSETGHCYCKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCFAESGQCSCRPHMIGRQCNEVEPGYYFATLDHYLYEAEEANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFFIDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGRIPTSSRCGNTIPDDDNQVVSLSPGSRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGGSGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGSLSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPSGCKPCECHLQGSVNAFCNPVTGQCHCFQGVYARQCDRCLPGHWGFPSCQPCQCNGHADDCDPVTGECLNCQDYTMGHNCERCLAGYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCASGYFGNPSEVGGSCQPCQCHNNIDTTDPEACDKETGRCLKCLYHTEGEHCQFCRFGYYGDALQQDCRKCVCNYLGTVQEHCNGSDCQCDKATGQCLCLPNVIGQNCDRCAPNTWQLASGTGCDPCNCNAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDVECRACDCDPRGIETPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRFLEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDVTEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEFIKNSDIRGALDSITKYFQMSLEAEERVNASTTEPNSTVEQSALMRDRVEDVMMERESQFKEKQEEQARLLDELAGKLQSLDLSAAAEMTCGTPPGASCSETECGGPNCRTDEGERKCGGPGCGGLVTVAHNAWQKAMDLDQDVLSALAEVEQLSKMVSEAKLRADEAKQSAEDILLKTNATKEKMDKSNEELRNLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVESLSQVEVILQHSAADIARAEMLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDIQGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVKQSAEDVKKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLLKDLERKYEDNQRYLEDKAQELARLEGEVRSLLKDISQKVAVYSTCL", "length": 1649, "header": "tr|G3XAI2-1|G3XAI2_HUMAN Computationally mapped isoform of Laminin subunit beta 1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2 CANONICAL=P07942-1" }, "locus": { "chromosome": "7", "start_pos": 107994898, "end_pos": 107923954, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000393561.6", "url": "https://www.ensembl.org/id/ENST00000393561.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000377191.2", "url": "https://www.ensembl.org/id/ENSP00000377191.2" } ] } }, { "isoform_ac": "P07942-1", "url": "", "sequence": { "sequence": "MGLLQLLAFSFLALCRARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSISCHFDMAVYLATGNVSGGVCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTGLIAGQCRCKLNVEGEHCDVCKEGFYDLSSEDPFGCKSCACNPLGTIPGGNPCDSETGHCYCKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCFAESGQCSCRPHMIGRQCNEVEPGYYFATLDHYLYEAEEANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFFIDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGRIPTSSRCGNTIPDDDNQVVSLSPGSRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGGSGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGSLSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPSGCKPCECHLQGSVNAFCNPVTGQCHCFQGVYARQCDRCLPGHWGFPSCQPCQCNGHADDCDPVTGECLNCQDYTMGHNCERCLAGYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCASGYFGNPSEVGGSCQPCQCHNNIDTTDPEACDKETGRCLKCLYHTEGEHCQFCRFGYYGDALQQDCRKCVCNYLGTVQEHCNGSDCQCDKATGQCLCLPNVIGQNCDRCAPNTWQLASGTGCDPCNCNAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDVECRACDCDPRGIETPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRFLEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDVTEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEFIKNSDIRGALDSITKYFQMSLEAEERVNASTTEPNSTVEQSALMRDRVEDVMMERESQFKEKQEEQARLLDELAGKLQSLDLSAAAEMTCGTPPGASCSETECGGPNCRTDEGERKCGGPGCGGLVTVAHNAWQKAMDLDQDVLSALAEVEQLSKMVSEAKLRADEAKQSAEDILLKTNATKEKMDKSNEELRNLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVESLSQVEVILQHSAADIARAEMLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDIQGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVKQSAEDVKKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLLKDLERKYEDNQRYLEDKAQELARLEGEVRSLLKDISQKVAVYSTCL", "length": 1786, "header": "sp|P07942-1|LAMB1_HUMAN Isoform 1 of Laminin subunit beta-1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2 CANONICAL=P07942-1" }, "locus": { "chromosome": "7", "start_pos": 108002885, "end_pos": 107923954, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000222399.11", "url": "https://www.ensembl.org/id/ENST00000222399.11" }, { "database": "Ensembl Peptide", "id": "ENSP00000222399.6", "url": "https://www.ensembl.org/id/ENSP00000222399.6" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1041, "start_aa": "Asn", "end_pos": 1041, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1041", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1041, "start_aa": "Asn", "end_pos": 1041, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1041", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1041, "start_aa": "Asn", "end_pos": 1041, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1041", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1041, "start_aa": "Asn", "end_pos": 1041, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1041", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 1041, "start_aa": "Asn", "end_pos": 1041, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1041", "evidence": [ { "id": "P07942", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07942#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 1195, "start_aa": "Asn", "end_pos": 1195, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1195", "evidence": [ { "id": "P07942", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07942#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 120, "start_aa": "Asn", "end_pos": 120, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn120", "evidence": [ { "id": "P07942", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07942#ptm_processing" } ] }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1279, "start_aa": "Asn", "end_pos": 1279, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1279", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1279, "start_aa": "Asn", "end_pos": 1279, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1279", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1279, "start_aa": "Asn", "end_pos": 1279, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1279", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14260UH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1279, "start_aa": "Asn", "end_pos": 1279, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1279", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20312EM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1279, "start_aa": "Asn", "end_pos": 1279, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1279", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1279, "start_aa": "Asn", "end_pos": 1279, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1279", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G34617SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1279, "start_aa": "Asn", "end_pos": 1279, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1279", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1279, "start_aa": "Asn", "end_pos": 1279, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1279", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1279, "start_aa": "Asn", "end_pos": 1279, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1279", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G51640FO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1279, "start_aa": "Asn", "end_pos": 1279, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1279", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G52131KU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1279, "start_aa": "Asn", "end_pos": 1279, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1279", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G57888GL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1279, "start_aa": "Asn", "end_pos": 1279, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1279", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G62894KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1279, "start_aa": "Asn", "end_pos": 1279, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1279", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1279, "start_aa": "Asn", "end_pos": 1279, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1279", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1279, "start_aa": "Asn", "end_pos": 1279, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1279", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66760KM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1279, "start_aa": "Asn", "end_pos": 1279, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1279", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1279, "start_aa": "Asn", "end_pos": 1279, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1279", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1279, "start_aa": "Asn", "end_pos": 1279, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1279", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1279, "start_aa": "Asn", "end_pos": 1279, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1279", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G83633GK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1279, "start_aa": "Asn", "end_pos": 1279, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1279", "evidence": [ { "id": "P07942", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1279, "start_aa": "Asn", "end_pos": 1279, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1279", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G96577RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1279, "start_aa": "Asn", "end_pos": 1279, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1279", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1279, "start_aa": "Asn", "end_pos": 1279, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1279", "evidence": [ { "id": "P07942", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P07942", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07942#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1280, "start_aa": "Ser", "end_pos": 1280, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1280", "evidence": [ { "id": "P07942", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07942" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "P07942", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P07942" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1336, "start_aa": "Asn", "end_pos": 1336, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1336", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1336, "start_aa": "Asn", "end_pos": 1336, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1336", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1336, "start_aa": "Asn", "end_pos": 1336, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1336", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1336, "start_aa": "Asn", "end_pos": 1336, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1336", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 1336, "start_aa": "Asn", "end_pos": 1336, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1336", "evidence": [ { "id": "P07942", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07942#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 1343, "start_aa": "Asn", "end_pos": 1343, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1343", "evidence": [ { "id": "P07942", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07942#ptm_processing" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "CGGPGCGGLVTVAHNAWQK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1425, "start_aa": "Cys", "end_pos": 1443, "end_aa": "Lys", "evidence": [ { "id": "P07942", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "VTVAHNAW", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1434, "start_aa": "Val", "end_pos": 1441, "end_aa": "Trp", "evidence": [ { "id": "P07942", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1435, "start_aa": "Thr", "end_pos": 1435, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1435", "evidence": [ { "id": "P07942", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 1487, "start_aa": "Asn", "end_pos": 1487, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1487", "evidence": [ { "id": "P07942", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07942#ptm_processing" } ] }, { "glytoucan_ac": "G13694XX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1542, "start_aa": "Asn", "end_pos": 1542, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1542", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G71560PC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1542, "start_aa": "Asn", "end_pos": 1542, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1542", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G89205CJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1542, "start_aa": "Asn", "end_pos": 1542, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1542", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 1542, "start_aa": "Asn", "end_pos": 1542, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1542", "evidence": [ { "id": "P07942", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07942#ptm_processing" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1678, "start_aa": "Thr", "end_pos": 1678, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1678", "evidence": [ { "id": "P07942", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "G38663NM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 356, "start_aa": "Asn", "end_pos": 356, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn356", "evidence": [ { "id": "P07942", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07942#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 519, "start_aa": "Asn", "end_pos": 519, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn519", "evidence": [ { "id": "P07942", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07942#ptm_processing" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 677, "start_aa": "Asn", "end_pos": 677, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn677", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 677, "start_aa": "Asn", "end_pos": 677, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn677", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25418HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 677, "start_aa": "Asn", "end_pos": 677, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn677", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 677, "start_aa": "Asn", "end_pos": 677, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn677", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G33791AF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 677, "start_aa": "Asn", "end_pos": 677, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn677", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 677, "start_aa": "Asn", "end_pos": 677, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn677", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 677, "start_aa": "Asn", "end_pos": 677, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn677", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 677, "start_aa": "Asn", "end_pos": 677, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn677", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G80223IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 677, "start_aa": "Asn", "end_pos": 677, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn677", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 677, "start_aa": "Asn", "end_pos": 677, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn677", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 677, "start_aa": "Asn", "end_pos": 677, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn677", "evidence": [ { "id": "1442", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1442" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 677, "start_aa": "Asn", "end_pos": 677, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn677", "evidence": [ { "id": "P07942", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P07942", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07942#ptm_processing" } ] } ], "phosphorylation": [ { "start_pos": 1280, "end_pos": 1280, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07942", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07942" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ], "site_lbl": "Ser1280" }, { "start_pos": 1281, "end_pos": 1281, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07942", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07942" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ], "site_lbl": "Thr1281" }, { "start_pos": 1478, "end_pos": 1478, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by FAM20C", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" }, { "database": "iPTMnet", "id": "P07942", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07942" }, { "database": "PubMed", "id": "26091039", "url": "https://glygen.org/publication/PubMed/26091039" } ], "site_lbl": "Ser1478" }, { "start_pos": 1496, "end_pos": 1496, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by FAM20C", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" }, { "database": "iPTMnet", "id": "P07942", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07942" }, { "database": "PubMed", "id": "26091039", "url": "https://glygen.org/publication/PubMed/26091039" } ], "site_lbl": "Ser1496" }, { "start_pos": 154, "end_pos": 154, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07942", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07942" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" } ], "site_lbl": "Ser154" }, { "start_pos": 1666, "end_pos": 1666, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by FAM20C", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" }, { "database": "iPTMnet", "id": "P07942", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07942" }, { "database": "PubMed", "id": "26091039", "url": "https://glygen.org/publication/PubMed/26091039" } ], "site_lbl": "Ser1666" }, { "start_pos": 1682, "end_pos": 1682, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by FAM20C", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" }, { "database": "iPTMnet", "id": "P07942", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07942" }, { "database": "PubMed", "id": "26091039", "url": "https://glygen.org/publication/PubMed/26091039" } ], "site_lbl": "Ser1682" }, { "start_pos": 1735, "end_pos": 1735, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07942", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07942" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser1735" }, { "start_pos": 242, "end_pos": 242, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07942", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07942" }, { "database": "PubMed", "id": "19562805", "url": "https://glygen.org/publication/PubMed/19562805" } ], "site_lbl": "Thr242" }, { "start_pos": 250, "end_pos": 250, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "site_lbl": "Ser250" }, { "start_pos": 939, "end_pos": 939, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07942", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07942" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" } ], "site_lbl": "Thr939" }, { "start_pos": 950, "end_pos": 950, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07942", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07942" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" } ], "site_lbl": "Tyr950" }, { "start_pos": 953, "end_pos": 953, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07942", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07942" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" } ], "site_lbl": "Ser953" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported", "glycoprotein_predicted" ], "publication": [ { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology", "journal": "EMBO J", "date": "2013", "authors": "Steentoft C., Vakhrushev S.Y., Joshi H.J., Kong Y., Vester-Christensen M.B., Schjoldager K.T., Lavrsen K., Dabelsteen S., Pedersen N.B., Marcos-Silva L., Gupta R., Bennett E.P., Mandel U., Brunak S., Wandall H.H., Levery S.B., Clausen H.", "evidence": [ { "database": "UniCarbKB", "id": "P07942", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1038/emboj.2013.79", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "title": "Probing the O-Glycoproteome of Gastric Cancer Cell Lines for Biomarker Discovery", "journal": "Molecular & Cellular Proteomics", "date": "2015", "authors": "Campos D., Freitas D., Gomes J., Magalh\u00e3es A., Steentoft C., Gomes C., Vester-Christensen M. B., Ferreira J. A., Afonso L. P., Santos L. L., Pinto de Sousa J., Mandel U., Clausen H., Vakhrushev S. Y., Reis C. A.", "evidence": [ { "database": "UniCarbKB", "id": "P07942", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1074/mcp.M114.046862", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "title": "Binding of the G domains of laminin alpha1 and alpha2 chains and perlecan to heparin, sulfatides, alpha-dystroglycan and several extracellular matrix proteins.", "journal": "The EMBO journal", "date": "1999", "authors": "Talts JF, Andac Z, Gohring W, Brancaccio A, Timpl R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "10022829", "url": "https://glygen.org/publication/PubMed/10022829" } ] }, { "title": "N-Linked glycosylation and sialylation of the acid-labile subunit. Role in complex formation with insulin-like growth factor (IGF)-binding protein-3 and the IGFs.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Janosi JB, Firth SM, Bond JJ, Baxter RC, Delhanty PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10026136", "url": "https://glygen.org/publication/PubMed/10026136" } ] }, { "title": "The insulin-like growth factor (IGF)-dependent IGF binding protein-4 protease secreted by human fibroblasts is pregnancy-associated plasma protein-A.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Lawrence JB, Oxvig C, Overgaard MT, Sottrup-Jensen L, Gleich GJ, Hays LG, Yates JR 3rd, Conover CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10077652", "url": "https://glygen.org/publication/PubMed/10077652" } ] }, { "title": "The EGR family of transcription-regulatory factors: progress at the interface of molecular and systems neuroscience.", "journal": "Trends in neurosciences", "date": "1999", "authors": "O'Donovan KJ, Tourtellotte WG, Millbrandt J, Baraban JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "10203854", "url": "https://glygen.org/publication/PubMed/10203854" } ] }, { "title": "The cleavage site specificity of human prostate specific antigen for insulin-like growth factor binding protein-3.", "journal": "FEBS letters", "date": "1999", "authors": "Okabe E, Kajihara J, Usami Y, Hirano K", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10218588", "url": "https://glygen.org/publication/PubMed/10218588" } ] }, { "title": "Phosphorylation of CREB in axon-induced Schwann cell proliferation.", "journal": "Journal of neuroscience research", "date": "1999", "authors": "Lee MM, Badache A, DeVries GH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "10220111", "url": "https://glygen.org/publication/PubMed/10220111" } ] }, { "title": "Fibrillin degradation by matrix metalloproteinases: implications for connective tissue remodelling.", "journal": "The Biochemical journal", "date": "1999", "authors": "Ashworth JL, Murphy G, Rock MJ, Sherratt MJ, Shapiro SD, Shuttleworth CA, Kielty CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "10229672", "url": "https://glygen.org/publication/PubMed/10229672" } ] }, { "title": "Agrin in Alzheimer's disease: altered solubility and abnormal distribution within microvasculature and brain parenchyma.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Donahue JE, Berzin TM, Rafii MS, Glass DJ, Yancopoulos GD, Fallon JR, Stopa EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "10339611", "url": "https://glygen.org/publication/PubMed/10339611" } ] }, { "title": "Fibrillin degradation by matrix metalloproteinases: identification of amino- and carboxy-terminal cleavage sites.", "journal": "FEBS letters", "date": "1999", "authors": "Hindson VJ, Ashworth JL, Rock MJ, Cunliffe S, Shuttleworth CA, Kielty CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "10386589", "url": "https://glygen.org/publication/PubMed/10386589" } ] }, { "title": "Identification of conserved cis-elements and transcription factors required for sterol-regulated transcription of stearoyl-CoA desaturase 1 and 2.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Tabor DE, Kim JB, Spiegelman BM, Edwards PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "10400691", "url": "https://glygen.org/publication/PubMed/10400691" } ] }, { "title": "Inflammation-related neutrophil proteases, cathepsin G and elastase, function as insulin-like growth factor binding protein proteases.", "journal": "Growth hormone & IGF research : official journal of the Growth Hormone Research Society and the International IGF Research Society", "date": "1999", "authors": "Gibson TL, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10512690", "url": "https://glygen.org/publication/PubMed/10512690" } ] }, { "title": "HGF induces FAK activation and integrin-mediated adhesion in MTLn3 breast carcinoma cells.", "journal": "International journal of cancer", "date": "1999", "authors": "Beviglia L, Kramer RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874081", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081" } ], "reference": [ { "type": "PubMed", "id": "10521801", "url": "https://glygen.org/publication/PubMed/10521801" } ] }, { "title": "A central domain binding site in insulin-like growth factor binding protein-5 for the acid-labile subunit.", "journal": "Endocrinology", "date": "2000", "authors": "Twigg SM, Kiefer MC, Zapf J, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10614670", "url": "https://glygen.org/publication/PubMed/10614670" } ] }, { "title": "Agrin binds to beta-amyloid (Abeta), accelerates abeta fibril formation, and is localized to Abeta deposits in Alzheimer's disease brain.", "journal": "Molecular and cellular neurosciences", "date": "2000", "authors": "Cotman SL, Halfter W, Cole GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "10673326", "url": "https://glygen.org/publication/PubMed/10673326" } ] }, { "title": "Insulin-like growth factor binding protein (IGFBP)-3-bound IGF-I and IGFBP-3-bound IGF-II in growth hormone deficiency.", "journal": "Hormone research", "date": "1999", "authors": "Belgorosky A, Rivarola MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10681634", "url": "https://glygen.org/publication/PubMed/10681634" } ] }, { "title": "EMMPRIN (CD147), an inducer of matrix metalloproteinase synthesis, also binds interstitial collagenase to the tumor cell surface.", "journal": "Cancer research", "date": "2000", "authors": "Guo H, Li R, Zucker S, Toole BP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "10706100", "url": "https://glygen.org/publication/PubMed/10706100" } ] }, { "title": "Myelin synthesis in the peripheral nervous system.", "journal": "Progress in neurobiology", "date": "2000", "authors": "Garbay B, Heape AM, Sargueil F, Cassagne C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "10727776", "url": "https://glygen.org/publication/PubMed/10727776" } ] }, { "title": "Protein zero gene expression is regulated by the glial transcription factor Sox10.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Peirano RI, Goerich DE, Riethmacher D, Wegner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "10757804", "url": "https://glygen.org/publication/PubMed/10757804" } ] }, { "title": "Biochemical characterization of the catalytic domain of human matrix metalloproteinase 19. Evidence for a role as a potent basement membrane degrading enzyme.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Stracke JO, Hutton M, Stewart M, Pendas AM, Smith B, Lopez-Otin C, Murphy G, Knauper V", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "10809722", "url": "https://glygen.org/publication/PubMed/10809722" } ] }, { "title": "Binding characteristics of pro-insulin-like growth factor-II from cancer patients: binary and ternary complex formation with IGF binding proteins-1 to -6.", "journal": "The Journal of endocrinology", "date": "2000", "authors": "Bond JJ, Meka S, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10810289", "url": "https://glygen.org/publication/PubMed/10810289" } ] }, { "title": "A distal Schwann cell-specific enhancer mediates axonal regulation of the Oct-6 transcription factor during peripheral nerve development and regeneration.", "journal": "The EMBO journal", "date": "2000", "authors": "Mandemakers W, Zwart R, Jaegle M, Walbeehm E, Visser P, Grosveld F, Meijer D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "10856243", "url": "https://glygen.org/publication/PubMed/10856243" } ] }, { "title": "Evidence that the interaction between insulin-like growth factor (IGF)-II and IGF binding protein (IGFBP)-4 is essential for the action of the IGF-II-dependent IGFBP-4 protease.", "journal": "Archives of biochemistry and biophysics", "date": "2000", "authors": "Qin X, Byun D, Lau KH, Baylink DJ, Mohan S", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10898936", "url": "https://glygen.org/publication/PubMed/10898936" } ] }, { "title": "Effects of IGFBP-2 overexpression in vitro and in vivo.", "journal": "Pediatric nephrology (Berlin, Germany)", "date": "2000", "authors": "Wolf E, Lahm H, Wu M, Wanke R, Hoeflich A", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10912521", "url": "https://glygen.org/publication/PubMed/10912521" } ] }, { "title": "O-glycosylation of insulin-like growth factor (IGF) binding protein-6 maintains high IGF-II binding affinity by decreasing binding to glycosaminoglycans and susceptibility to proteolysis.", "journal": "European journal of biochemistry", "date": "2000", "authors": "Marinaro JA, Neumann GM, Russo VC, Leeding KS, Bach LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10951195", "url": "https://glygen.org/publication/PubMed/10951195" } ] }, { "title": "Brevican is degraded by matrix metalloproteinases and aggrecanase-1 (ADAMTS4) at different sites.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Nakamura H, Fujii Y, Inoki I, Sugimoto K, Tanzawa K, Matsuki H, Miura R, Yamaguchi Y, Okada Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "10986281", "url": "https://glygen.org/publication/PubMed/10986281" } ] }, { "title": "Prostate carcinoma (PC-3) cell proliferation is stimulated by the 22-25-kDa proteolytic fragment (1-160) and inhibited by the 16-kDa fragment (1-95) of recombinant human insulin-like growth factor binding protein-3.", "journal": "Growth hormone & IGF research : official journal of the Growth Hormone Research Society and the International IGF Research Society", "date": "1998", "authors": "Angelloz-Nicoud P, Lalou C, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10990447", "url": "https://glygen.org/publication/PubMed/10990447" } ] }, { "title": "Integrins as receptors for laminins.", "journal": "Microscopy research and technique", "date": "2000", "authors": "Belkin AM, Stepp MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "11054877", "url": "https://glygen.org/publication/PubMed/11054877" } ] }, { "title": "Mutations in cartilage oligomeric matrix protein causing pseudoachondroplasia and multiple epiphyseal dysplasia affect binding of calcium and collagen I, II, and IX.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Thur J, Rosenberg K, Nitsche DP, Pihlajamaa T, Ala-Kokko L, Heinegard D, Paulsson M, Maurer P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "11084047", "url": "https://glygen.org/publication/PubMed/11084047" } ] }, { "title": "A sarcoglycan-dystroglycan complex anchors Dp116 and utrophin in the peripheral nervous system.", "journal": "Human molecular genetics", "date": "2000", "authors": "Imamura M, Araishi K, Noguchi S, Ozawa E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "11115854", "url": "https://glygen.org/publication/PubMed/11115854" } ] }, { "title": "Periaxin mutations cause recessive Dejerine-Sottas neuropathy.", "journal": "American journal of human genetics", "date": "2001", "authors": "Boerkoel CF, Takashima H, Stankiewicz P, Garcia CA, Leber SM, Rhee-Morris L, Lupski JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "11133365", "url": "https://glygen.org/publication/PubMed/11133365" } ] }, { "title": "A mutation in periaxin is responsible for CMT4F, an autosomal recessive form of Charcot-Marie-Tooth disease.", "journal": "Human molecular genetics", "date": "2001", "authors": "Guilbot A, Williams A, Ravise N, Verny C, Brice A, Sherman DL, Brophy PJ, LeGuern E, Delague V, Bareil C, Megarbane A, Claustres M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "11157804", "url": "https://glygen.org/publication/PubMed/11157804" } ] }, { "title": "Pregnancy-associated plasma protein-A accounts for the insulin-like growth factor (IGF)-binding protein-4 (IGFBP-4) proteolytic activity in human pregnancy serum and enhances the mitogenic activity of IGF by degrading IGFBP-4 in vitro.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2001", "authors": "Byun D, Mohan S, Yoo M, Sexton C, Baylink DJ, Qin X", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11158056", "url": "https://glygen.org/publication/PubMed/11158056" } ] }, { "title": "Ligand-binding characteristics of recombinant amino- and carboxyl-terminal fragments of human insulin-like growth factor-binding protein-3.", "journal": "The Journal of endocrinology", "date": "2001", "authors": "Galanis M, Firth SM, Bond J, Nathanielsz A, Kortt AA, Hudson PJ, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11250653", "url": "https://glygen.org/publication/PubMed/11250653" } ] }, { "title": "Biglycan and decorin bind close to the n-terminal region of the collagen VI triple helix.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Wiberg C, Hedbom E, Khairullina A, Lamande SR, Oldberg A, Timpl R, Morgelin M, Heinegard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "11259413", "url": "https://glygen.org/publication/PubMed/11259413" } ] }, { "title": "Pregnancy-associated plasma protein-A2 (PAPP-A2), a novel insulin-like growth factor-binding protein-5 proteinase.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Overgaard MT, Boldt HB, Laursen LS, Sottrup-Jensen L, Conover CA, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11264294", "url": "https://glygen.org/publication/PubMed/11264294" } ] }, { "title": "Mutagenesis of basic amino acids in the carboxyl-terminal region of insulin-like growth factor binding protein-5 affects acid-labile subunit binding.", "journal": "Endocrinology", "date": "2001", "authors": "Firth SM, Clemmons DR, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11316783", "url": "https://glygen.org/publication/PubMed/11316783" } ] }, { "title": "A distal upstream enhancer from the myelin basic protein gene regulates expression in myelin-forming schwann cells.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2001", "authors": "Forghani R, Garofalo L, Foran DR, Farhadi HF, Lepage P, Hudson TJ, Tretjakoff I, Valera P, Peterson A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "11356866", "url": "https://glygen.org/publication/PubMed/11356866" } ] }, { "title": "Osteopontin, a novel substrate for matrix metalloproteinase-3 (stromelysin-1) and matrix metalloproteinase-7 (matrilysin).", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Agnihotri R, Crawford HC, Haro H, Matrisian LM, Havrda MC, Liaw L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "11375993", "url": "https://glygen.org/publication/PubMed/11375993" } ] }, { "title": "EGR2 mutations in inherited neuropathies dominant-negatively inhibit myelin gene expression.", "journal": "Neuron", "date": "2001", "authors": "Nagarajan R, Svaren J, Le N, Araki T, Watson M, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "11394999", "url": "https://glygen.org/publication/PubMed/11394999" } ] }, { "title": "Do Schwann cells stop, DR(o)P2, and roll?", "journal": "Neuron", "date": "2001", "authors": "Wrabetz L, Feltri ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "11430795", "url": "https://glygen.org/publication/PubMed/11430795" } ] }, { "title": "Specific disruption of a schwann cell dystrophin-related protein complex in a demyelinating neuropathy.", "journal": "Neuron", "date": "2001", "authors": "Sherman DL, Fabrizi C, Gillespie CS, Brophy PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "11430802", "url": "https://glygen.org/publication/PubMed/11430802" } ] }, { "title": "Pregnancy-associated plasma protein-A (PAPP-A) cleaves insulin-like growth factor binding protein (IGFBP)-5 independent of IGF: implications for the mechanism of IGFBP-4 proteolysis by PAPP-A.", "journal": "FEBS letters", "date": "2001", "authors": "Laursen LS, Overgaard MT, Soe R, Boldt HB, Sottrup-Jensen L, Giudice LC, Conover CA, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11522292", "url": "https://glygen.org/publication/PubMed/11522292" } ] }, { "title": "Insulin-like growth factor-binding protein-5 inhibits growth and induces differentiation of mouse osteosarcoma cells.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Schneider MR, Zhou R, Hoeflich A, Krebs O, Schmidt J, Mohan S, Wolf E, Lahm H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11606061", "url": "https://glygen.org/publication/PubMed/11606061" } ] }, { "title": "Human Connexin 32, a gap junction protein altered in the X-linked form of Charcot-Marie-Tooth disease, is directly regulated by the transcription factor SOX10.", "journal": "Human molecular genetics", "date": "2001", "authors": "Bondurand N, Girard M, Pingault V, Lemort N, Dubourg O, Goossens M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "11734543", "url": "https://glygen.org/publication/PubMed/11734543" } ] }, { "title": "IGFBP-3 binding to endothelial cells inhibits plasmin and thrombin proteolysis.", "journal": "American journal of physiology. Endocrinology and metabolism", "date": "2002", "authors": "Booth BA, Boes M, Dake BL, Knudtson KL, Bar RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11739083", "url": "https://glygen.org/publication/PubMed/11739083" } ] }, { "title": "Insulin-like growth factor-binding protein 2 in tumorigenesis: protector or promoter?", "journal": "Cancer research", "date": "2001", "authors": "Hoeflich A, Reisinger R, Lahm H, Kiess W, Blum WF, Kolb HJ, Weber MM, Wolf E", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11751371", "url": "https://glygen.org/publication/PubMed/11751371" } ] }, { "title": "Characterisation of cis-acting sequences reveals a biphasic, axon-dependent regulation of Krox20 during Schwann cell development.", "journal": "Development (Cambridge, England)", "date": "2002", "authors": "Ghislain J, Desmarquet-Trin-Dinh C, Jaegle M, Meijer D, Charnay P, Frain M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "11782409", "url": "https://glygen.org/publication/PubMed/11782409" } ] }, { "title": "Molecular distribution of IGF binding protein-5 in human serum.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2002", "authors": "Baxter RC, Meka S, Firth SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11788658", "url": "https://glygen.org/publication/PubMed/11788658" } ] }, { "title": "Not all perlecans are created equal: interactions with fibroblast growth factor (FGF) 2 and FGF receptors.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Knox S, Merry C, Stringer S, Melrose J, Whitelock J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000171" } ], "reference": [ { "type": "PubMed", "id": "11847221", "url": "https://glygen.org/publication/PubMed/11847221" } ] }, { "title": "Overexpression of alpha(v)beta6 integrin in serous epithelial ovarian cancer regulates extracellular matrix degradation via the plasminogen activation cascade.", "journal": "Carcinogenesis", "date": "2002", "authors": "Ahmed N, Pansino F, Clyde R, Murthi P, Quinn MA, Rice GE, Agrez MV, Mok S, Baker MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "11872628", "url": "https://glygen.org/publication/PubMed/11872628" } ] }, { "title": "Regulation of melanoma cell migration and invasion by laminin-5 and alpha3beta1 integrin (VLA-3).", "journal": "Clinical & experimental metastasis", "date": "2002", "authors": "Tsuji T, Kawada Y, Kai-Murozono M, Komatsu S, Han SA, Takeuchi K, Mizushima H, Miyazaki K, Irimura T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "11964076", "url": "https://glygen.org/publication/PubMed/11964076" } ] }, { "title": "Identification of the regulatory region of the peripheral myelin protein 22 (PMP22) gene that directs temporal and spatial expression in development and regeneration of peripheral nerves.", "journal": "Molecular and cellular neurosciences", "date": "2002", "authors": "Maier M, Berger P, Nave KA, Suter U", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "12056842", "url": "https://glygen.org/publication/PubMed/12056842" } ] }, { "title": "A cAMP-responsive element binding site is essential for sterol regulation of the human lanosterol 14alpha-demethylase gene (CYP51).", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2002", "authors": "Halder SK, Fink M, Waterman MR, Rozman D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "12145339", "url": "https://glygen.org/publication/PubMed/12145339" } ] }, { "title": "Matriptase-2, a membrane-bound mosaic serine proteinase predominantly expressed in human liver and showing degrading activity against extracellular matrix proteins.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Velasco G, Cal S, Quesada V, Sanchez LM, Lopez-Otin C", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "12149247", "url": "https://glygen.org/publication/PubMed/12149247" } ] }, { "title": "A cell type-specific allele of the POU gene Oct-6 reveals Schwann cell autonomous function in nerve development and regeneration.", "journal": "The EMBO journal", "date": "2002", "authors": "Ghazvini M, Mandemakers W, Jaegle M, Piirsoo M, Driegen S, Koutsourakis M, Smit X, Grosveld F, Meijer D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "12198163", "url": "https://glygen.org/publication/PubMed/12198163" } ] }, { "title": "Matrix-matrix interaction of cartilage oligomeric matrix protein and fibronectin.", "journal": "Matrix biology : journal of the International Society for Matrix Biology", "date": "2002", "authors": "Di Cesare PE, Chen FS, Moergelin M, Carlson CS, Leslie MP, Perris R, Fang C", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "12225811", "url": "https://glygen.org/publication/PubMed/12225811" } ] }, { "title": "Laminin modulates morphogenic properties of the collagen XVIII endostatin domain.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Javaherian K, Park SY, Pickl WF, LaMontagne KR, Sjin RT, Gillies S, Lo KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "12237301", "url": "https://glygen.org/publication/PubMed/12237301" } ] }, { "title": "Substrate specificity of the metalloproteinase pregnancy-associated plasma protein-A (PAPP-A) assessed by mutagenesis and analysis of synthetic peptides: substrate residues distant from the scissile bond are critical for proteolysis.", "journal": "The Biochemical journal", "date": "2002", "authors": "Laursen LS, Overgaard MT, Nielsen CG, Boldt HB, Hopmann KH, Conover CA, Sottrup-Jensen L, Giudice LC, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12241545", "url": "https://glygen.org/publication/PubMed/12241545" } ] }, { "title": "IGF-binding proteins are multifunctional and act via IGF-dependent and -independent mechanisms.", "journal": "The Journal of endocrinology", "date": "2002", "authors": "Mohan S, Baylink DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12379487", "url": "https://glygen.org/publication/PubMed/12379487" } ] }, { "title": "Cellular actions of the insulin-like growth factor binding proteins.", "journal": "Endocrine reviews", "date": "2002", "authors": "Firth SM, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12466191", "url": "https://glygen.org/publication/PubMed/12466191" } ] }, { "title": "Membrane type-1-matrix metalloproteinase expressed by prostate carcinoma cells cleaves human laminin-5 beta3 chain and induces cell migration.", "journal": "Cancer research", "date": "2003", "authors": "Udayakumar TS, Chen ML, Bair EL, Von Bredow DC, Cress AE, Nagle RB, Bowden GT", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "12727852", "url": "https://glygen.org/publication/PubMed/12727852" } ] }, { "title": "The POU proteins Brn-2 and Oct-6 share important functions in Schwann cell development.", "journal": "Genes & development", "date": "2003", "authors": "Jaegle M, Ghazvini M, Mandemakers W, Piirsoo M, Driegen S, Levavasseur F, Raghoenath S, Grosveld F, Meijer D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "12782656", "url": "https://glygen.org/publication/PubMed/12782656" } ] }, { "title": "Regulation of the myelin gene periaxin provides evidence for Krox-20-independent myelin-related signalling in Schwann cells.", "journal": "Molecular and cellular neurosciences", "date": "2003", "authors": "Parkinson DB, Dickinson S, Bhaskaran A, Kinsella MT, Brophy PJ, Sherman DL, Sharghi-Namini S, Duran Alonso MB, Mirsky R, Jessen KR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "12799134", "url": "https://glygen.org/publication/PubMed/12799134" } ] }, { "title": "Amino- and carboxyl-terminal fragments of insulin-like growth factor (IGF) binding protein-3 cooperate to bind IGFs with high affinity and inhibit IGF receptor interactions.", "journal": "Endocrinology", "date": "2003", "authors": "Payet LD, Wang XH, Baxter RC, Firth SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12810533", "url": "https://glygen.org/publication/PubMed/12810533" } ] }, { "title": "The calpain system.", "journal": "Physiological reviews", "date": "2003", "authors": "Goll DE, Thompson VF, Li H, Wei W, Cong J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "12843408", "url": "https://glygen.org/publication/PubMed/12843408" } ] }, { "title": "IGF-binding protein-4: biochemical characteristics and functional consequences.", "journal": "The Journal of endocrinology", "date": "2003", "authors": "Zhou R, Diehl D, Hoeflich A, Lahm H, Wolf E", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12904166", "url": "https://glygen.org/publication/PubMed/12904166" } ] }, { "title": "Structural determinants for binary and ternary complex formation between insulin-like growth factor-I (IGF-I) and IGF binding protein-3.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Baxter RC, Bayne ML, Cascieri MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "1370451", "url": "https://glygen.org/publication/PubMed/1370451" } ] }, { "title": "Mapping of binding sites for heparin, plasminogen activator inhibitor-1, and plasminogen to vitronectin's heparin-binding region reveals a novel vitronectin-dependent feedback mechanism for the control of plasmin formation.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Kost C, Stuber W, Ehrlich HJ, Pannekoek H, Preissner KT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "1376317", "url": "https://glygen.org/publication/PubMed/1376317" } ] }, { "title": "Prostate-specific antigen (PSA) is an insulin-like growth factor binding protein-3 protease found in seminal plasma.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1992", "authors": "Cohen P, Graves HC, Peehl DM, Kamarei M, Giudice LC, Rosenfeld RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "1383255", "url": "https://glygen.org/publication/PubMed/1383255" } ] }, { "title": "Combined analysis of oligonucleotide microarray data from transgenic and knockout mice identifies direct SREBP target genes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Horton JD, Shah NA, Warrington JA, Anderson NN, Park SW, Brown MS, Goldstein JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "14512514", "url": "https://glygen.org/publication/PubMed/14512514" } ] }, { "title": "Local regulation of fat metabolism in peripheral nerves.", "journal": "Genes & development", "date": "2003", "authors": "Verheijen MH, Chrast R, Burrola P, Lemke G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "14522948", "url": "https://glygen.org/publication/PubMed/14522948" } ] }, { "title": "Distinct elements of the peripheral myelin protein 22 (PMP22) promoter regulate expression in Schwann cells and sensory neurons.", "journal": "Molecular and cellular neurosciences", "date": "2003", "authors": "Maier M, Castagner F, Berger P, Suter U", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "14664827", "url": "https://glygen.org/publication/PubMed/14664827" } ] }, { "title": "Neurite outgrowth by the alternatively spliced region of human tenascin-C is mediated by neuronal alpha7beta1 integrin.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2004", "authors": "Mercado ML, Nur-e-Kamal A, Liu HY, Gross SR, Movahed R, Meiners S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "14715956", "url": "https://glygen.org/publication/PubMed/14715956" } ] }, { "title": "HtrA1 serine protease inhibits signaling mediated by Tgfbeta family proteins.", "journal": "Development (Cambridge, England)", "date": "2004", "authors": "Oka C, Tsujimoto R, Kajikawa M, Koshiba-Takeuchi K, Ina J, Yano M, Tsuchiya A, Ueta Y, Soma A, Kanda H, Matsumoto M, Kawaichi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "14973287", "url": "https://glygen.org/publication/PubMed/14973287" } ] }, { "title": "Regulation of dendritic branching and filopodia formation in hippocampal neurons by specific acylated protein motifs.", "journal": "Molecular biology of the cell", "date": "2004", "authors": "Gauthier-Campbell C, Bredt DS, Murphy TH, El-Husseini Ael-D", "evidence": [ { "database": "Reactome", "id": "R-HSA-373760", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-373760" } ], "reference": [ { "type": "PubMed", "id": "14978216", "url": "https://glygen.org/publication/PubMed/14978216" } ] }, { "title": "Interactions between the cartilage oligomeric matrix protein and matrilins. Implications for matrix assembly and the pathogenesis of chondrodysplasias.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Mann HH, Ozbek S, Engel J, Paulsson M, Wagener R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "15075323", "url": "https://glygen.org/publication/PubMed/15075323" } ] }, { "title": "The role of the acid-labile subunit in regulating insulin-like growth factor transport across human umbilical vein endothelial cell monolayers.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2004", "authors": "Payet LD, Firth SM, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15126567", "url": "https://glygen.org/publication/PubMed/15126567" } ] }, { "title": "Autocatalytic cleavage of the EMR2 receptor occurs at a conserved G protein-coupled receptor proteolytic site motif.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Lin HH, Chang GW, Davies JQ, Stacey M, Harris J, Gordon S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "15150276", "url": "https://glygen.org/publication/PubMed/15150276" } ] }, { "title": "DREG, a developmentally regulated G protein-coupled receptor containing two conserved proteolytic cleavage sites.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2004", "authors": "Moriguchi T, Haraguchi K, Ueda N, Okada M, Furuya T, Akiyama T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "15189448", "url": "https://glygen.org/publication/PubMed/15189448" } ] }, { "title": "A novel secreted, cell-surface glycoprotein containing multiple epidermal growth factor-like repeats and one CUB domain is highly expressed in primary osteoblasts and bones.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Wu BT, Su YH, Tsai MT, Wasserman SM, Topper JN, Yang RB", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "15234972", "url": "https://glygen.org/publication/PubMed/15234972" } ] }, { "title": "Structural basis for interactions between tenascins and lectican C-type lectin domains: evidence for a crosslinking role for tenascins.", "journal": "Structure (London, England : 1993)", "date": "2004", "authors": "Lundell A, Olin AI, Morgelin M, al-Karadaghi S, Aspberg A, Logan DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "15296743", "url": "https://glygen.org/publication/PubMed/15296743" } ] }, { "title": "C-terminal domain of insulin-like growth factor (IGF) binding protein-6: structure and interaction with IGF-II.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2004", "authors": "Headey SJ, Keizer DW, Yao S, Brasier G, Kantharidis P, Bach LA, Norton RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15308688", "url": "https://glygen.org/publication/PubMed/15308688" } ] }, { "title": "Restricted growth of Schwann cells lacking Cajal bands slows conduction in myelinated nerves.", "journal": "Nature", "date": "2004", "authors": "Court FA, Sherman DL, Pratt T, Garry EM, Ribchester RR, Cottrell DF, Fleetwood-Walker SM, Brophy PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "15356632", "url": "https://glygen.org/publication/PubMed/15356632" } ] }, { "title": "Binding of the proteoglycan decorin to collagen type VI.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Bidanset DJ, Guidry C, Rosenberg LC, Choi HU, Timpl R, Hook M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "1544908", "url": "https://glygen.org/publication/PubMed/1544908" } ] }, { "title": "Characterization of insulin-like growth factor-free interaction between insulin-like growth factor binding protein 3 and acid labile subunit expressed from Xenopus oocytes.", "journal": "Journal of biochemistry and molecular biology", "date": "2004", "authors": "Choi KY, Kyung YJ, Lee CY, Lee DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15469690", "url": "https://glygen.org/publication/PubMed/15469690" } ] }, { "title": "Role of N- and C-terminal residues of insulin-like growth factor (IGF)-binding protein-3 in regulating IGF complex formation and receptor activation.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Yan X, Forbes BE, McNeil KA, Baxter RC, Firth SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15485880", "url": "https://glygen.org/publication/PubMed/15485880" } ] }, { "title": "Contributions of the N- and C-terminal domains of IGF binding protein-6 to IGF binding.", "journal": "Journal of molecular endocrinology", "date": "2004", "authors": "Headey SJ, Leeding KS, Norton RS, Bach LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15525596", "url": "https://glygen.org/publication/PubMed/15525596" } ] }, { "title": "BMP-1/Tolloid-like metalloproteases process endorepellin, the angiostatic C-terminal fragment of perlecan.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Gonzalez EM, Reed CC, Bix G, Fu J, Zhang Y, Gopalakrishnan B, Greenspan DS, Iozzo RV", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "15591058", "url": "https://glygen.org/publication/PubMed/15591058" } ] }, { "title": "Characterization of human SCD2, an oligomeric desaturase with improved stability and enzyme activity by cross-linking in intact cells.", "journal": "The Biochemical journal", "date": "2005", "authors": "Zhang S, Yang Y, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "15610069", "url": "https://glygen.org/publication/PubMed/15610069" } ] }, { "title": "Structural basis for the regulation of insulin-like growth factors by IGF binding proteins.", "journal": "Structure (London, England : 1993)", "date": "2005", "authors": "Siwanowicz I, Popowicz GM, Wisniewska M, Huber R, Kuenkele KP, Lang K, Engh RA, Holak TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15642270", "url": "https://glygen.org/publication/PubMed/15642270" } ] }, { "title": "Analysis of congenital hypomyelinating Egr2Lo/Lo nerves identifies Sox2 as an inhibitor of Schwann cell differentiation and myelination.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Le N, Nagarajan R, Wang JY, Araki T, Schmidt RE, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "15695336", "url": "https://glygen.org/publication/PubMed/15695336" } ] }, { "title": "Regulation of cholesterol/lipid biosynthetic genes by Egr2/Krox20 during peripheral nerve myelination.", "journal": "Journal of neurochemistry", "date": "2005", "authors": "Leblanc SE, Srinivasan R, Ferri C, Mager GM, Gillian-Daniel AL, Wrabetz L, Svaren J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "15836632", "url": "https://glygen.org/publication/PubMed/15836632" } ] }, { "title": "Characterization of HSCD5, a novel human stearoyl-CoA desaturase unique to primates.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Wang J, Yu L, Schmidt RE, Su C, Huang X, Gould K, Cao G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "15907797", "url": "https://glygen.org/publication/PubMed/15907797" } ] }, { "title": "ADAM10 mediates E-cadherin shedding and regulates epithelial cell-cell adhesion, migration, and beta-catenin translocation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Maretzky T, Reiss K, Ludwig A, Buchholz J, Scholz F, Proksch E, de Strooper B, Hartmann D, Saftig P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "15958533", "url": "https://glygen.org/publication/PubMed/15958533" } ] }, { "title": "RanBPM is an L1-interacting protein that regulates L1-mediated mitogen-activated protein kinase activation.", "journal": "Journal of neurochemistry", "date": "2005", "authors": "Cheng L, Lemmon S, Lemmon V", "evidence": [ { "database": "Reactome", "id": "R-HSA-373760", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-373760" } ], "reference": [ { "type": "PubMed", "id": "16000162", "url": "https://glygen.org/publication/PubMed/16000162" } ] }, { "title": "Human glioblastomas overexpress ADAMTS-5 that degrades brevican.", "journal": "Acta neuropathologica", "date": "2005", "authors": "Nakada M, Miyamori H, Kita D, Takahashi T, Yamashita J, Sato H, Miura R, Yamaguchi Y, Okada Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "16133547", "url": "https://glygen.org/publication/PubMed/16133547" } ] }, { "title": "Nab proteins are essential for peripheral nervous system myelination.", "journal": "Nature neuroscience", "date": "2005", "authors": "Le N, Nagarajan R, Wang JY, Svaren J, LaPash C, Araki T, Schmidt RE, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "16136673", "url": "https://glygen.org/publication/PubMed/16136673" } ] }, { "title": "Interactions between collagen IX and biglycan measured by atomic force microscopy.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Chen CH, Yeh ML, Geyer M, Wang GJ, Huang MH, Heggeness MH, Hook M, Luo ZP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "16293224", "url": "https://glygen.org/publication/PubMed/16293224" } ] }, { "title": "Control of myelination in Schwann cells: a Krox20 cis-regulatory element integrates Oct6, Brn2 and Sox10 activities.", "journal": "EMBO reports", "date": "2006", "authors": "Ghislain J, Charnay P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "16311519", "url": "https://glygen.org/publication/PubMed/16311519" } ] }, { "title": "Functional organization of a Schwann cell enhancer.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2005", "authors": "Denarier E, Forghani R, Farhadi HF, Dib S, Dionne N, Friedman HC, Lepage P, Hudson TJ, Drouin R, Peterson A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "16319321", "url": "https://glygen.org/publication/PubMed/16319321" } ] }, { "title": "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.", "journal": "Journal of proteome research", "date": "2005", "authors": "Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942#ptm_processing" }, { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "reference": [ { "type": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "title": "Direct regulation of myelin protein zero expression by the Egr2 transactivator.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "LeBlanc SE, Jang SW, Ward RM, Wrabetz L, Svaren J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "16373334", "url": "https://glygen.org/publication/PubMed/16373334" } ] }, { "title": "Ligand-binding specificities of laminin-binding integrins: a comprehensive survey of laminin-integrin interactions using recombinant alpha3beta1, alpha6beta1, alpha7beta1 and alpha6beta4 integrins.", "journal": "Matrix biology : journal of the International Society for Matrix Biology", "date": "2006", "authors": "Nishiuchi R, Takagi J, Hayashi M, Ido H, Yagi Y, Sanzen N, Tsuji T, Yamada M, Sekiguchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "16413178", "url": "https://glygen.org/publication/PubMed/16413178" } ] }, { "title": "Involvement of tenascin-C and PG-M/versican in flexor tenosynovial pathology of idiopathic carpal tunnel syndrome.", "journal": "Histology and histopathology", "date": "2006", "authors": "Tsujii M, Hirata H, Yoshida T, Imanaka-Yoshida K, Morita A, Uchida A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "16493581", "url": "https://glygen.org/publication/PubMed/16493581" } ] }, { "title": "Matrix metalloproteinase degradation of elastin, type IV collagen and proteoglycan. A quantitative comparison of the activities of 95 kDa and 72 kDa gelatinases, stromelysins-1 and -2 and punctuated metalloproteinase (PUMP).", "journal": "The Biochemical journal", "date": "1991", "authors": "Murphy G, Cockett MI, Ward RV, Docherty AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "1649600", "url": "https://glygen.org/publication/PubMed/1649600" } ] }, { "title": "Multiple functions of the integrin alpha6beta4 in epidermal homeostasis and tumorigenesis.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Wilhelmsen K, Litjens SH, Sonnenberg A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "16581764", "url": "https://glygen.org/publication/PubMed/16581764" } ] }, { "title": "Alpha-V-dependent outside-in signaling is required for the regulation of CD44 surface expression, MMP-2 secretion, and cell migration by osteopontin in human melanoma cells.", "journal": "Experimental cell research", "date": "2006", "authors": "Samanna V, Wei H, Ego-Osuala D, Chellaiah MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "16631740", "url": "https://glygen.org/publication/PubMed/16631740" } ] }, { "title": "Direct interaction of focal adhesion kinase (FAK) with Met is required for FAK to promote hepatocyte growth factor-induced cell invasion.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Chen SY, Chen HC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874081", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081" } ], "reference": [ { "type": "PubMed", "id": "16782899", "url": "https://glygen.org/publication/PubMed/16782899" } ] }, { "title": "The discoidin domain receptor DDR2 is a receptor for type X collagen.", "journal": "Matrix biology : journal of the International Society for Matrix Biology", "date": "2006", "authors": "Leitinger B, Kwan AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000171" } ], "reference": [ { "type": "PubMed", "id": "16806867", "url": "https://glygen.org/publication/PubMed/16806867" } ] }, { "title": "Cathepsin s promotes human preadipocyte differentiation: possible involvement of fibronectin degradation.", "journal": "Endocrinology", "date": "2006", "authors": "Taleb S, Cancello R, Clement K, Lacasa D", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "16825321", "url": "https://glygen.org/publication/PubMed/16825321" } ] }, { "title": "In vivo detection of Egr2 binding to target genes during peripheral nerve myelination.", "journal": "Journal of neurochemistry", "date": "2006", "authors": "Jang SW, LeBlanc SE, Roopra A, Wrabetz L, Svaren J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "16923174", "url": "https://glygen.org/publication/PubMed/16923174" } ] }, { "title": "Sequence identity between the alpha 2-macroglobulin receptor and low density lipoprotein receptor-related protein suggests that this molecule is a multifunctional receptor.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Strickland DK, Ashcom JD, Williams S, Burgess WH, Migliorini M, Argraves WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "1698775", "url": "https://glygen.org/publication/PubMed/1698775" } ] }, { "title": "The effects of cAMP on differentiation of cultured Schwann cells: progression from an early phenotype (04+) to a myelin phenotype (P0+, GFAP-, N-CAM-, NGF-receptor-) depends on growth inhibition.", "journal": "The Journal of cell biology", "date": "1991", "authors": "Morgan L, Jessen KR, Mirsky R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "1704008", "url": "https://glygen.org/publication/PubMed/1704008" } ] }, { "title": "The role of insulin-like growth factor binding proteins.", "journal": "Neuroendocrinology", "date": "2006", "authors": "Holly J, Perks C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17047378", "url": "https://glygen.org/publication/PubMed/17047378" } ] }, { "title": "Hyaluronan and its binding proteins, the hyaladherins.", "journal": "Current opinion in cell biology", "date": "1990", "authors": "Toole BP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "1707285", "url": "https://glygen.org/publication/PubMed/1707285" } ] }, { "title": "Quantitative analysis of insulin-like growth factor-modulated proteolysis of insulin-like growth factor binding protein-4 and -5 by pregnancy-associated plasma protein-A.", "journal": "Biochemistry", "date": "2007", "authors": "Gyrup C, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17249697", "url": "https://glygen.org/publication/PubMed/17249697" } ] }, { "title": "Regulation of insulin-like growth factor (IGF) bioactivity by sequential proteolytic cleavage of IGF binding protein-4 and -5.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2007", "authors": "Laursen LS, Kjaer-Sorensen K, Andersen MH, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17312271", "url": "https://glygen.org/publication/PubMed/17312271" } ] }, { "title": "Neuropathy-associated Egr2 mutants disrupt cooperative activation of myelin protein zero by Egr2 and Sox10.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "LeBlanc SE, Ward RM, Svaren J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "17325040", "url": "https://glygen.org/publication/PubMed/17325040" } ] }, { "title": "Engagement of collagen-binding integrins promotes matrix metalloproteinase-9-dependent E-cadherin ectodomain shedding in ovarian carcinoma cells.", "journal": "Cancer research", "date": "2007", "authors": "Symowicz J, Adley BP, Gleason KJ, Johnson JJ, Ghosh S, Fishman DA, Hudson LG, Stack MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "17332331", "url": "https://glygen.org/publication/PubMed/17332331" } ] }, { "title": "Kallikrein 7 enhances pancreatic cancer cell invasion by shedding E-cadherin.", "journal": "Cancer", "date": "2007", "authors": "Johnson SK, Ramani VC, Hennings L, Haun RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "17354228", "url": "https://glygen.org/publication/PubMed/17354228" } ] }, { "title": "Structural basis for the autoinhibition of focal adhesion kinase.", "journal": "Cell", "date": "2007", "authors": "Lietha D, Cai X, Ceccarelli DF, Li Y, Schaller MD, Eck MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874081", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081" } ], "reference": [ { "type": "PubMed", "id": "17574028", "url": "https://glygen.org/publication/PubMed/17574028" } ] }, { "title": "Interaction of cartilage oligomeric matrix protein/thrombospondin 5 with aggrecan.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Chen FH, Herndon ME, Patel N, Hecht JT, Tuan RS, Lawler J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "17588949", "url": "https://glygen.org/publication/PubMed/17588949" } ] }, { "title": "The calpains: modular designs and functional diversity.", "journal": "Genome biology", "date": "2007", "authors": "Croall DE, Ersfeld K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "17608959", "url": "https://glygen.org/publication/PubMed/17608959" } ] }, { "title": "Hypomorphic Sox10 alleles reveal novel protein functions and unravel developmental differences in glial lineages.", "journal": "Development (Cambridge, England)", "date": "2007", "authors": "Schreiner S, Cossais F, Fischer K, Scholz S, Bosl MR, Holtmann B, Sendtner M, Wegner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "17699610", "url": "https://glygen.org/publication/PubMed/17699610" } ] }, { "title": "Misexpression of Pou3f1 results in peripheral nerve hypomyelination and axonal loss.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2007", "authors": "Ryu EJ, Wang JY, Le N, Baloh RH, Gustin JA, Schmidt RE, Milbrandt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "17959798", "url": "https://glygen.org/publication/PubMed/17959798" } ] }, { "title": "Cooperativity of the N- and C-terminal domains of insulin-like growth factor (IGF) binding protein 2 in IGF binding.", "journal": "Biochemistry", "date": "2007", "authors": "Kuang Z, Yao S, McNeil KA, Thompson JA, Bach LA, Forbes BE, Wallace JC, Norton RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17985932", "url": "https://glygen.org/publication/PubMed/17985932" } ] }, { "title": "The ectodomain shedding of E-cadherin by ADAM15 supports ErbB receptor activation.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Najy AJ, Day KC, Day ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "18434311", "url": "https://glygen.org/publication/PubMed/18434311" } ] }, { "title": "Interactions of Sox10 and Egr2 in myelin gene regulation.", "journal": "Neuron glia biology", "date": "2007", "authors": "Jones EA, Jang SW, Mager GM, Chang LW, Srinivasan R, Gokey NG, Ward RM, Nagarajan R, Svaren J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "18634568", "url": "https://glygen.org/publication/PubMed/18634568" } ] }, { "title": "Caspase-3 activation triggers extracellular cathepsin L release and endorepellin proteolysis.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Cailhier JF, Sirois I, Laplante P, Lepage S, Raymond MA, Brassard N, Prat A, Iozzo RV, Pshezhetsky AV, Hebert MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "18658137", "url": "https://glygen.org/publication/PubMed/18658137" } ] }, { "title": "Successive and selective release of phosphorylated peptides captured by hydroxy acid-modified metal oxide chromatography.", "journal": "Journal of proteome research", "date": "2008", "authors": "Kyono Y, Sugiyama N, Imami K, Tomita M, Ishihama Y", "evidence": [ { "database": "iPTMnet", "id": "P07942", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07942" } ], "reference": [ { "type": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" } ] }, { "title": "The molecular machinery of myelin gene transcription in Schwann cells.", "journal": "Glia", "date": "2008", "authors": "Svaren J, Meijer D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "18803322", "url": "https://glygen.org/publication/PubMed/18803322" } ] }, { "title": "Membrane-type 1 matrix metalloproteinase regulates macrophage-dependent elastolytic activity and aneurysm formation in vivo.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Xiong W, Knispel R, MacTaggart J, Greiner TC, Weiss SJ, Baxter BT", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "19010778", "url": "https://glygen.org/publication/PubMed/19010778" } ] }, { "title": "SREBPs: SREBP function in glia-neuron interactions.", "journal": "The FEBS journal", "date": "2009", "authors": "Camargo N, Smit AB, Verheijen MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "19143832", "url": "https://glygen.org/publication/PubMed/19143832" } ] }, { "title": "Myelin-associated glycoprotein and its axonal receptors.", "journal": "Journal of neuroscience research", "date": "2009", "authors": "Schnaar RL, Lopez PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "19156870", "url": "https://glygen.org/publication/PubMed/19156870" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942#ptm_processing" }, { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "A laminin-2, dystroglycan, utrophin axis is required for compartmentalization and elongation of myelin segments.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2009", "authors": "Court FA, Hewitt JE, Davies K, Patton BL, Uncini A, Wrabetz L, Feltri ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "19321787", "url": "https://glygen.org/publication/PubMed/19321787" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "P07942", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07942" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "Quantitative analysis of phosphopeptides in search of the disease biomarker from the hepatocellular carcinoma specimen.", "journal": "Proteomics", "date": "2009", "authors": "Lee HJ, Na K, Kwon MS, Kim H, Kim KS, Paik YK", "evidence": [ { "database": "iPTMnet", "id": "P07942", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07942" } ], "reference": [ { "type": "PubMed", "id": "19562805", "url": "https://glygen.org/publication/PubMed/19562805" } ] }, { "title": "MT1-MMP-mediated cleavage of decorin in corneal angiogenesis.", "journal": "Journal of vascular research", "date": "2009", "authors": "Mimura T, Han KY, Onguchi T, Chang JH, Kim TI, Kojima T, Zhou Z, Azar DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "19571574", "url": "https://glygen.org/publication/PubMed/19571574" } ] }, { "title": "Identification of a novel HtrA1-susceptible cleavage site in human aggrecan: evidence for the involvement of HtrA1 in aggrecan proteolysis in vivo.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Chamberland A, Wang E, Jones AR, Collins-Racie LA, LaVallie ER, Huang Y, Liu L, Morris EA, Flannery CR, Yang Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "19657146", "url": "https://glygen.org/publication/PubMed/19657146" } ] }, { "title": "ADAM-8 isolated from human osteoarthritic chondrocytes cleaves fibronectin at Ala(271).", "journal": "Arthritis and rheumatism", "date": "2009", "authors": "Zack MD, Malfait AM, Skepner AP, Yates MP, Griggs DW, Hall T, Hills RL, Alston JT, Nemirovskiy OV, Radabaugh MR, Leone JW, Arner EC, Tortorella MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "19714641", "url": "https://glygen.org/publication/PubMed/19714641" } ] }, { "title": "A G protein-coupled receptor is essential for Schwann cells to initiate myelination.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Monk KR, Naylor SG, Glenn TD, Mercurio S, Perlin JR, Dominguez C, Moens CB, Talbot WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "19745155", "url": "https://glygen.org/publication/PubMed/19745155" } ] }, { "title": "Structure of the human laminin B1 chain gene.", "journal": "J. Biol. Chem.", "date": "1990", "authors": "Vuolteenaho R, Chow L T, Tryggvason K", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "reference": [ { "type": "PubMed", "id": "1975589", "url": "https://glygen.org/publication/PubMed/1975589" } ] }, { "title": "Expression and activity of the POU transcription factor SCIP.", "journal": "Science (New York, N.Y.)", "date": "1990", "authors": "Monuki ES, Kuhn R, Weinmaster G, Trapp BD, Lemke G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "1975954", "url": "https://glygen.org/publication/PubMed/1975954" } ] }, { "title": "Activation of Krox20 gene expression by Sox10 in myelinating Schwann cells.", "journal": "Journal of neurochemistry", "date": "2010", "authors": "Reiprich S, Kriesch J, Schreiner S, Wegner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "19922439", "url": "https://glygen.org/publication/PubMed/19922439" } ] }, { "title": "Exploring the human leukocyte phosphoproteome using a microfluidic reversed-phase-TiO2-reversed-phase high-performance liquid chromatography phosphochip coupled to a quadrupole time-of-flight mass spectrometer.", "journal": "Analytical chemistry", "date": "2010", "authors": "Raijmakers R, Kraiczek K, de Jong AP, Mohammed S, Heck AJ", "evidence": [ { "database": "iPTMnet", "id": "P07942", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07942" } ], "reference": [ { "type": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P07942", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07942" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Matrix metalloproteinase-19 is highly expressed in astroglial tumors and promotes invasion of glioma cells.", "journal": "Journal of neuropathology and experimental neurology", "date": "2010", "authors": "Lettau I, Hattermann K, Held-Feindt J, Brauer R, Sedlacek R, Mentlein R", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "20142769", "url": "https://glygen.org/publication/PubMed/20142769" } ] }, { "title": "Structural basis of human CYP51 inhibition by antifungal azoles.", "journal": "Journal of molecular biology", "date": "2010", "authors": "Strushkevich N, Usanov SA, Park HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "20149798", "url": "https://glygen.org/publication/PubMed/20149798" } ] }, { "title": "Cholesterol and myelin biogenesis.", "journal": "Sub-cellular biochemistry", "date": "2010", "authors": "Saher G, Simons M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "20213556", "url": "https://glygen.org/publication/PubMed/20213556" } ] }, { "title": "Decorin interacts with fibrillar collagen of embryonic and adult human skin.", "journal": "Journal of structural biology", "date": "1991", "authors": "Fleischmajer R, Fisher LW, MacDonald ED, Jacobs L Jr, Perlish JS, Termine JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2059554", "url": "https://glygen.org/publication/PubMed/2059554" } ] }, { "title": "Biological role of dystroglycan in Schwann cell function and its implications in peripheral nervous system diseases.", "journal": "Journal of biomedicine & biotechnology", "date": "2010", "authors": "Masaki T, Matsumura K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "20625412", "url": "https://glygen.org/publication/PubMed/20625412" } ] }, { "title": "Phosphorylation of focal adhesion kinase on tyrosine 194 by Met leads to its activation through relief of autoinhibition.", "journal": "Oncogene", "date": "2011", "authors": "Chen TH, Chan PC, Chen CL, Chen HC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874081", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081" } ], "reference": [ { "type": "PubMed", "id": "20802513", "url": "https://glygen.org/publication/PubMed/20802513" } ] }, { "title": "Nrg1/ErbB signaling networks in Schwann cell development and myelination.", "journal": "Seminars in cell & developmental biology", "date": "2010", "authors": "Newbern J, Birchmeier C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "20832498", "url": "https://glygen.org/publication/PubMed/20832498" } ] }, { "title": "Expanding members and roles of the calpain superfamily and their genetically modified animals.", "journal": "Experimental animals", "date": "2010", "authors": "Sorimachi H, Hata S, Ono Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "21030783", "url": "https://glygen.org/publication/PubMed/21030783" } ] }, { "title": "Locus-wide identification of Egr2/Krox20 regulatory targets in myelin genes.", "journal": "Journal of neurochemistry", "date": "2010", "authors": "Jang SW, Srinivasan R, Jones EA, Sun G, Keles S, Krueger C, Chang LW, Nagarajan R, Svaren J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "21044070", "url": "https://glygen.org/publication/PubMed/21044070" } ] }, { "title": "Acyl-protein thioesterase 2 catalyzes the deacylation of peripheral membrane-associated GAP-43.", "journal": "PloS one", "date": "2010", "authors": "Tomatis VM, Trenchi A, Gomez GA, Daniotti JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-373760", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-373760" } ], "reference": [ { "type": "PubMed", "id": "21152083", "url": "https://glygen.org/publication/PubMed/21152083" } ] }, { "title": "Substrate-induced remodeling of the active site regulates human HTRA1 activity.", "journal": "Nature structural & molecular biology", "date": "2011", "authors": "Truebestein L, Tennstaedt A, Monig T, Krojer T, Canellas F, Kaiser M, Clausen T, Ehrmann M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "21297635", "url": "https://glygen.org/publication/PubMed/21297635" } ] }, { "title": "Activation and function of immediate-early genes in the nervous system.", "journal": "Biochemistry and cell biology = Biochimie et biologie cellulaire", "date": "2011", "authors": "Perez-Cadahia B, Drobic B, Davie JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "21326363", "url": "https://glygen.org/publication/PubMed/21326363" } ] }, { "title": "Regulation of the PMP22 gene through an intronic enhancer.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2011", "authors": "Jones EA, Lopez-Anido C, Srinivasan R, Krueger C, Chang LW, Nagarajan R, Svaren J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "21411665", "url": "https://glygen.org/publication/PubMed/21411665" } ] }, { "title": "HDAC1 and HDAC2 control the transcriptional program of myelination and the survival of Schwann cells.", "journal": "Nature neuroscience", "date": "2011", "authors": "Jacob C, Christen CN, Pereira JA, Somandin C, Baggiolini A, Lotscher P, Ozcelik M, Tricaud N, Meijer D, Yamaguchi T, Matthias P, Suter U", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "21423190", "url": "https://glygen.org/publication/PubMed/21423190" } ] }, { "title": "HDAC-mediated deacetylation of NF-kappaB is critical for Schwann cell myelination.", "journal": "Nature neuroscience", "date": "2011", "authors": "Chen Y, Wang H, Yoon SO, Xu X, Hottiger MO, Svaren J, Nave KA, Kim HA, Olson EN, Lu QR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "21423191", "url": "https://glygen.org/publication/PubMed/21423191" } ] }, { "title": "SCUBE3 is an endogenous TGF-beta receptor ligand and regulates the epithelial-mesenchymal transition in lung cancer.", "journal": "Oncogene", "date": "2011", "authors": "Wu YY, Peck K, Chang YL, Pan SH, Cheng YF, Lin JC, Yang RB, Hong TM, Yang PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "21441952", "url": "https://glygen.org/publication/PubMed/21441952" } ] }, { "title": "Gpr126 is essential for peripheral nerve development and myelination in mammals.", "journal": "Development (Cambridge, England)", "date": "2011", "authors": "Monk KR, Oshima K, Jors S, Heller S, Talbot WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "21613327", "url": "https://glygen.org/publication/PubMed/21613327" } ] }, { "title": "Dentin matrix protein 1 (DMP1) signals via cell surface integrin.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Wu H, Teng PN, Jayaraman T, Onishi S, Li J, Bannon L, Huang H, Close J, Sfeir C", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "21642437", "url": "https://glygen.org/publication/PubMed/21642437" } ] }, { "title": "Functional dissection of the Oct6 Schwann cell enhancer reveals an essential role for dimeric Sox10 binding.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2011", "authors": "Jagalur NB, Ghazvini M, Mandemakers W, Driegen S, Maas A, Jones EA, Jaegle M, Grosveld F, Svaren J, Meijer D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "21653862", "url": "https://glygen.org/publication/PubMed/21653862" } ] }, { "title": "Calpain chronicle--an enzyme family under multidisciplinary characterization.", "journal": "Proceedings of the Japan Academy. Series B, Physical and biological sciences", "date": "2011", "authors": "Sorimachi H, Hata S, Ono Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "21670566", "url": "https://glygen.org/publication/PubMed/21670566" } ] }, { "title": "Classical and neonatal Marfan syndrome mutations in fibrillin-1 cause differential protease susceptibilities and protein function.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Kirschner R, Hubmacher D, Iyengar G, Kaur J, Fagotto-Kaufmann C, Bromme D, Bartels R, Reinhardt DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "21784848", "url": "https://glygen.org/publication/PubMed/21784848" } ] }, { "title": "Collagen I and III and their decorin modified surfaces studied by atomic force microscopy and the elucidation of their affinity toward positive apolipoprotein B-100 residue by quartz crystal microbalance.", "journal": "The Analyst", "date": "2011", "authors": "Witos J, Saint-Guirons J, Meinander K, D'Ulivo L, Riekkola ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "21789315", "url": "https://glygen.org/publication/PubMed/21789315" } ] }, { "title": "Calpains: an elaborate proteolytic system.", "journal": "Biochimica et biophysica acta", "date": "2012", "authors": "Ono Y, Sorimachi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "21864727", "url": "https://glygen.org/publication/PubMed/21864727" } ] }, { "title": "Early growth response 1--a transcription factor in the crossfire of signal transduction cascades.", "journal": "Indian journal of biochemistry & biophysics", "date": "2011", "authors": "Pagel JI, Deindl E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "22053691", "url": "https://glygen.org/publication/PubMed/22053691" } ] }, { "title": "Dentin phosphoprotein (DPP) activates integrin-mediated anchorage-dependent signals in undifferentiated mesenchymal cells.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Eapen A, Ramachandran A, George A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "22134916", "url": "https://glygen.org/publication/PubMed/22134916" } ] }, { "title": "MT1-MMP regulates the turnover and endocytosis of extracellular matrix fibronectin.", "journal": "Journal of cell science", "date": "2011", "authors": "Shi F, Sottile J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "22159414", "url": "https://glygen.org/publication/PubMed/22159414" } ] }, { "title": "Distal enhancers upstream of the Charcot-Marie-Tooth type 1A disease gene PMP22.", "journal": "Human molecular genetics", "date": "2012", "authors": "Jones EA, Brewer MH, Srinivasan R, Krueger C, Sun G, Charney KN, Keles S, Antonellis A, Svaren J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "22180461", "url": "https://glygen.org/publication/PubMed/22180461" } ] }, { "title": "A novel evolutionarily conserved domain of cell-adhesion GPCRs mediates autoproteolysis.", "journal": "The EMBO journal", "date": "2012", "authors": "Arac D, Boucard AA, Bolliger MF, Nguyen J, Soltis SM, Sudhof TC, Brunger AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "22333914", "url": "https://glygen.org/publication/PubMed/22333914" } ] }, { "title": "Genome-wide analysis of EGR2/SOX10 binding in myelinating peripheral nerve.", "journal": "Nucleic acids research", "date": "2012", "authors": "Srinivasan R, Sun G, Keles S, Jones EA, Jang SW, Krueger C, Moran JJ, Svaren J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "22492709", "url": "https://glygen.org/publication/PubMed/22492709" } ] }, { "title": "The epidermal basement membrane is a composite of separate laminin- or collagen IV-containing networks connected by aggregated perlecan, but not by nidogens.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Behrens DT, Villone D, Koch M, Brunner G, Sorokin L, Robenek H, Bruckner-Tuderman L, Bruckner P, Hansen U", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "22493504", "url": "https://glygen.org/publication/PubMed/22493504" } ] }, { "title": "Drp2 and periaxin form Cajal bands with dystroglycan but have distinct roles in Schwann cell growth.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2012", "authors": "Sherman DL, Wu LM, Grove M, Gillespie CS, Brophy PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "22764250", "url": "https://glygen.org/publication/PubMed/22764250" } ] }, { "title": "Chromatin-remodeling factor Brg1 is required for Schwann cell differentiation and myelination.", "journal": "Developmental cell", "date": "2012", "authors": "Weider M, Kuspert M, Bischof M, Vogl MR, Hornig J, Loy K, Kosian T, Muller J, Hillgartner S, Tamm ER, Metzger D, Wegner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "22814607", "url": "https://glygen.org/publication/PubMed/22814607" } ] }, { "title": "Structure-function relationships in calpains.", "journal": "The Biochemical journal", "date": "2012", "authors": "Campbell RL, Davies PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "23035980", "url": "https://glygen.org/publication/PubMed/23035980" } ] }, { "title": "Mutations in LAMB1 cause cobblestone brain malformation without muscular or ocular abnormalities.", "journal": "American journal of human genetics", "date": "2013", "authors": "Radmanesh F, Caglayan AO, Silhavy JL, Yilmaz C, Cantagrel V, Omar T, Rosti B, Kaymakcalan H, Gabriel S, Li M, Sestan N, Bilguvar K, Dobyns WB, Zaki MS, Gunel M, Gleeson JG", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "reference": [ { "type": "PubMed", "id": "23472759", "url": "https://glygen.org/publication/PubMed/23472759" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology.", "journal": "The EMBO journal", "date": "2013", "authors": "Steentoft C, Vakhrushev SY, Joshi HJ, Kong Y, Vester-Christensen MB, Schjoldager KT, Lavrsen K, Dabelsteen S, Pedersen NB, Marcos-Silva L, Gupta R, Bennett EP, Mandel U, Brunak S, Wandall HH, Levery SB, Clausen H", "evidence": [ { "database": "UniCarbKB", "id": "P07942", "url": "" } ], "reference": [ { "type": "PubMed", "id": "23584533", "url": "https://glygen.org/publication/PubMed/23584533" } ] }, { "title": "Immunoelectron microscopy of osteonectin and type I collagen in osteoblasts and bone matrix.", "journal": "Calcified tissue international", "date": "1990", "authors": "Romanowski R, Jundt G, Termine JD, von der Mark K, Schulz A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2364322", "url": "https://glygen.org/publication/PubMed/2364322" } ] }, { "title": "Sticky signaling--adhesion class G protein-coupled receptors take the stage.", "journal": "Science signaling", "date": "2013", "authors": "Langenhan T, Aust G, Hamann J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "23695165", "url": "https://glygen.org/publication/PubMed/23695165" } ] }, { "title": "Octamer-binding transcription factors: genomics and functions.", "journal": "Frontiers in bioscience (Landmark edition)", "date": "2013", "authors": "Zhao FQ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "23747866", "url": "https://glygen.org/publication/PubMed/23747866" } ] }, { "title": "Characterization of opticin digestion by proteases involved in osteoarthritis development.", "journal": "Joint, bone, spine : revue du rhumatisme", "date": "2014", "authors": "Tio L, Martel-Pelletier J, Pelletier JP, Bishop PN, Roughley P, Farran A, Benito P, Monfort J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "23845380", "url": "https://glygen.org/publication/PubMed/23845380" } ] }, { "title": "SWI/SNF enzymes promote SOX10- mediated activation of myelin gene expression.", "journal": "PloS one", "date": "2013", "authors": "Marathe HG, Mehta G, Zhang X, Datar I, Mehrotra A, Yeung KC, de la Serna IL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "23874858", "url": "https://glygen.org/publication/PubMed/23874858" } ] }, { "title": "A 125/115-kDa cell surface receptor specific for vitronectin interacts with the arginine-glycine-aspartic acid adhesion sequence derived from fibronectin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1985", "authors": "Pytela R, Pierschbacher MD, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2412224", "url": "https://glygen.org/publication/PubMed/2412224" } ] }, { "title": "Very large G protein-coupled receptor 1 regulates myelin-associated glycoprotein via Galphas/Galphaq-mediated protein kinases A/C.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Shin D, Lin ST, Fu YH, Ptacek LJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "24191038", "url": "https://glygen.org/publication/PubMed/24191038" } ] }, { "title": "Platelet membrane glycoprotein IIb/IIIa: member of a family of Arg-Gly-Asp--specific adhesion receptors.", "journal": "Science (New York, N.Y.)", "date": "1986", "authors": "Pytela R, Pierschbacher MD, Ginsberg MH, Plow EF, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2420006", "url": "https://glygen.org/publication/PubMed/2420006" } ] }, { "title": "Gpr126 functions in Schwann cells to control differentiation and myelination via G-protein activation.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2013", "authors": "Mogha A, Benesh AE, Patra C, Engel FB, Schoneberg T, Liebscher I, Monk KR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "24227709", "url": "https://glygen.org/publication/PubMed/24227709" } ] }, { "title": "Interaction of vitronectin with collagen.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Gebb C, Hayman EG, Engvall E, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2430969", "url": "https://glygen.org/publication/PubMed/2430969" } ] }, { "title": "FAK dimerization controls its kinase-dependent functions at focal adhesions.", "journal": "The EMBO journal", "date": "2014", "authors": "Brami-Cherrier K, Gervasi N, Arsenieva D, Walkiewicz K, Boutterin MC, Ortega A, Leonard PG, Seantier B, Gasmi L, Bouceba T, Kadare G, Girault JA, Arold ST", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874081", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081" } ], "reference": [ { "type": "PubMed", "id": "24480479", "url": "https://glygen.org/publication/PubMed/24480479" } ] }, { "title": "PMP22 related neuropathies: Charcot-Marie-Tooth disease type 1A and Hereditary Neuropathy with liability to Pressure Palsies.", "journal": "Orphanet journal of rare diseases", "date": "2014", "authors": "van Paassen BW, van der Kooi AJ, van Spaendonck-Zwarts KY, Verhamme C, Baas F, de Visser M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "24646194", "url": "https://glygen.org/publication/PubMed/24646194" } ] }, { "title": "Periaxin and AHNAK nucleoprotein 2 form intertwined homodimers through domain swapping.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Han H, Kursula P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "24675079", "url": "https://glygen.org/publication/PubMed/24675079" } ] }, { "title": "Structure of the Mr 140,000 growth hormone-dependent insulin-like growth factor binding protein complex: determination by reconstitution and affinity-labeling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Baxter RC, Martin JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "2476804", "url": "https://glygen.org/publication/PubMed/2476804" } ] }, { "title": "Cloning, sequence analysis and expression of a cDNA encoding a novel insulin-like growth factor binding protein (IGFBP-2).", "journal": "The EMBO journal", "date": "1989", "authors": "Binkert C, Landwehr J, Mary JL, Schwander J, Heinrich G", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "2479552", "url": "https://glygen.org/publication/PubMed/2479552" } ] }, { "title": "Probing the O-glycoproteome of gastric cancer cell lines for biomarker discovery.", "journal": "Molecular & cellular proteomics : MCP", "date": "2015", "authors": "Campos D, Freitas D, Gomes J, Magalhaes A, Steentoft C, Gomes C, Vester-Christensen MB, Ferreira JA, Afonso LP, Santos LL, Pinto de Sousa J, Mandel U, Clausen H, Vakhrushev SY, Reis CA", "evidence": [ { "database": "UniCarbKB", "id": "P07942", "url": "" } ], "reference": [ { "type": "PubMed", "id": "25813380", "url": "https://glygen.org/publication/PubMed/25813380" } ] }, { "title": "Differential Sox10 genomic occupancy in myelinating glia.", "journal": "Glia", "date": "2015", "authors": "Lopez-Anido C, Sun G, Koenning M, Srinivasan R, Hung HA, Emery B, Keles S, Svaren J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "25974668", "url": "https://glygen.org/publication/PubMed/25974668" } ] }, { "title": "A Single Kinase Generates the Majority of the Secreted Phosphoproteome.", "journal": "Cell", "date": "2015", "authors": "Tagliabracci VS, Wiley SE, Guo X, Kinch LN, Durrant E, Wen J, Xiao J, Cui J, Nguyen KB, Engel JL, Coon JJ, Grishin N, Pinna LA, Pagliarini DJ, Dixon JE", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" }, { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" }, { "database": "iPTMnet", "id": "P07942", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07942" } ], "reference": [ { "type": "PubMed", "id": "26091039", "url": "https://glygen.org/publication/PubMed/26091039" } ] }, { "title": "Schwann cells and their transcriptional network: Evolution of key regulators of peripheral myelination.", "journal": "Brain research", "date": "2016", "authors": "Stolt CC, Wegner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "26423937", "url": "https://glygen.org/publication/PubMed/26423937" } ] }, { "title": "MAG, myelin and overcoming growth inhibition in the CNS.", "journal": "Frontiers in molecular neuroscience", "date": "2015", "authors": "McKerracher L, Rosen KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "26441514", "url": "https://glygen.org/publication/PubMed/26441514" } ] }, { "title": "Gene regulation in the immediate-early response process.", "journal": "Advances in biological regulation", "date": "2016", "authors": "Bahrami S, Drablos F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "27220739", "url": "https://glygen.org/publication/PubMed/27220739" } ] }, { "title": "Tead1 regulates the expression of Peripheral Myelin Protein 22 during Schwann cell development.", "journal": "Human molecular genetics", "date": "2016", "authors": "Lopez-Anido C, Poitelon Y, Gopinath C, Moran JJ, Ma KH, Law WD, Antonellis A, Feltri ML, Svaren J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "27288457", "url": "https://glygen.org/publication/PubMed/27288457" } ] }, { "title": "Adhesion G-protein coupled receptors and extracellular matrix proteins: Roles in myelination and glial cell development.", "journal": "Developmental dynamics : an official publication of the American Association of Anatomists", "date": "2017", "authors": "Mehta P, Piao X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "27859941", "url": "https://glygen.org/publication/PubMed/27859941" } ] }, { "title": "Schwann cell development, maturation and regeneration: a focus on classic and emerging intracellular signaling pathways.", "journal": "Neural regeneration research", "date": "2017", "authors": "Castelnovo LF, Bonalume V, Melfi S, Ballabio M, Colleoni D, Magnaghi V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "28852375", "url": "https://glygen.org/publication/PubMed/28852375" } ] }, { "title": "Large-scale intact glycopeptide identification by Mascot database search.", "journal": "Scientific reports", "date": "2018", "authors": "Bollineni RC, Koehler CJ, Gislefoss RE, Anonsen JH, Thiede B", "evidence": [ { "database": "GlyConnect", "id": "1442", "url": "https://glyconnect.expasy.org/browser/proteins/1442" } ], "reference": [ { "type": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P07942", "url": "" }, { "database": "GlyConnect", "id": "1442", "url": "https://glyconnect.expasy.org/browser/proteins/1442" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Maf links Neuregulin1 signaling to cholesterol synthesis in myelinating Schwann cells.", "journal": "Genes & development", "date": "2018", "authors": "Kim M, Wende H, Walcher J, Kuhnemund J, Cheret C, Kempa S, McShane E, Selbach M, Lewin GR, Birchmeier C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "29748249", "url": "https://glygen.org/publication/PubMed/29748249" } ] }, { "title": "Quantitative Profiling of Protein O-GlcNAcylation Sites by an Isotope-Tagged Cleavable Linker.", "journal": "ACS chemical biology", "date": "2018", "authors": "Qin K, Zhu Y, Qin W, Gao J, Shao X, Wang YL, Zhou W, Wang C, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07942", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07942" }, { "database": "O-GlcNAc Atlas", "id": "P07942", "url": "https://oglcnac.org/atlas/detail/P07942" } ], "reference": [ { "type": "PubMed", "id": "30059200", "url": "https://glygen.org/publication/PubMed/30059200" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07942", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07942" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "End-Truncated LAMB1 Causes a Hippocampal Memory Defect and a Leukoencephalopathy.", "journal": "Annals of neurology", "date": "2021", "authors": "Aloui C, Herve D, Marenne G, Savenier F, Le Guennec K, Bergametti F, Verdura E, Ludwig TE, Lebenberg J, Jabeur W, Morel H, Coste T, Demarquay G, Bachoumas P, Cogez J, Mathey G, Bernard E, Chabriat H, Genin E, Tournier-Lasserve E", "evidence": [ { "database": "RefSeq", "id": "NP_002282", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002282" } ], "reference": [ { "type": "PubMed", "id": "34606115", "url": "https://glygen.org/publication/PubMed/34606115" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07942", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07942" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "Spatiotemporal Activation of Protein O-GlcNAcylation in Living Cells.", "journal": "Journal of the American Chemical Society", "date": "2022", "authors": "He J, Fan Z, Tian Y, Yang W, Zhou Y, Zhu Q, Zhang W, Qin W, Yi W", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07942", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07942" } ], "reference": [ { "type": "PubMed", "id": "35138101", "url": "https://glygen.org/publication/PubMed/35138101" } ] }, { "title": "Lamin B1 is a potential therapeutic target and prognostic biomarker for hepatocellular carcinoma.", "journal": "Bioengineered", "date": "2022", "authors": "Yang Y, Gao L, Chen J, Xiao W, Liu R, Kan H", "evidence": [ { "database": "RefSeq", "id": "NP_002282", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002282" } ], "reference": [ { "type": "PubMed", "id": "35436411", "url": "https://glygen.org/publication/PubMed/35436411" } ] }, { "title": "Evaluation of JUN, FN1 and LAMB1 polymorphisms in pterygium in a Chinese Han population.", "journal": "Ophthalmic genetics", "date": "2022", "authors": "Wu X, Dong S, Xu Y, Zhu G, Yan M", "evidence": [ { "database": "RefSeq", "id": "NP_002282", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002282" } ], "reference": [ { "type": "PubMed", "id": "35445627", "url": "https://glygen.org/publication/PubMed/35445627" } ] }, { "title": "RNA Helicase DDX24 Stabilizes LAMB1 to Promote Hepatocellular Carcinoma Progression.", "journal": "Cancer research", "date": "2022", "authors": "Liu T, Gan H, He S, Deng J, Hu X, Li L, Cai L, He J, Long H, Cai J, Li H, Zhang Q, Wang L, Chen F, Chen Y, Zhang H, Li J, Yang L, Liu Y, Yang JH, Kuang DM, Pang P, He H, Shan H", "evidence": [ { "database": "RefSeq", "id": "NP_002282", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002282" } ], "reference": [ { "type": "PubMed", "id": "35763670", "url": "https://glygen.org/publication/PubMed/35763670" } ] }, { "title": "Compound variants of FKTN, POMGNT1, and LAMB1 gene identified by prenatal whole-exome sequencing in three fetuses with congenital hydrocephalus.", "journal": "The journal of obstetrics and gynaecology research", "date": "2022-10", "authors": "Li Meng, Fu Huayu, Li Jiao, Meng Dahua, Zhang Qiang, Fei Dongmei", "evidence": [ { "database": "RefSeq", "id": "NP_002282", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002282" } ], "reference": [ { "type": "PubMed", "id": "35843586", "url": "https://glygen.org/publication/PubMed/35843586" } ] }, { "title": "Human laminin B1 chain. A multidomain protein with gene (LAMB1) locus in the q22 region of chromosome 7.", "journal": "J. Biol. Chem.", "date": "1987", "authors": "Pikkarainen T, Eddy R, Fukushima Y, Byers M, Shows T, Pihlajaniemi T, Saraste M, Tryggvason K", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "reference": [ { "type": "PubMed", "id": "3611077", "url": "https://glygen.org/publication/PubMed/3611077" } ] }, { "title": "Isolation of a cDNA clone for the human laminin-B1 chain and its gene localization.", "journal": "Am. J. Hum. Genet.", "date": "1987", "authors": "Jaye M, Modi W S, Ricca G A, Mudd R, Chiu I M, O'Brien S J, Drohan W N", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "reference": [ { "type": "PubMed", "id": "3661559", "url": "https://glygen.org/publication/PubMed/3661559" } ] }, { "title": "Binding of laminin to type IV collagen: a morphological study.", "journal": "The Journal of cell biology", "date": "1985", "authors": "Charonis AS, Tsilibary EC, Yurchenco PD, Furthmayr H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "3997977", "url": "https://glygen.org/publication/PubMed/3997977" } ] }, { "title": "Cartilage proteoglycan binding region and link protein. Radioimmunoassays and the detection of masked determinants in aggregates.", "journal": "The Biochemical journal", "date": "1983", "authors": "Ratcliffe A, Hardingham T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "6193777", "url": "https://glygen.org/publication/PubMed/6193777" } ] }, { "title": "Specific inhibition of type I and type II collagen fibrillogenesis by the small proteoglycan of tendon.", "journal": "The Biochemical journal", "date": "1984", "authors": "Vogel KG, Paulsson M, Heinegard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "6439184", "url": "https://glygen.org/publication/PubMed/6439184" } ] }, { "title": "Characterization of the binding domains in the fragments cleaved by cathepsin G from human plasma fibronectin.", "journal": "European journal of biochemistry", "date": "1982", "authors": "Vartio T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "7075587", "url": "https://glygen.org/publication/PubMed/7075587" } ] }, { "title": "Binding of tenascin-C to soluble fibronectin and matrix fibrils.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Chung CY, Zardi L, Erickson HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7499434", "url": "https://glygen.org/publication/PubMed/7499434" } ] }, { "title": "Autophosphorylation of the focal adhesion kinase, pp125FAK, directs SH2-dependent binding of pp60src.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Schaller MD, Hildebrand JD, Shannon JD, Fox JW, Vines RR, Parsons JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874081", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081" } ], "reference": [ { "type": "PubMed", "id": "7509446", "url": "https://glygen.org/publication/PubMed/7509446" } ] }, { "title": "Heparin, heparan sulfate, and dermatan sulfate regulate formation of the insulin-like growth factor-I and insulin-like growth factor-binding protein complexes.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Arai T, Parker A, Busby W Jr, Clemmons DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7519608", "url": "https://glygen.org/publication/PubMed/7519608" } ] }, { "title": "Matrix metalloproteinases degrade insulin-like growth factor-binding protein-3 in dermal fibroblast cultures.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Fowlkes JL, Enghild JJ, Suzuki K, Nagase H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7523391", "url": "https://glygen.org/publication/PubMed/7523391" } ] }, { "title": "Recombinant human insulin-like growth factor (IGF)-binding protein-6 inhibits IGF-II-induced differentiation of L6A1 myoblasts.", "journal": "Endocrinology", "date": "1994", "authors": "Bach LA, Hsieh S, Brown AL, Rechler MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7525263", "url": "https://glygen.org/publication/PubMed/7525263" } ] }, { "title": "Identification of insulin-like growth factor-binding protein-3 (IGFBP-3) fragments and IGFBP-5 proteolytic activity in human seminal plasma: a comparison of normal and vasectomized patients.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1994", "authors": "Lee KO, Oh Y, Giudice LC, Cohen P, Peehl DM, Rosenfeld RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7525634", "url": "https://glygen.org/publication/PubMed/7525634" } ] }, { "title": "Biological effects of prostate specific antigen as an insulin-like growth factor binding protein-3 protease.", "journal": "The Journal of endocrinology", "date": "1994", "authors": "Cohen P, Peehl DM, Graves HC, Rosenfeld RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7525824", "url": "https://glygen.org/publication/PubMed/7525824" } ] }, { "title": "Tenascin-R (J1 160/180 inhibits fibronectin-mediated cell adhesion--functional relatedness to tenascin-C.", "journal": "Journal of cell science", "date": "1994", "authors": "Pesheva P, Probstmeier R, Skubitz AP, McCarthy JB, Furcht LT, Schachner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7527058", "url": "https://glygen.org/publication/PubMed/7527058" } ] }, { "title": "Interactions between insulin-like growth factor-I (IGF-I) and the system of plasminogen activators and their inhibitors in the control of IGF-binding protein-3 production and proteolysis in human osteosarcoma cells.", "journal": "Endocrinology", "date": "1994", "authors": "Lalou C, Silve C, Rosato R, Segovia B, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7527330", "url": "https://glygen.org/publication/PubMed/7527330" } ] }, { "title": "Biochemical analysis of prostate specific antigen-proteolyzed insulin-like growth factor binding protein-3.", "journal": "Growth regulation", "date": "1994", "authors": "Fielder PJ, Rosenfeld RG, Graves HC, Grandbois K, Maack CA, Sawamura S, Ogawa Y, Sommer A, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7538844", "url": "https://glygen.org/publication/PubMed/7538844" } ] }, { "title": "Alpha v beta 1 is a receptor for vitronectin and fibrinogen, and acts with alpha 5 beta 1 to mediate spreading on fibronectin.", "journal": "Journal of cell science", "date": "1995", "authors": "Marshall JF, Rutherford DC, McCartney AC, Mitjans F, Goodman SL, Hart IR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7542669", "url": "https://glygen.org/publication/PubMed/7542669" } ] }, { "title": "Serum levels of insulin-like growth factor (IGF)-binding protein-3 (IGFBP-3) in healthy infants, children, and adolescents: the relation to IGF-I, IGF-II, IGFBP-1, IGFBP-2, age, sex, body mass index, and pubertal maturation.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1995", "authors": "Juul A, Dalgaard P, Blum WF, Bang P, Hall K, Michaelsen KF, Muller J, Skakkebaek NE", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7543116", "url": "https://glygen.org/publication/PubMed/7543116" } ] }, { "title": "Release of biological activities from quiescent fibronectin by a conformational change and limited proteolysis by matrix metalloproteinases.", "journal": "Biochemistry", "date": "1995", "authors": "Fukai F, Ohtaki M, Fujii N, Yajima H, Ishii T, Nishizawa Y, Miyazaki K, Katayama T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "7547873", "url": "https://glygen.org/publication/PubMed/7547873" } ] }, { "title": "The human integrin alpha 8 beta 1 functions as a receptor for tenascin, fibronectin, and vitronectin.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Schnapp LM, Hatch N, Ramos DM, Klimanskaya IV, Sheppard D, Pytela R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7559467", "url": "https://glygen.org/publication/PubMed/7559467" } ] }, { "title": "Autocrine regulation of cell proliferation by the insulin-like growth factor (IGF) and IGF binding protein-3 protease system in a human prostate carcinoma cell line (PC-3).", "journal": "Endocrinology", "date": "1995", "authors": "Angelloz-Nicoud P, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7588299", "url": "https://glygen.org/publication/PubMed/7588299" } ] }, { "title": "Binding of mutants of human insulin-like growth factor II to insulin-like growth factor binding proteins 1-6.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Bach LA, Hsieh S, Sakano K, Fujiwara H, Perdue JF, Rechler MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7683646", "url": "https://glygen.org/publication/PubMed/7683646" } ] }, { "title": "The alpha v beta 5 integrin receptor regulates receptor-mediated endocytosis of vitronectin.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Panetti TS, McKeown-Longo PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7685013", "url": "https://glygen.org/publication/PubMed/7685013" } ] }, { "title": "Glucose does not influence the insulin-like growth factor (JGF) binding to carrier proteins (IGFBPs): analysis of rat and human serum by western ligand blotting.", "journal": "Experientia", "date": "1993", "authors": "Cianfarani S, Frost VJ, Savage MO, Holly JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7689487", "url": "https://glygen.org/publication/PubMed/7689487" } ] }, { "title": "Endothelial cell attachment and spreading on human tenascin is mediated by alpha 2 beta 1 and alpha v beta 3 integrins.", "journal": "Journal of cell science", "date": "1993", "authors": "Sriramarao P, Mendler M, Bourdon MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7693733", "url": "https://glygen.org/publication/PubMed/7693733" } ] }, { "title": "Interaction of biglycan with type I collagen.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Schonherr E, Witsch-Prehm P, Harrach B, Robenek H, Rauterberg J, Kresse H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7852349", "url": "https://glygen.org/publication/PubMed/7852349" } ] }, { "title": "Dystroglycan is a binding protein of laminin and merosin in peripheral nerve.", "journal": "FEBS letters", "date": "1994", "authors": "Yamada H, Shimizu T, Tanaka T, Campbell KP, Matsumura K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "7925941", "url": "https://glygen.org/publication/PubMed/7925941" } ] }, { "title": "Krox-20 controls myelination in the peripheral nervous system.", "journal": "Nature", "date": "1994", "authors": "Topilko P, Schneider-Maunoury S, Levi G, Baron-Van Evercooren A, Chennoufi AB, Seitanidou T, Babinet C, Charnay P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "7935840", "url": "https://glygen.org/publication/PubMed/7935840" } ] }, { "title": "The expression of functional link protein in a baculovirus system: analysis of mutants lacking the A, B and B' domains.", "journal": "The Biochemical journal", "date": "1994", "authors": "Grover J, Roughley PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8002934", "url": "https://glygen.org/publication/PubMed/8002934" } ] }, { "title": "Direct interaction of v-Src with the focal adhesion kinase mediated by the Src SH2 domain.", "journal": "Molecular biology of the cell", "date": "1994", "authors": "Xing Z, Chen HC, Nowlen JK, Taylor SJ, Shalloway D, Guan JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874081", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081" } ], "reference": [ { "type": "PubMed", "id": "8054685", "url": "https://glygen.org/publication/PubMed/8054685" } ] }, { "title": "Sources of cholesterol for kidney and nerve during development.", "journal": "Journal of lipid research", "date": "1994", "authors": "Jurevics HA, Morell P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "8138712", "url": "https://glygen.org/publication/PubMed/8138712" } ] }, { "title": "Cloning and characterization of a unique elastolytic metalloproteinase produced by human alveolar macrophages.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Shapiro SD, Kobayashi DK, Ley TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "8226919", "url": "https://glygen.org/publication/PubMed/8226919" } ] }, { "title": "A role for the dystrophin-glycoprotein complex as a transmembrane linker between laminin and actin.", "journal": "The Journal of cell biology", "date": "1993", "authors": "Ervasti JM, Campbell KP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "8349731", "url": "https://glygen.org/publication/PubMed/8349731" } ] }, { "title": "Interaction of heparin cofactor II with biglycan and decorin.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Whinna HC, Choi HU, Rosenberg LC, Church FC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8440685", "url": "https://glygen.org/publication/PubMed/8440685" } ] }, { "title": "The ubiquitously expressed human CYP51 encodes lanosterol 14 alpha-demethylase, a cytochrome P450 whose expression is regulated by oxysterols.", "journal": "Archives of biochemistry and biophysics", "date": "1996", "authors": "Stromstedt M, Rozman D, Waterman MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "8619637", "url": "https://glygen.org/publication/PubMed/8619637" } ] }, { "title": "The degradation of human endothelial cell-derived perlecan and release of bound basic fibroblast growth factor by stromelysin, collagenase, plasmin, and heparanases.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Whitelock JM, Murdoch AD, Iozzo RV, Underwood PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "8626565", "url": "https://glygen.org/publication/PubMed/8626565" } ] }, { "title": "Characterization of dp6troglycan-laminin interaction in peripheral nerve.", "journal": "Journal of neurochemistry", "date": "1996", "authors": "Yamada H, Chiba A, Endo T, Kobata A, Anderson LV, Hori H, Fukuta-Ohi H, Kanazawa I, Campbell KP, Shimizu T, Matsumura K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "8627307", "url": "https://glygen.org/publication/PubMed/8627307" } ] }, { "title": "A direct role for sterol regulatory element binding protein in activation of 3-hydroxy-3-methylglutaryl coenzyme A reductase gene.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Vallett SM, Sanchez HB, Rosenfeld JM, Osborne TF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "8647822", "url": "https://glygen.org/publication/PubMed/8647822" } ] }, { "title": "The POU factor Oct-6 and Schwann cell differentiation.", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Jaegle M, Mandemakers W, Broos L, Zwart R, Karis A, Visser P, Grosveld F, Meijer D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "8662541", "url": "https://glygen.org/publication/PubMed/8662541" } ] }, { "title": "Measurement of insulin-like growth factor (IGF)-II binding to purified IGF binding proteins 1-6: comparison of charcoal adsorption and high performance size exclusion chromatography.", "journal": "Biochimica et biophysica acta", "date": "1996", "authors": "Bach LA, Rechler MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8781553", "url": "https://glygen.org/publication/PubMed/8781553" } ] }, { "title": "Differential effects of the integrins alpha9beta1, alphavbeta3, and alphavbeta6 on cell proliferative responses to tenascin. Roles of the beta subunit extracellular and cytoplasmic domains.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Yokosaki Y, Monis H, Chen J, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8798654", "url": "https://glygen.org/publication/PubMed/8798654" } ] }, { "title": "Insulin-like growth factor binding protein (IGFBP) proteases: functional regulators of cell growth.", "journal": "Progress in growth factor research", "date": "1995", "authors": "Rajah R, Katz L, Nunn S, Solberg P, Beers T, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8817670", "url": "https://glygen.org/publication/PubMed/8817670" } ] }, { "title": "The human connexin32 gene is transcribed from two tissue-specific promoters.", "journal": "Bioscience reports", "date": "1996", "authors": "Neuhaus IM, Bone L, Wang S, Ionasescu V, Werner R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "8842374", "url": "https://glygen.org/publication/PubMed/8842374" } ] }, { "title": "Recombinant human insulin-like growth factor (IGF) binding protein-3 stimulates prostate carcinoma cell proliferation via an IGF-dependent mechanism. Role of serine proteases.", "journal": "Growth regulation", "date": "1996", "authors": "Angelloz-Nicoud P, Harel L, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8894645", "url": "https://glygen.org/publication/PubMed/8894645" } ] }, { "title": "Interaction of cartilage matrix protein with aggrecan. Increased covalent cross-linking with tissue maturation.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Hauser N, Paulsson M, Heinegard D, Morgelin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8943283", "url": "https://glygen.org/publication/PubMed/8943283" } ] }, { "title": "Isolation and characterization of proteolytic fragments of insulin-like growth factor-binding protein-3.", "journal": "Hormone research", "date": "1996", "authors": "Lalou C, Lassarre C, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8964575", "url": "https://glygen.org/publication/PubMed/8964575" } ] }, { "title": "The role of the C-terminal domain of human collagenase-3 (MMP-13) in the activation of procollagenase-3, substrate specificity, and tissue inhibitor of metalloproteinase interaction.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Knauper V, Cowell S, Smith B, Lopez-Otin C, O'Shea M, Morris H, Zardi L, Murphy G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "9065415", "url": "https://glygen.org/publication/PubMed/9065415" } ] }, { "title": "Hydrolysis of a broad spectrum of extracellular matrix proteins by human macrophage elastase.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Gronski TJ Jr, Martin RL, Kobayashi DK, Walsh BC, Holman MC, Huber M, Van Wart HE, Shapiro SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "9115292", "url": "https://glygen.org/publication/PubMed/9115292" } ] }, { "title": "Degradation of decorin by matrix metalloproteinases: identification of the cleavage sites, kinetic analyses and transforming growth factor-beta1 release.", "journal": "The Biochemical journal", "date": "1997", "authors": "Imai K, Hiramatsu A, Fukushima D, Pierschbacher MD, Okada Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "9148753", "url": "https://glygen.org/publication/PubMed/9148753" } ] }, { "title": "Laminin 5 binds the NC-1 domain of type VII collagen.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Rousselle P, Keene DR, Ruggiero F, Champliaud MF, Rest M, Burgeson RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "9245798", "url": "https://glygen.org/publication/PubMed/9245798" } ] }, { "title": "Localization of a binding site for the proteoglycan decorin on collagen XIV (undulin).", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Ehnis T, Dieterich W, Bauer M, Kresse H, Schuppan D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9252349", "url": "https://glygen.org/publication/PubMed/9252349" } ] }, { "title": "The C-type lectin domains of lecticans, a family of aggregating chondroitin sulfate proteoglycans, bind tenascin-R by protein-protein interactions independent of carbohydrate moiety.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Aspberg A, Miura R, Bourdoulous S, Shimonaka M, Heinegard D, Schachner M, Ruoslahti E, Yamaguchi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9294172", "url": "https://glygen.org/publication/PubMed/9294172" } ] }, { "title": "Mapping of a defined neurocan binding site to distinct domains of tenascin-C.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Rauch U, Clement A, Retzler C, Frohlich L, Fassler R, Gohring W, Faissner A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9341124", "url": "https://glygen.org/publication/PubMed/9341124" } ] }, { "title": "Identification of hyaluronan-binding domains of aggrecan.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Watanabe H, Cheung SC, Itano N, Kimata K, Yamada Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9346959", "url": "https://glygen.org/publication/PubMed/9346959" } ] }, { "title": "SH2- and SH3-mediated interactions between focal adhesion kinase and Src.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Thomas JW, Ellis B, Boerner RJ, Knight WB, White GC 2nd, Schaller MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874081", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081" } ], "reference": [ { "type": "PubMed", "id": "9417118", "url": "https://glygen.org/publication/PubMed/9417118" } ] }, { "title": "Differential regulation of the zinc finger genes Krox-20 and Krox-24 (Egr-1) suggests antagonistic roles in Schwann cells.", "journal": "Journal of neuroscience research", "date": "1997", "authors": "Topilko P, Levi G, Merlo G, Mantero S, Desmarquet C, Mancardi G, Charnay P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "9418958", "url": "https://glygen.org/publication/PubMed/9418958" } ] }, { "title": "Membrane-type matrix metalloproteinases 1 and 2 exhibit broad-spectrum proteolytic capacities comparable to many matrix metalloproteinases.", "journal": "European journal of biochemistry", "date": "1997", "authors": "d'Ortho MP, Will H, Atkinson S, Butler G, Messent A, Gavrilovic J, Smith B, Timpl R, Zardi L, Murphy G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "9461298", "url": "https://glygen.org/publication/PubMed/9461298" } ] }, { "title": "Regenerating sciatic nerve does not utilize circulating cholesterol.", "journal": "Neurochemical research", "date": "1998", "authors": "Jurevics H, Bouldin TW, Toews AD, Morell P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "9482253", "url": "https://glygen.org/publication/PubMed/9482253" } ] }, { "title": "Insulin-like growth factor (IGF)-binding protein 5 forms an alternative ternary complex with IGFs and the acid-labile subunit.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Twigg SM, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9497324", "url": "https://glygen.org/publication/PubMed/9497324" } ] }, { "title": "Human colonic cancer cells synthesize and adhere to laminin-5. Their adhesion to laminin-5 involves multiple receptors among which is integrin alpha2beta1.", "journal": "Journal of cell science", "date": "1998", "authors": "Orian-Rousseau V, Aberdam D, Rousselle P, Messent A, Gavrilovic J, Meneguzzi G, Kedinger M, Simon-Assmann P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "9645947", "url": "https://glygen.org/publication/PubMed/9645947" } ] }, { "title": "The discoidin domain receptor tyrosine kinases are activated by collagen.", "journal": "Molecular cell", "date": "1997", "authors": "Vogel W, Gish GD, Alves F, Pawson T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000171" } ], "reference": [ { "type": "PubMed", "id": "9659899", "url": "https://glygen.org/publication/PubMed/9659899" } ] }, { "title": "An orphan receptor tyrosine kinase family whose members serve as nonintegrin collagen receptors.", "journal": "Molecular cell", "date": "1997", "authors": "Shrivastava A, Radziejewski C, Campbell E, Kovac L, McGlynn M, Ryan TE, Davis S, Goldfarb MP, Glass DJ, Lemke G, Yancopoulos GD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000171" } ], "reference": [ { "type": "PubMed", "id": "9659900", "url": "https://glygen.org/publication/PubMed/9659900" } ] }, { "title": "Cartilage oligomeric matrix protein shows high affinity zinc-dependent interaction with triple helical collagen.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Rosenberg K, Olsson H, Morgelin M, Heinegard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9685393", "url": "https://glygen.org/publication/PubMed/9685393" } ] }, { "title": "Transcriptional activation of the stearoyl-CoA desaturase 2 gene by sterol regulatory element-binding protein/adipocyte determination and differentiation factor 1.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Tabor DE, Kim JB, Spiegelman BM, Edwards PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "9705348", "url": "https://glygen.org/publication/PubMed/9705348" } ] }, { "title": "Identification of novel high molecular weight insulin-like growth factor-binding protein-3 association proteins in human serum.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1998", "authors": "Collett-Solberg PF, Nunn SE, Gibson TB, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9709957", "url": "https://glygen.org/publication/PubMed/9709957" } ] }, { "title": "The insulin-like growth factor (IGF)binding protein 1 binding epitope on IGF-I probed by heteronuclear NMR spectroscopy and mutational analysis.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Jansson M, Andersson G, Uhlen M, Nilsson B, Kordel J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9733769", "url": "https://glygen.org/publication/PubMed/9733769" } ] }, { "title": "Differential stimulation of cholesterol and unsaturated fatty acid biosynthesis in cells expressing individual nuclear sterol regulatory element-binding proteins.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Pai JT, Guryev O, Brown MS, Goldstein JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "9748295", "url": "https://glygen.org/publication/PubMed/9748295" } ] }, { "title": "Insulin-like growth factor-binding protein 5 complexes with the acid-labile subunit. Role of the carboxyl-terminal domain.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Twigg SM, Kiefer MC, Zapf J, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9786878", "url": "https://glygen.org/publication/PubMed/9786878" } ] }, { "title": "Human HtrA, an evolutionarily conserved serine protease identified as a differentially expressed gene product in osteoarthritic cartilage.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Hu SI, Carozza M, Klein M, Nantermet P, Luk D, Crowl RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1474228", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228" } ], "reference": [ { "type": "PubMed", "id": "9852107", "url": "https://glygen.org/publication/PubMed/9852107" } ] }, { "title": "Inducible and constitutive transcription factors in the mammalian nervous system: control of gene expression by Jun, Fos and Krox, and CREB/ATF proteins.", "journal": "Brain research. Brain research reviews", "date": "1998", "authors": "Herdegen T, Leah JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9619665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665" } ], "reference": [ { "type": "PubMed", "id": "9858769", "url": "https://glygen.org/publication/PubMed/9858769" } ] }, { "title": "Elevated levels of the IGF-binding protein protease MMP-1 in asthmatic airway smooth muscle.", "journal": "American journal of respiratory cell and molecular biology", "date": "1999", "authors": "Rajah R, Nachajon RV, Collins MH, Hakonarson H, Grunstein MM, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9922210", "url": "https://glygen.org/publication/PubMed/9922210" } ] }, { "title": "Tenascin-C inhibits beta1 integrin-dependent cell adhesion and neurite outgrowth on fibronectin by a disialoganglioside-mediated signaling mechanism.", "journal": "Glycobiology", "date": "1999", "authors": "Probstmeier R, Pesheva P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9949188", "url": "https://glygen.org/publication/PubMed/9949188" } ] } ], "pathway": [ { "id": "hsa:3912", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3912", "resource": "KEGG Pathway" }, { "id": "R-HSA-1474228", "name": "Degradation of the extracellular matrix", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228", "resource": "Reactome", "description": "Degradation of the extracellular matrix" }, { "id": "R-HSA-3000157", "name": "Laminin interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157", "resource": "Reactome", "description": "Laminin interactions" }, { "id": "R-HSA-3000171", "name": "Non-integrin membrane-ECM interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000171", "resource": "Reactome", "description": "Non-integrin membrane-ECM interactions" }, { "id": "R-HSA-3000178", "name": "ECM proteoglycans", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178", "resource": "Reactome", "description": "ECM proteoglycans" }, { "id": "R-HSA-373760", "name": "L1CAM interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-373760", "resource": "Reactome", "description": "L1CAM interactions" }, { "id": "R-HSA-381426", "name": "Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426", "resource": "Reactome", "description": "Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)" }, { "id": "R-HSA-8874081", "name": "MET activates PTK2 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081", "resource": "Reactome", "description": "MET activates PTK2 signaling" }, { "id": "R-HSA-8957275", "name": "Post-translational protein phosphorylation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8957275", "resource": "Reactome", "description": "Post-translational protein phosphorylation" }, { "id": "R-HSA-9619665", "name": "EGR2 and SOX10-mediated initiation of Schwann cell myelination", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9619665", "resource": "Reactome", "description": "EGR2 and SOX10-mediated initiation of Schwann cell myelination" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZQN7-1", "protein_name": "Laminin subunit beta 1", "gene_name": "Lamb1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGVLQVFAFGVLALWGTRVCAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQEDKKCFICDSRDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTVQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCESSFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDMAVFLATGNVSGGVCDNCQHNTMGRNCEQCKPFYFQHPERDIRDPNLCEPCTCDPAGSENGGICDGYTDFSVGLIAGQCRCKLHVEGERCDVCKEGFYDLSAEDPFGCKSCACNPLGTIPGGNPCDSETGYCYCKRLVTGQRCDQCLPQHWGLSNDLDGCRPCDCDLGGALNNSCSEDSGQCSCLPHMIGRQCNEVESGYYFTTLDHYIYEAEEANLGPGVVVVERRYIQDRIPSWTGPGFVRVPEGAYLEFFIDNIPHSMEYEILIRYEPQLPDHWEKAVITVQRPGRIPTSSRCGNTVPDDDNQVVSLSPGSRYVVLPRPVCFEKGMNYTVRLELPQYTASGSDVESPYTLIDSLVLMPYCKSLDIFTVGGSGDGEVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALIHQAGLACECDPQGSLSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPNGCKPCDCHLQGSVSAFCDAVTGQCHCFQGIYARQCDRCLPGFWGFPSCQPCQCNGHAEDCDTVTGECLSCQDYTTGHNCERCLAGYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDGCASGYFGNPSDFGGSCQPCQCHHNIDTTDPEACDKETGRCLKCLYHTEGDHCQFCQHGYYGDALRQDCRKCVCNYLGTVREHCNGSDCHCDKTTGQCSCLPNVIGQNCDRCAPHTWQLASGTGCEPCNCNAVHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDVECRACDCDPRGIETPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIGELTNRTHKFLEKAKALKISGVIGPYRETVDSVEKKVNEIRDILAQSPAAEPLKNIGILFEEAEKLTKDVTEKMAQVEVKLSDTASRSNSTAGELDALQAEAGSLDKTVNELAEQLEFIKNSDIQGALDSITKYFQISLEAEKRVNASTTDPNSTVEQSALTRDRVEDLMLERESQFKEKQEEQARLLDELAGKLQSLDLSAAAEMTCGTHPGADCSESECGGPNCRTDEGEKKCGGPGCGGLVTVAHSAWQKAMDFDRDVLNALAEVEQLSKMVSEAKVRADEAKQNAQDVLLKTNATREKVDRSNEDLRNLIKQIRDFLTEDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVETLSQVEVILQQSAADIARAELLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDIQGTQNLLTSIESETAASEETLTNASQRISKLERNVEELKRKAAQNSGEADYIEKVVYSVKQSADEVKKTLDGELDEKYKKVESLIAQKTEESADARRKAELLQNEAKTLLAQANSKLQLLEDLERKYEDNQKYLEDKAQELVRLEGEVRSLLKDISEKVAVYSTCL", "length": 1786 }, "evidence": [ { "id": "45917691", "url": "http://www.informatics.jax.org/homology/45917691", "database": "MGI" }, { "id": "P07942", "url": "https://omabrowser.org/oma/group/P07942/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P02469-1", "protein_name": "Laminin subunit beta-1", "gene_name": "Lamb1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGLLQVFAFGVLALWGTRVCAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQEDKKCFICDSRDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKAWGVYRYFAYDCESSFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGVNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDMAVFLATGNVSGGVCDNCQHNTMGRNCEQCKPFYFQHPERDIRDPNLCEPCTCDPAGSENGGICDGYTDFSVGLIAGQCRCKLHVEGERCDVCKEGFYDLSAEDPYGCKSCACNPLGTIPGGNPCDSETGYCYCKRLVTGQRCDQCLPQHWGLSNDLDGCRPCDCDLGGALNNSCSEDSGQCSCLPHMIGRQCNEVESGYYFTTLDHYIYEAEEANLGPGVIVVERQYIQDRIPSWTGPGFVRVPEGAYLEFFIDNIPYSMEYEILIRYEPQLPDHWEKAVITVQRPGKIPASSRCGNTVPDDDNQVVSLSPGSRYVVLPRPVCFEKGMNYTVRLELPQYTASGSDVESPYTFIDSLVLMPYCKSLDIFTVGGSGDGEVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALIHQTGLACECDPQGSLSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPNGCKPCDCHLQGSASAFCDAITGQCHCFQGIYARQCDRCLPGYWGFPSCQPCQCNGHALDCDTVTGECLSCQDYTTGHNCERCLAGYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCASGFFGNPSDFGGSCQPCQCHHNIDTTDPEACDKETGRCLKCLYHTEGDHCQLCQYGYYGDALRQDCRKCVCNYLGTVKEHCNGSDCHCDKATGQCSCLPNVIGQNCDRCAPNTWQLASGTGCGPCNCNAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDVECRACDCDPRGIETPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDAIIGELTNRTHKFLEKAKALKISGVIGPYRETVDSVEKKVNEIKDILAQSPAAEPLKNIGILFEEAEKLTKDVTEKMAQVEVKLTDTASQSNSTAGELGALQAEAESLDKTVKELAEQLEFIKNSDIQGALDSITKYFQMSLEAEKRVNASTTDPNSTVEQSALTRDRVEDLMLERESPFKEQQEEQARLLDELAGKLQSLDLSAVAQMTCGTPPGADCSESECGGPNCRTDEGEKKCGGPGCGGLVTVAHSAWQKAMDFDRDVLSALAEVEQLSKMVSEAKVRADEAKQNAQDVLLKTNATKEKVDKSNEDLRNLIKQIRNFLTEDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVETLSQVEVILQQSAADIARAELLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDIQGTQNLLTSIESETAASEETLTNASQRISKLERNVEELKRKAAQNSGEAEYIEKVVYSVKQNADDVKKTLDGELDEKYKKVESLIAQKTEESADARRKAELLQNEAKTLLAQANSKLQLLEDLERKYEDNQKYLEDKAQELVRLEGEVRSLLKDISEKVAVYSTCL", "length": 1786 }, "evidence": [ { "id": "45917691", "url": "http://www.informatics.jax.org/homology/45917691", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 13, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "pmid": "" }, { "name": "endoplasmic reticulum lumen", "id": "GO:0005788", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005788", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "pmid": "" }, { "name": "basement membrane", "id": "GO:0005604", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005604", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "pmid": "" }, { "name": "laminin-1 complex", "id": "GO:0005606", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005606", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "pmid": "" }, { "name": "laminin-2 complex", "id": "GO:0005607", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005607", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "pmid": "" }, { "name": "laminin-8 complex", "id": "GO:0043257", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043257", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "pmid": "" }, { "name": "laminin-10 complex", "id": "GO:0043259", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043259", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "pmid": "" }, { "name": "collagen-containing extracellular matrix", "id": "GO:0062023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062023", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "pmid": "" }, { "name": "protein complex involved in cell-matrix adhesion", "id": "GO:0098637", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098637", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 12, "go_terms": [ { "name": "cell adhesion", "id": "GO:0007155", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007155", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "pmid": "" }, { "name": "positive regulation of cell migration", "id": "GO:0030335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030335", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "pmid": "" }, { "name": "neuron projection development", "id": "GO:0031175", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031175", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "pmid": "" }, { "name": "positive regulation of cell adhesion", "id": "GO:0045785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045785", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "pmid": "" }, { "name": "substrate adhesion-dependent cell spreading", "id": "GO:0034446", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034446", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "pmid": "" }, { "name": "positive regulation of muscle cell differentiation", "id": "GO:0051149", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051149", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "pmid": "" }, { "name": "odontogenesis", "id": "GO:0042476", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042476", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "pmid": "" }, { "name": "positive regulation of epithelial cell proliferation", "id": "GO:0050679", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050679", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "pmid": "" }, { "name": "positive regulation of integrin-mediated signaling pathway", "id": "GO:2001046", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001046", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "pmid": "" }, { "name": "endodermal cell differentiation", "id": "GO:0035987", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035987", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "pmid": "" }, { "name": "neuronal-glial interaction involved in cerebral cortex radial glia guided migration", "id": "GO:0021812", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021812", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "pmid": "" }, { "name": "regulation of basement membrane organization", "id": "GO:0110011", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0110011", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "structural molecule activity", "id": "GO:0005198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005198", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "pmid": "" }, { "name": "extracellular matrix structural constituent", "id": "GO:0005201", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005201", "evidence": [ { "database": "UniProtKB", "id": "P07942", "url": "https://www.uniprot.org/uniprot/P07942" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "laminin subunit beta-1 N-glycosylated 1 (human)", "definition": "A laminin subunit beta-1 (human) that has been N-glycosylated at the residue equivalent to Asn-1279 of the amino acid sequence represented by UniProtKB:P07942-1, in which the glycan composition is represented by GlyTouCan:G83633GK. Example: UniProtKB:P07942-1, Asn-1279, MOD:00160~GNO:G83633GK. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054413", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054413" } ] } ], "site_annotation": [ { "start_pos": 1041, "end_pos": 1043, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1195, "end_pos": 1197, "annotation": "n_glycosylation_sequon" }, { "start_pos": 120, "end_pos": 122, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1279, "end_pos": 1281, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1336, "end_pos": 1338, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1343, "end_pos": 1345, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1487, "end_pos": 1489, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1542, "end_pos": 1544, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1643, "end_pos": 1645, "annotation": "n_glycosylation_sequon" }, { "start_pos": 356, "end_pos": 358, "annotation": "n_glycosylation_sequon" }, { "start_pos": 519, "end_pos": 521, "annotation": "n_glycosylation_sequon" }, { "start_pos": 677, "end_pos": 679, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 120, 330, 356, 519, 677, 1041, 1195, 1279, 1336, 1343, 1487, 1542 ], "o_linked_sites": [ 1280, 1425, 1434, 1435, 1678 ], "snv_sites": [ 120, 122, 153, 272, 330, 338, 356, 358, 370, 413, 519, 521, 615, 679, 688, 730, 905, 966, 982, 1043, 1099, 1197, 1280, 1296, 1338, 1343, 1345, 1487, 1544, 1678 ], "glycation_sites": [], "phosphorylation_sites": [ 154, 242, 250, 939, 950, 953, 1280, 1281, 1478, 1496, 1666, 1682, 1735 ], "sequon_annotation_sites": [ { "start_pos": 1041, "end_pos": 1043 }, { "start_pos": 1195, "end_pos": 1197 }, { "start_pos": 120, "end_pos": 122 }, { "start_pos": 1279, "end_pos": 1281 }, { "start_pos": 1336, "end_pos": 1338 }, { "start_pos": 1343, "end_pos": 1345 }, { "start_pos": 1487, "end_pos": 1489 }, { "start_pos": 1542, "end_pos": 1544 }, { "start_pos": 1643, "end_pos": 1645 }, { "start_pos": 356, "end_pos": 358 }, { "start_pos": 519, "end_pos": 521 }, { "start_pos": 677, "end_pos": 679 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 61 }, { "field": "total_sites", "count": 16 }, { "field": "n_linked_glycans", "count": 33 }, { "field": "n_linked_glycan_sites", "count": 17 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 4 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 5 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 50 }, { "field": "total_sites", "count": 10 }, { "field": "n_linked_glycans", "count": 33 }, { "field": "n_linked_glycan_sites", "count": 6 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 4 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 6 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 13 }, { "field": "total_sites", "count": 13 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 33 }, { "field": "total_sites", "count": 30 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 28 }, { "field": "total_sites", "count": 25 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 292 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }