{ "uniprot_canonical_ac": "P07911-1", "uniprot_ac": "P07911", "uniprot_id": "UROM_HUMAN", "mass": { "chemical_mass": 69761.0, "monoisotopic_mass": 69761.0 }, "refseq": { "ac": "NP_001008390", "name": "uromodulin isoform a preproprotein", "summary": "The protein encoded by this gene is the most abundant protein in mammalian urine under physiological conditions. Its excretion in urine follows proteolytic cleavage of the ectodomain of its glycosyl phosphatidylinosital-anchored counterpart that is situated on the luminal cell surface of the loop of Henle. This protein may act as a constitutive inhibitor of calcium crystallization in renal fluids. Excretion of this protein in urine may provide defense against urinary tract infections caused by uropathogenic bacteria. Defects in this gene are associated with the renal disorders medullary cystic kidney disease-2 (MCKD2), glomerulocystic kidney disease with hyperuricemia and isosthenuria (GCKDHI), and familial juvenile hyperuricemic nephropathy (FJHN). Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2013].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008390" }, "gene_names": [ { "name": "UMOD", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P07911", "id": "P07911" }, { "name": "ADMCKD2; ADTKD1; FJHN; HNFJ; HNFJ1; MCKD2; THGP; THP", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008390", "id": "NP_001008390" }, { "name": "UMOD", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008390", "id": "NP_001008390" } ], "protein_names": [ { "name": "Uromodulin", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P07911" }, { "name": "THP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07911" }, { "name": "Tamm-Horsfall urinary glycoprotein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07911" }, { "name": "uromodulin isoform a preproprotein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008390", "id": "NP_001008390" }, { "name": "uromucoid; Tamm-Horsfall urinary glycoprotein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008390", "id": "NP_001008390" } ], "function": [ { "annotation": "Functions in biogenesis and organization of the apical membrane of epithelial cells of the thick ascending limb of Henle's loop (TALH), where it promotes formation of complex filamentous gel-like structure that may play a role in the water barrier permeability (Probable). May serve as a receptor for binding and endocytosis of cytokines (IL-1, IL-2) and TNF (PubMed:3498215). Facilitates neutrophil migration across renal epithelia (PubMed:20798515).", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911#function" }, { "database": "PubMed", "id": "20798515", "url": "https://glygen.org/publication/PubMed/20798515" }, { "database": "PubMed", "id": "3498215", "url": "https://glygen.org/publication/PubMed/3498215" } ] }, { "annotation": "Healthy Women Have Higher Systemic Uromodulin Levels: Identification of Uromodulin as an Estrogen Responsive Gene.", "evidence": [ { "database": "RefSeq", "id": "NP_001008390", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008390" }, { "database": "PubMed", "id": "37340540", "url": "https://glygen.org/publication/PubMed/37340540" } ] }, { "annotation": "In the urine, may contribute to colloid osmotic pressure, retards passage of positively charged electrolytes, and inhibits formation of liquid containing supersaturated salts and subsequent formation of salt crystals (By similarity). Protects against urinary tract infections by binding to type 1 fimbriated E.coli (PubMed:11134021, PubMed:32616672). Binds to bacterial adhesin fimH which mediates the stable formation of bacterial aggregates, prevents the binding of E.coli to uroplakins UPK1A and UPK1B which act as urothelial receptors for type I fimbriae, and allows for pathogen clearance through micturation (PubMed:11134021, PubMed:32616672). Also promotes aggregation of other bacteria including K.pneumoniae, P.aeruginosa and S.mitis and so may also protect against other uropathogens (PubMed:32616672).", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911#function" }, { "database": "UniProtKB", "id": "Q91X17", "url": "https://www.uniprot.org/uniprot/Q91X17#function" }, { "database": "PubMed", "id": "32616672", "url": "https://glygen.org/publication/PubMed/32616672" }, { "database": "PubMed", "id": "11134021", "url": "https://glygen.org/publication/PubMed/11134021" } ] }, { "annotation": "Kidney function may partially mediated the protective effect of urinary uromodulin on kidney stone. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001008390", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008390" }, { "database": "PubMed", "id": "37022471", "url": "https://glygen.org/publication/PubMed/37022471" } ] }, { "annotation": "The protein encoded by this gene is the most abundant protein in mammalian urine under physiological conditions. Its excretion in urine follows proteolytic cleavage of the ectodomain of its glycosyl phosphatidylinosital-anchored counterpart that is situated on the luminal cell surface of the loop of Henle. This protein may act as a constitutive inhibitor of calcium crystallization in renal fluids. Excretion of this protein in urine may provide defense against urinary tract infections caused by uropathogenic bacteria. Defects in this gene are associated with the renal disorders medullary cystic kidney disease-2 (MCKD2), glomerulocystic kidney disease with hyperuricemia and isosthenuria (GCKDHI), and familial juvenile hyperuricemic nephropathy (FJHN). Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2013].", "evidence": [ { "database": "RefSeq", "id": "NP_001008390", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008390" } ] }, { "annotation": "Urinary uromodulin is generated by a conserved C-terminal proteolytic cleavage and retains its entire ZP domain.", "evidence": [ { "database": "RefSeq", "id": "NP_001008390", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008390" }, { "database": "PubMed", "id": "18375198", "url": "https://glygen.org/publication/PubMed/18375198" } ] } ], "disease": [ { "disease_id": "DOID:0060062", "recommended_name": { "id": "DOID:0060062", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060062", "name": "familial juvenile hyperuricemic nephropathy", "description": "A kidney disease that is characterized by hyperuricemia with renal uric acid under-excretion, gout and chronic kidney disease." }, "synonyms": [ { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "familial juvenile hyperuricemic nephropathy type 1", "description": "A rare kidney disorder characterized by hyperuricemia, progressive nephropathy, and gout occurring at an early age." }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "familial juvenile gouty nephropathy", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "familial nephropathy with gout", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "gouty nephropathy, familial juvenile", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "hyperuricemic nephropathy, familial juvenile", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "nephropathy, familial, with gout", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "ADTKD-UMOD", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "FJHN type 1", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "HNFJ1", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "UMOD familial juvenile hyperuricemic nephropathy", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "UMOD-associated FJHN", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "UMOD-associated familial juvenile hyperuricemic nephropathy", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "UMOD-related ADTKD", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "UMOD-related kidney disease", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "autosomal dominant medullary cystic kidney disease type 2", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "autosomal dominant medullary cystic kidney disease with hyperuricemia", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "autosomal dominant tubulointerstitial kidney disease due to mutations in UMOD", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "familial juvenile hyperuricemic nephropathy caused by mutation in UMOD", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "glomerulocystic kidney disease with hyperuricemia and isosthenuria", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "hyperuricemic nephropathy, familial juvenile, 1", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "hyperuricemic nephropathy, familial juvenile, type 1", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "medullary cystic kidney disease 2", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "medullary cystic kidney disease type 2", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "medullary cystic kidney disease type II", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "tubulointerstitial kidney disease, autosomal dominant, 1", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "uromodulin storage disease", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "uromodulin-associated kidney disease", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "ADMCKD2", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "MCKD2", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "UMOD-related autosomal dominant tubulointerstitial kidney disease", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "familial juvenile hyperuricaemic nephropathy", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "medullary cystic kidney disease 2, autosomal dominant", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "familial juvenile hyperuricemic nephropathy type 2", "description": "Familial juvenile hyperuricemic nephropathy type 2 is a rare autosomal dominantly inherited disease of childhood characterized by hypoproliferative anemia, hyperuricemia and slowly progressing kidney failure due to dysregulation of the renin-angiotensin system (RAS)." }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "ADTKD-REN", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "FJHN type 2", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "REN familial juvenile hyperuricemic nephropathy", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "REN-associated FJHN", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "REN-associated familial juvenile hyperuricemic nephropathy", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "REN-associated kidney disease", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "autosomal dominant tubulointerstitial kidney disease due to mutations in REN", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "familial juvenile hyperuricemic nephropathy caused by mutation in REN", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "familial juvenile hyperuricemic nephropathy type 2", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "hyperuricemic nephropathy, familial juvenile, type 2", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "tubulointerstitial kidney disease, autosomal dominant, 4", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "HNFJ2", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "REN-related autosomal dominant tubulointerstitial kidney disease", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "early-onset hyperuricemia, Anemia, and progressive kidney failure", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "hyperuricemic nephropathy, familial juvenile, 2", "description": "" }, { "id": "MONDO:0013643", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013643", "name": "hyperuricemic nephropathy, familial juvenile type 3", "description": "" }, { "id": "MONDO:0013643", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013643", "name": "HNFJ3", "description": "" }, { "id": "MONDO:0013643", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013643", "name": "hyperuricemic nephropathy, familial juvenile, 3", "description": "" }, { "id": "MIM:162000", "resource": "MIM", "url": "https://www.omim.org/entry/162000", "name": "Tubulointerstitial kidney disease, autosomal dominant, 1", "description": "Tubulointerstitial kidney disease, autosomal dominant, 1" }, { "id": "MIM:613092", "resource": "MIM", "url": "https://www.omim.org/entry/613092", "name": "Tubulointerstitial kidney disease, autosomal dominant, 4", "description": "Tubulointerstitial kidney disease, autosomal dominant, 4" } ], "evidence": [ { "id": "162000", "database": "MIM", "url": "https://www.omim.org/entry/162000" } ] } ], "snv": [ { "evidence": [ { "id": "rs1567309377", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1567309377" }, { "id": "rs1567309377", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1567309377" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 277, "end_pos": 277, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->NLR); o-glyco-site-loss (T->R).", "chr_id": "16", "chr_pos": "20348471", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T277", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs752681709", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752681709" }, { "id": "rs752681709", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752681709" }, { "id": "rs752681709", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752681709" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 232, "end_pos": 232, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->KGT).", "chr_id": "16", "chr_pos": "20348605", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N232", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1426900885", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1426900885" }, { "id": "rs1426900885", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1426900885#frequency_tab" }, { "id": "rs1426900885", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1426900885" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 234, "end_pos": 234, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->NGK).", "chr_id": "16", "chr_pos": "20348600", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T234", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1426900885", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1426900885" }, { "id": "rs1426900885", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1426900885#frequency_tab" }, { "id": "rs1426900885", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1426900885" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 234, "end_pos": 234, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->NGM).", "chr_id": "16", "chr_pos": "20348600", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T234", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1190932235", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1190932235" }, { "id": "rs1190932235", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1190932235" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 252, "end_pos": 252, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "16", "chr_pos": "20348547", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S252", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1459671950", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1459671950" }, { "id": "rs1459671950", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1459671950" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 259, "end_pos": 259, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DAS->NAS).", "chr_id": "16", "chr_pos": "20348526", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D259", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs772246118", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772246118" }, { "id": "rs772246118", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772246118" }, { "id": "rs772246118", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs772246118#frequency_tab" }, { "id": "rs772246118", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772246118" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 25, "end_pos": 25, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DTS->NTS).", "chr_id": "16", "chr_pos": "20350665", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D25", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs778754785", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778754785" }, { "id": "rs778754785", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778754785" }, { "id": "rs778754785", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778754785#frequency_tab" }, { "id": "rs778754785", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778754785" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 275, "end_pos": 275, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->SLT).", "chr_id": "16", "chr_pos": "20348477", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N275", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs982409965", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs982409965" }, { "id": "rs982409965", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs982409965" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 275, "end_pos": 275, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->YLT).", "chr_id": "16", "chr_pos": "20348478", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N275", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs147199402", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147199402" }, { "id": "rs147199402", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147199402" }, { "id": "rs147199402", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs147199402#frequency_tab" }, { "id": "rs147199402", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs147199402" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 292, "end_pos": 292, "sequence_org": "S", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->Y).", "chr_id": "16", "chr_pos": "20348321", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S292", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs759032284", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759032284" }, { "id": "rs759032284", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759032284" }, { "id": "rs759032284", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs759032284" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 322, "end_pos": 322, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "16", "chr_pos": "20348230", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N322", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs765984547", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765984547" }, { "id": "rs765984547", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765984547" }, { "id": "rs765984547", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765984547" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 322, "end_pos": 322, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "16", "chr_pos": "20348231", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N322", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs752403214", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752403214" }, { "id": "rs752403214", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752403214" }, { "id": "rs752403214", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752403214" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 324, "end_pos": 324, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->NIA).", "chr_id": "16", "chr_pos": "20348226", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T324", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs941211035", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs941211035" }, { "id": "rs941211035", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs941211035" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 324, "end_pos": 324, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->NII).", "chr_id": "16", "chr_pos": "20348225", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T324", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1259853990", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1259853990" }, { "id": "rs1259853990", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1259853990" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 360, "end_pos": 360, "sequence_org": "Y", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (YLS->NLS).", "chr_id": "16", "chr_pos": "20346230", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "Y360", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1481027280", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1481027280" }, { "id": "rs1481027280", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1481027280" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 396, "end_pos": 396, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "16", "chr_pos": "20344168", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N396", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1965401087", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1965401087" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 398, "end_pos": 398, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->NEI).", "chr_id": "16", "chr_pos": "20344162", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T398", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs749428596", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749428596" }, { "id": "rs749428596", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749428596" }, { "id": "rs749428596", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs749428596#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 403, "end_pos": 403, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SNT->NNT).", "chr_id": "16", "chr_pos": "20344147", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S403", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1486280813", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1486280813" }, { "id": "rs1486280813", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1486280813" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 40, "end_pos": 40, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->NAI).", "chr_id": "16", "chr_pos": "20349182", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T40", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1250994911", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1250994911" }, { "id": "rs1250994911", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1250994911#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 449, "end_pos": 449, "sequence_org": "R", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NIR->NIS).", "chr_id": "16", "chr_pos": "20341321", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "R449", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs768490922", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768490922" }, { "id": "rs768490922", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768490922" }, { "id": "rs768490922", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs768490922#frequency_tab" }, { "id": "rs768490922", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768490922" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 495, "end_pos": 495, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DLS->NLS).", "chr_id": "16", "chr_pos": "20341185", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D495", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs550521976", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs550521976" }, { "id": "rs550521976", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs550521976" }, { "id": "rs550521976", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs550521976#frequency_tab" }, { "id": "rs550521976", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs550521976" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 515, "end_pos": 515, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->NAM).", "chr_id": "16", "chr_pos": "20341124", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T515", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs550521976", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs550521976" }, { "id": "rs550521976", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs550521976" }, { "id": "rs550521976", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs550521976#frequency_tab" }, { "id": "rs550521976", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs550521976" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 515, "end_pos": 515, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->NAR).", "chr_id": "16", "chr_pos": "20341124", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T515", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs143641292", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143641292" }, { "id": "rs143641292", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143641292" }, { "id": "rs143641292", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs143641292#frequency_tab" }, { "id": "rs143641292", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs143641292" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 581, "end_pos": 581, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TCS->NCS).", "chr_id": "16", "chr_pos": "20336726", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T581", "disease": [ { "disease_id": "DOID:0060062", "recommended_name": { "id": "DOID:0060062", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060062", "name": "familial juvenile hyperuricemic nephropathy", "description": "A kidney disease that is characterized by hyperuricemia with renal uric acid under-excretion, gout and chronic kidney disease." }, "synonyms": [ { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "familial juvenile hyperuricemic nephropathy type 1", "description": "A rare kidney disorder characterized by hyperuricemia, progressive nephropathy, and gout occurring at an early age." }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "familial juvenile gouty nephropathy", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "familial nephropathy with gout", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "gouty nephropathy, familial juvenile", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "hyperuricemic nephropathy, familial juvenile", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "nephropathy, familial, with gout", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "ADTKD-UMOD", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "FJHN type 1", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "HNFJ1", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "UMOD familial juvenile hyperuricemic nephropathy", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "UMOD-associated FJHN", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "UMOD-associated familial juvenile hyperuricemic nephropathy", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "UMOD-related ADTKD", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "UMOD-related kidney disease", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "autosomal dominant medullary cystic kidney disease type 2", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "autosomal dominant medullary cystic kidney disease with hyperuricemia", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "autosomal dominant tubulointerstitial kidney disease due to mutations in UMOD", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "familial juvenile hyperuricemic nephropathy caused by mutation in UMOD", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "glomerulocystic kidney disease with hyperuricemia and isosthenuria", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "hyperuricemic nephropathy, familial juvenile, 1", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "hyperuricemic nephropathy, familial juvenile, type 1", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "medullary cystic kidney disease 2", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "medullary cystic kidney disease type 2", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "medullary cystic kidney disease type II", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "tubulointerstitial kidney disease, autosomal dominant, 1", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "uromodulin storage disease", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "uromodulin-associated kidney disease", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "ADMCKD2", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "MCKD2", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "UMOD-related autosomal dominant tubulointerstitial kidney disease", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "familial juvenile hyperuricaemic nephropathy", "description": "" }, { "id": "MONDO:0008073", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008073", "name": "medullary cystic kidney disease 2, autosomal dominant", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "familial juvenile hyperuricemic nephropathy type 2", "description": "Familial juvenile hyperuricemic nephropathy type 2 is a rare autosomal dominantly inherited disease of childhood characterized by hypoproliferative anemia, hyperuricemia and slowly progressing kidney failure due to dysregulation of the renin-angiotensin system (RAS)." }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "ADTKD-REN", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "FJHN type 2", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "REN familial juvenile hyperuricemic nephropathy", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "REN-associated FJHN", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "REN-associated familial juvenile hyperuricemic nephropathy", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "REN-associated kidney disease", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "autosomal dominant tubulointerstitial kidney disease due to mutations in REN", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "familial juvenile hyperuricemic nephropathy caused by mutation in REN", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "familial juvenile hyperuricemic nephropathy type 2", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "hyperuricemic nephropathy, familial juvenile, type 2", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "tubulointerstitial kidney disease, autosomal dominant, 4", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "HNFJ2", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "REN-related autosomal dominant tubulointerstitial kidney disease", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "early-onset hyperuricemia, Anemia, and progressive kidney failure", "description": "" }, { "id": "MONDO:0013128", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013128", "name": "hyperuricemic nephropathy, familial juvenile, 2", "description": "" }, { "id": "MONDO:0013643", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013643", "name": "hyperuricemic nephropathy, familial juvenile type 3", "description": "" }, { "id": "MONDO:0013643", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013643", "name": "HNFJ3", "description": "" }, { "id": "MONDO:0013643", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013643", "name": "hyperuricemic nephropathy, familial juvenile, 3", "description": "" }, { "id": "MIM:162000", "resource": "MIM", "url": "https://www.omim.org/entry/162000", "name": "Tubulointerstitial kidney disease, autosomal dominant, 1", "description": "Tubulointerstitial kidney disease, autosomal dominant, 1" }, { "id": "MIM:613092", "resource": "MIM", "url": "https://www.omim.org/entry/613092", "name": "Tubulointerstitial kidney disease, autosomal dominant, 4", "description": "Tubulointerstitial kidney disease, autosomal dominant, 4" } ] } ], "keywords": [ "ebi", "germline", "disease" ] }, { "evidence": [ { "id": "rs184339980", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs184339980" }, { "id": "rs184339980", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs184339980" }, { "id": "rs184339980", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs184339980" }, { "id": "rs184339980", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs184339980#frequency_tab" }, { "id": "rs184339980", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs184339980" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 594, "end_pos": 594, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DQS->NQS).", "chr_id": "16", "chr_pos": "20336688", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "D594", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P07911", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07911" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 634, "end_pos": 634, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (TLT->NLT).", "chr_id": "16", "chr_pos": "20336714", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "T634", "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs766532087", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766532087" }, { "id": "rs766532087", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766532087" }, { "id": "rs766532087", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs766532087" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 76, "end_pos": 76, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->DCS).", "chr_id": "16", "chr_pos": "20349075", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N76", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1336248874", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1336248874" }, { "id": "rs1336248874", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1336248874#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 76, "end_pos": 76, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "16", "chr_pos": "20349074", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N76", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1336248874", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1336248874" }, { "id": "rs1336248874", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1336248874#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 76, "end_pos": 76, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->TCS).", "chr_id": "16", "chr_pos": "20349074", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N76", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1596563120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1596563120" }, { "id": "rs1596563120", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1596563120" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 78, "end_pos": 78, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->NCP).", "chr_id": "16", "chr_pos": "20349069", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S78", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1288986917", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1288986917" }, { "id": "rs1288986917", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1288986917#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 80, "end_pos": 80, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "16", "chr_pos": "20349062", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N80", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs374642516", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374642516" }, { "id": "rs374642516", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374642516" }, { "id": "rs374642516", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs374642516#frequency_tab" }, { "id": "rs374642516", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs374642516" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 87, "end_pos": 87, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NTP->NTS).", "chr_id": "16", "chr_pos": "20349042", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P87", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 333, "end_pos": 333, "sequence_org": "L", "sequence_mut": "K", "comment": "Abolishes polymerization and filament formation of the secreted form.", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" }, { "database": "PubMed", "id": "26811476", "url": "https://glygen.org/publication/PubMed/26811476" } ] }, { "start_pos": 415, "end_pos": 415, "sequence_org": "R", "sequence_mut": "A", "comment": "Abolishes polymerization. No effect on protein trafficking or secretion. Suppresses the dominant-negative loss of polymerization in 555-F-A-556 DEL or 586-A--A-589; when associated with 555-F-A-556 DEL or 586-A--A-589.", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" }, { "database": "PubMed", "id": "33196145", "url": "https://glygen.org/publication/PubMed/33196145" } ] }, { "start_pos": 421, "end_pos": 421, "sequence_org": "I", "sequence_mut": "K", "comment": "Abolishes polymerization and filament formation of the secreted form.", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" }, { "database": "PubMed", "id": "26811476", "url": "https://glygen.org/publication/PubMed/26811476" } ] }, { "start_pos": 430, "end_pos": 430, "sequence_org": "D", "sequence_mut": "L", "comment": "Impairs polymerization and filament formation of the secreted form.", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" }, { "database": "PubMed", "id": "19005207", "url": "https://glygen.org/publication/PubMed/19005207" } ] }, { "start_pos": 435, "end_pos": 435, "sequence_org": "L", "sequence_mut": "S", "comment": "Impairs polymerization and filament formation of the secreted form.", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" }, { "database": "PubMed", "id": "19005207", "url": "https://glygen.org/publication/PubMed/19005207" } ] }, { "start_pos": 458, "end_pos": 458, "sequence_org": "V", "sequence_mut": "R", "comment": "Leads to retention in the endoplasmic reticulum, probably due to misfolding.", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" }, { "database": "PubMed", "id": "19005207", "url": "https://glygen.org/publication/PubMed/19005207" } ] }, { "start_pos": 555, "end_pos": 556, "sequence_org": "FA", "sequence_mut": "", "comment": "Abolishes polymerization, in a dominant-negative manner. No effect on protein trafficking or secretion. Suppresses the dominant-negative loss of polymerization; when associated with A-415.", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" }, { "database": "PubMed", "id": "33196145", "url": "https://glygen.org/publication/PubMed/33196145" } ] }, { "start_pos": 586, "end_pos": 589, "sequence_org": "RFRS", "sequence_mut": "AAAA", "comment": "Abolishes cleavage by HPN. Abolishes polymerization, in a dominant-negative manner. Suppresses the dominant-negative loss of polymerization; when associated with A-415.", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" }, { "database": "PubMed", "id": "26811476", "url": "https://glygen.org/publication/PubMed/26811476" }, { "database": "PubMed", "id": "19005207", "url": "https://glygen.org/publication/PubMed/19005207" }, { "database": "PubMed", "id": "26673890", "url": "https://glygen.org/publication/PubMed/26673890" }, { "database": "PubMed", "id": "33196145", "url": "https://glygen.org/publication/PubMed/33196145" } ] }, { "start_pos": 598, "end_pos": 600, "sequence_org": "VLN", "sequence_mut": "AAA", "comment": "Decreased export from the endoplasmic reticulum, leading to decreased secretion. Impairs polymerization.", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" }, { "database": "PubMed", "id": "19005207", "url": "https://glygen.org/publication/PubMed/19005207" } ] }, { "start_pos": 602, "end_pos": 603, "sequence_org": "GP", "sequence_mut": "AA", "comment": "Decreased export from the endoplasmic reticulum, leading to decreased secretion. Impairs polymerization.", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" }, { "database": "PubMed", "id": "19005207", "url": "https://glygen.org/publication/PubMed/19005207" } ] }, { "start_pos": 605, "end_pos": 607, "sequence_org": "TRK", "sequence_mut": "AAA", "comment": "No effect on secretion. Does not impair polymerization.", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" }, { "database": "PubMed", "id": "19005207", "url": "https://glygen.org/publication/PubMed/19005207" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "98.77", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000169344", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169344" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "41.27", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000169344", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169344" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "49.45", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000169344", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169344" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000169344", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169344" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "17.43", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000169344", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169344" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "16.94", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000169344", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169344" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000169344", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169344" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "30.96", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000169344", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169344" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "21.14", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000169344", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169344" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000169344", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169344" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "27.03", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000169344", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169344" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "41.11", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000169344", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169344" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "43.17", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000169344", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169344" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P07911", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07911" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P07911", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07911" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P07911", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07911" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P07911", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07911" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P07911", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07911" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P07911", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07911" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P07911", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07911" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P07911", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07911" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P07911", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07911" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P07911", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07911" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P07911", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07911" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "common_name": "Human" } ], "gene": [ { "name": "UMOD", "url": "https://www.uniprot.org/uniprot/P07911", "locus": { "chromosome": "16", "start_pos": 20333051, "end_pos": 20356301, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000169344", "url": "https://www.ensembl.org/id/ENSG00000169344" } ] } } ], "crossref": [ { "id": "ENSG00000169344", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169344", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P07911", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07911", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd00054", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00054", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "UMOD", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=UMOD", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "7369", "url": "https://www.ncbi.nlm.nih.gov/gene/7369", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "12559", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=12559", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P07911", "url": "https://www.ebi.ac.uk/intact/interactors/id:P07911*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000152", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000152", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000742", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000742", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001507", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001507", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001881", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001881", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009030", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009030", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017977", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017977", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018097", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018097", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR024731", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024731", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042235", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042235", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR048290", "url": "https://www.ebi.ac.uk/interpro/entry/IPR048290", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:7369", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7369", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "162000", "url": "http://www.omim.org/entry/162000", "database": "MIM", "categories": [ "Other" ] }, { "id": "191845", "url": "http://www.omim.org/entry/191845", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P07911", "url": "https://www.nextprot.org/entry/NX_P07911", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "PPECYLA", "url": "https://omabrowser.org/oma/group/PPECYLA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5293157at2759", "url": "http://www.orthodb.org/?query=5293157at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR14002", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14002", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR14002:SF40", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14002:SF40", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24039", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24039", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24039:SF28", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24039:SF28", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "4WRN", "url": "https://www.rcsb.org/structure/4WRN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6TQK", "url": "https://www.rcsb.org/structure/6TQK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6TQL", "url": "https://www.rcsb.org/structure/6TQL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ZS5", "url": "https://www.rcsb.org/structure/6ZS5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ZYA", "url": "https://www.rcsb.org/structure/6ZYA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PFP", "url": "https://www.rcsb.org/structure/7PFP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Q3N", "url": "https://www.rcsb.org/structure/7Q3N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00100", "url": "http://pfam.xfam.org/family/PF00100", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF07645", "url": "http://pfam.xfam.org/family/PF07645", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF12947", "url": "http://pfam.xfam.org/family/PF12947", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P07911", "url": "https://pharos.nih.gov/targets/P07911", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000053980", "url": "https://proconsortium.org/app/entry/PR:000053980", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053981", "url": "https://proconsortium.org/app/entry/PR:000053981", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053982", "url": "https://proconsortium.org/app/entry/PR:000053982", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053983", "url": "https://proconsortium.org/app/entry/PR:000053983", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053984", "url": "https://proconsortium.org/app/entry/PR:000053984", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053985", "url": "https://proconsortium.org/app/entry/PR:000053985", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053986", "url": "https://proconsortium.org/app/entry/PR:000053986", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053987", "url": "https://proconsortium.org/app/entry/PR:000053987", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053988", "url": "https://proconsortium.org/app/entry/PR:000053988", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053989", "url": "https://proconsortium.org/app/entry/PR:000053989", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053990", "url": "https://proconsortium.org/app/entry/PR:000053990", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053991", "url": "https://proconsortium.org/app/entry/PR:000053991", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053992", "url": "https://proconsortium.org/app/entry/PR:000053992", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053993", "url": "https://proconsortium.org/app/entry/PR:000053993", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053994", "url": "https://proconsortium.org/app/entry/PR:000053994", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053995", "url": "https://proconsortium.org/app/entry/PR:000053995", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053996", "url": "https://proconsortium.org/app/entry/PR:000053996", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053997", "url": "https://proconsortium.org/app/entry/PR:000053997", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053998", "url": "https://proconsortium.org/app/entry/PR:000053998", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053999", "url": "https://proconsortium.org/app/entry/PR:000053999", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054000", "url": "https://proconsortium.org/app/entry/PR:000054000", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054001", "url": "https://proconsortium.org/app/entry/PR:000054001", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054002", "url": "https://proconsortium.org/app/entry/PR:000054002", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054003", "url": "https://proconsortium.org/app/entry/PR:000054003", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054004", "url": "https://proconsortium.org/app/entry/PR:000054004", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054005", "url": "https://proconsortium.org/app/entry/PR:000054005", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054006", "url": "https://proconsortium.org/app/entry/PR:000054006", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054007", "url": "https://proconsortium.org/app/entry/PR:000054007", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054008", "url": "https://proconsortium.org/app/entry/PR:000054008", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054009", "url": "https://proconsortium.org/app/entry/PR:000054009", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054010", "url": "https://proconsortium.org/app/entry/PR:000054010", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054011", "url": "https://proconsortium.org/app/entry/PR:000054011", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054012", "url": "https://proconsortium.org/app/entry/PR:000054012", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054013", "url": "https://proconsortium.org/app/entry/PR:000054013", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054014", "url": "https://proconsortium.org/app/entry/PR:000054014", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054015", "url": "https://proconsortium.org/app/entry/PR:000054015", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054016", "url": "https://proconsortium.org/app/entry/PR:000054016", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054017", "url": "https://proconsortium.org/app/entry/PR:000054017", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054018", "url": "https://proconsortium.org/app/entry/PR:000054018", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054019", "url": "https://proconsortium.org/app/entry/PR:000054019", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054020", "url": "https://proconsortium.org/app/entry/PR:000054020", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054021", "url": "https://proconsortium.org/app/entry/PR:000054021", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054022", "url": "https://proconsortium.org/app/entry/PR:000054022", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054023", "url": "https://proconsortium.org/app/entry/PR:000054023", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054024", "url": "https://proconsortium.org/app/entry/PR:000054024", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054025", "url": "https://proconsortium.org/app/entry/PR:000054025", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054026", "url": "https://proconsortium.org/app/entry/PR:000054026", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054027", "url": "https://proconsortium.org/app/entry/PR:000054027", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054028", "url": "https://proconsortium.org/app/entry/PR:000054028", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054029", "url": "https://proconsortium.org/app/entry/PR:000054029", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054030", "url": "https://proconsortium.org/app/entry/PR:000054030", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054031", "url": "https://proconsortium.org/app/entry/PR:000054031", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054032", "url": "https://proconsortium.org/app/entry/PR:000054032", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054033", "url": "https://proconsortium.org/app/entry/PR:000054033", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054034", "url": "https://proconsortium.org/app/entry/PR:000054034", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054035", "url": "https://proconsortium.org/app/entry/PR:000054035", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054036", "url": "https://proconsortium.org/app/entry/PR:000054036", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054037", "url": "https://proconsortium.org/app/entry/PR:000054037", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054038", "url": "https://proconsortium.org/app/entry/PR:000054038", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054039", "url": "https://proconsortium.org/app/entry/PR:000054039", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054040", "url": "https://proconsortium.org/app/entry/PR:000054040", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054041", "url": "https://proconsortium.org/app/entry/PR:000054041", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054042", "url": "https://proconsortium.org/app/entry/PR:000054042", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054043", "url": "https://proconsortium.org/app/entry/PR:000054043", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054044", "url": "https://proconsortium.org/app/entry/PR:000054044", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054045", "url": "https://proconsortium.org/app/entry/PR:000054045", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054046", "url": "https://proconsortium.org/app/entry/PR:000054046", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054047", "url": "https://proconsortium.org/app/entry/PR:000054047", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054048", "url": "https://proconsortium.org/app/entry/PR:000054048", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054049", "url": "https://proconsortium.org/app/entry/PR:000054049", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054050", "url": "https://proconsortium.org/app/entry/PR:000054050", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054051", "url": "https://proconsortium.org/app/entry/PR:000054051", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054052", "url": "https://proconsortium.org/app/entry/PR:000054052", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054053", "url": "https://proconsortium.org/app/entry/PR:000054053", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054054", "url": "https://proconsortium.org/app/entry/PR:000054054", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054055", "url": "https://proconsortium.org/app/entry/PR:000054055", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054056", "url": "https://proconsortium.org/app/entry/PR:000054056", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054057", "url": "https://proconsortium.org/app/entry/PR:000054057", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054058", "url": "https://proconsortium.org/app/entry/PR:000054058", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054059", "url": "https://proconsortium.org/app/entry/PR:000054059", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054060", "url": "https://proconsortium.org/app/entry/PR:000054060", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054061", "url": "https://proconsortium.org/app/entry/PR:000054061", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054062", "url": "https://proconsortium.org/app/entry/PR:000054062", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054063", "url": "https://proconsortium.org/app/entry/PR:000054063", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054064", "url": "https://proconsortium.org/app/entry/PR:000054064", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054065", "url": "https://proconsortium.org/app/entry/PR:000054065", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054066", "url": "https://proconsortium.org/app/entry/PR:000054066", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054067", "url": "https://proconsortium.org/app/entry/PR:000054067", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054068", "url": "https://proconsortium.org/app/entry/PR:000054068", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054069", "url": "https://proconsortium.org/app/entry/PR:000054069", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054070", "url": "https://proconsortium.org/app/entry/PR:000054070", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054071", "url": "https://proconsortium.org/app/entry/PR:000054071", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054072", "url": "https://proconsortium.org/app/entry/PR:000054072", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054073", "url": "https://proconsortium.org/app/entry/PR:000054073", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054074", "url": "https://proconsortium.org/app/entry/PR:000054074", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054075", "url": "https://proconsortium.org/app/entry/PR:000054075", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054076", "url": "https://proconsortium.org/app/entry/PR:000054076", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054077", "url": "https://proconsortium.org/app/entry/PR:000054077", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054078", "url": "https://proconsortium.org/app/entry/PR:000054078", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054079", "url": "https://proconsortium.org/app/entry/PR:000054079", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054080", "url": "https://proconsortium.org/app/entry/PR:000054080", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054081", "url": "https://proconsortium.org/app/entry/PR:000054081", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054082", "url": "https://proconsortium.org/app/entry/PR:000054082", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054083", "url": "https://proconsortium.org/app/entry/PR:000054083", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054084", "url": "https://proconsortium.org/app/entry/PR:000054084", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054085", "url": "https://proconsortium.org/app/entry/PR:000054085", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054086", "url": "https://proconsortium.org/app/entry/PR:000054086", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054087", "url": "https://proconsortium.org/app/entry/PR:000054087", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054088", "url": "https://proconsortium.org/app/entry/PR:000054088", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054089", "url": "https://proconsortium.org/app/entry/PR:000054089", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054090", "url": "https://proconsortium.org/app/entry/PR:000054090", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054091", "url": "https://proconsortium.org/app/entry/PR:000054091", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054092", "url": "https://proconsortium.org/app/entry/PR:000054092", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054093", "url": "https://proconsortium.org/app/entry/PR:000054093", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054094", "url": "https://proconsortium.org/app/entry/PR:000054094", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054095", "url": "https://proconsortium.org/app/entry/PR:000054095", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054096", "url": "https://proconsortium.org/app/entry/PR:000054096", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054097", "url": "https://proconsortium.org/app/entry/PR:000054097", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054098", "url": "https://proconsortium.org/app/entry/PR:000054098", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054099", "url": "https://proconsortium.org/app/entry/PR:000054099", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054100", "url": "https://proconsortium.org/app/entry/PR:000054100", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054101", "url": "https://proconsortium.org/app/entry/PR:000054101", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054102", "url": "https://proconsortium.org/app/entry/PR:000054102", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054103", "url": "https://proconsortium.org/app/entry/PR:000054103", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054104", "url": "https://proconsortium.org/app/entry/PR:000054104", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054105", "url": "https://proconsortium.org/app/entry/PR:000054105", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054106", "url": "https://proconsortium.org/app/entry/PR:000054106", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054107", "url": "https://proconsortium.org/app/entry/PR:000054107", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054108", "url": "https://proconsortium.org/app/entry/PR:000054108", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054109", "url": "https://proconsortium.org/app/entry/PR:000054109", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054110", "url": "https://proconsortium.org/app/entry/PR:000054110", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054111", "url": "https://proconsortium.org/app/entry/PR:000054111", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054112", "url": "https://proconsortium.org/app/entry/PR:000054112", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054113", "url": "https://proconsortium.org/app/entry/PR:000054113", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054114", "url": "https://proconsortium.org/app/entry/PR:000054114", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054115", "url": "https://proconsortium.org/app/entry/PR:000054115", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054116", "url": "https://proconsortium.org/app/entry/PR:000054116", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054117", "url": "https://proconsortium.org/app/entry/PR:000054117", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054118", "url": "https://proconsortium.org/app/entry/PR:000054118", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054119", "url": "https://proconsortium.org/app/entry/PR:000054119", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054120", "url": "https://proconsortium.org/app/entry/PR:000054120", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054121", "url": "https://proconsortium.org/app/entry/PR:000054121", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054122", "url": "https://proconsortium.org/app/entry/PR:000054122", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054123", "url": "https://proconsortium.org/app/entry/PR:000054123", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054124", "url": "https://proconsortium.org/app/entry/PR:000054124", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054125", "url": "https://proconsortium.org/app/entry/PR:000054125", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054126", "url": "https://proconsortium.org/app/entry/PR:000054126", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054127", "url": "https://proconsortium.org/app/entry/PR:000054127", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054128", "url": "https://proconsortium.org/app/entry/PR:000054128", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054129", "url": "https://proconsortium.org/app/entry/PR:000054129", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054130", "url": "https://proconsortium.org/app/entry/PR:000054130", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054131", "url": "https://proconsortium.org/app/entry/PR:000054131", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054132", "url": "https://proconsortium.org/app/entry/PR:000054132", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054133", "url": "https://proconsortium.org/app/entry/PR:000054133", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054134", "url": "https://proconsortium.org/app/entry/PR:000054134", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054135", "url": "https://proconsortium.org/app/entry/PR:000054135", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054136", "url": "https://proconsortium.org/app/entry/PR:000054136", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054137", "url": "https://proconsortium.org/app/entry/PR:000054137", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054138", "url": "https://proconsortium.org/app/entry/PR:000054138", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054139", "url": "https://proconsortium.org/app/entry/PR:000054139", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054140", "url": "https://proconsortium.org/app/entry/PR:000054140", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054141", "url": "https://proconsortium.org/app/entry/PR:000054141", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054142", "url": "https://proconsortium.org/app/entry/PR:000054142", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054143", "url": "https://proconsortium.org/app/entry/PR:000054143", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054144", "url": "https://proconsortium.org/app/entry/PR:000054144", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054145", "url": "https://proconsortium.org/app/entry/PR:000054145", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054146", "url": "https://proconsortium.org/app/entry/PR:000054146", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054147", "url": "https://proconsortium.org/app/entry/PR:000054147", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054148", "url": "https://proconsortium.org/app/entry/PR:000054148", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054149", "url": "https://proconsortium.org/app/entry/PR:000054149", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054150", "url": "https://proconsortium.org/app/entry/PR:000054150", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054151", "url": "https://proconsortium.org/app/entry/PR:000054151", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054152", "url": "https://proconsortium.org/app/entry/PR:000054152", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054153", "url": "https://proconsortium.org/app/entry/PR:000054153", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054154", "url": "https://proconsortium.org/app/entry/PR:000054154", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054155", "url": "https://proconsortium.org/app/entry/PR:000054155", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054156", "url": "https://proconsortium.org/app/entry/PR:000054156", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054157", "url": "https://proconsortium.org/app/entry/PR:000054157", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054158", "url": "https://proconsortium.org/app/entry/PR:000054158", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054159", "url": "https://proconsortium.org/app/entry/PR:000054159", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054160", "url": "https://proconsortium.org/app/entry/PR:000054160", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054161", "url": "https://proconsortium.org/app/entry/PR:000054161", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054162", "url": "https://proconsortium.org/app/entry/PR:000054162", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054163", "url": "https://proconsortium.org/app/entry/PR:000054163", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054164", "url": "https://proconsortium.org/app/entry/PR:000054164", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054165", "url": "https://proconsortium.org/app/entry/PR:000054165", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054166", "url": "https://proconsortium.org/app/entry/PR:000054166", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054167", "url": "https://proconsortium.org/app/entry/PR:000054167", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054168", "url": "https://proconsortium.org/app/entry/PR:000054168", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054169", "url": "https://proconsortium.org/app/entry/PR:000054169", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054170", "url": "https://proconsortium.org/app/entry/PR:000054170", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054171", "url": "https://proconsortium.org/app/entry/PR:000054171", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054172", "url": "https://proconsortium.org/app/entry/PR:000054172", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054173", "url": "https://proconsortium.org/app/entry/PR:000054173", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054174", "url": "https://proconsortium.org/app/entry/PR:000054174", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054175", "url": "https://proconsortium.org/app/entry/PR:000054175", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054176", "url": "https://proconsortium.org/app/entry/PR:000054176", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054177", "url": "https://proconsortium.org/app/entry/PR:000054177", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054178", "url": "https://proconsortium.org/app/entry/PR:000054178", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054179", "url": "https://proconsortium.org/app/entry/PR:000054179", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054180", "url": "https://proconsortium.org/app/entry/PR:000054180", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054181", "url": "https://proconsortium.org/app/entry/PR:000054181", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054182", "url": "https://proconsortium.org/app/entry/PR:000054182", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054183", "url": "https://proconsortium.org/app/entry/PR:000054183", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054184", "url": "https://proconsortium.org/app/entry/PR:000054184", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054185", "url": "https://proconsortium.org/app/entry/PR:000054185", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054186", "url": "https://proconsortium.org/app/entry/PR:000054186", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054187", "url": "https://proconsortium.org/app/entry/PR:000054187", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054188", "url": "https://proconsortium.org/app/entry/PR:000054188", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054189", "url": "https://proconsortium.org/app/entry/PR:000054189", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054190", "url": "https://proconsortium.org/app/entry/PR:000054190", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054191", "url": "https://proconsortium.org/app/entry/PR:000054191", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054192", "url": "https://proconsortium.org/app/entry/PR:000054192", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054193", "url": "https://proconsortium.org/app/entry/PR:000054193", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054194", "url": "https://proconsortium.org/app/entry/PR:000054194", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054195", "url": "https://proconsortium.org/app/entry/PR:000054195", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054196", "url": "https://proconsortium.org/app/entry/PR:000054196", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054197", "url": "https://proconsortium.org/app/entry/PR:000054197", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054198", "url": "https://proconsortium.org/app/entry/PR:000054198", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054199", "url": "https://proconsortium.org/app/entry/PR:000054199", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054200", "url": "https://proconsortium.org/app/entry/PR:000054200", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054201", "url": "https://proconsortium.org/app/entry/PR:000054201", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054202", "url": "https://proconsortium.org/app/entry/PR:000054202", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054203", "url": "https://proconsortium.org/app/entry/PR:000054203", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054204", "url": "https://proconsortium.org/app/entry/PR:000054204", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054205", "url": "https://proconsortium.org/app/entry/PR:000054205", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054206", "url": "https://proconsortium.org/app/entry/PR:000054206", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054207", "url": "https://proconsortium.org/app/entry/PR:000054207", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054208", "url": "https://proconsortium.org/app/entry/PR:000054208", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054209", "url": "https://proconsortium.org/app/entry/PR:000054209", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054210", "url": "https://proconsortium.org/app/entry/PR:000054210", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054211", "url": "https://proconsortium.org/app/entry/PR:000054211", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054212", "url": "https://proconsortium.org/app/entry/PR:000054212", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054213", "url": "https://proconsortium.org/app/entry/PR:000054213", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054214", "url": "https://proconsortium.org/app/entry/PR:000054214", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054215", "url": "https://proconsortium.org/app/entry/PR:000054215", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054216", "url": "https://proconsortium.org/app/entry/PR:000054216", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054217", "url": "https://proconsortium.org/app/entry/PR:000054217", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054218", "url": "https://proconsortium.org/app/entry/PR:000054218", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054219", "url": "https://proconsortium.org/app/entry/PR:000054219", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054220", "url": "https://proconsortium.org/app/entry/PR:000054220", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054221", "url": "https://proconsortium.org/app/entry/PR:000054221", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054222", "url": "https://proconsortium.org/app/entry/PR:000054222", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054223", "url": "https://proconsortium.org/app/entry/PR:000054223", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054224", "url": "https://proconsortium.org/app/entry/PR:000054224", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054225", "url": "https://proconsortium.org/app/entry/PR:000054225", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054226", "url": "https://proconsortium.org/app/entry/PR:000054226", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054227", "url": "https://proconsortium.org/app/entry/PR:000054227", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054228", "url": "https://proconsortium.org/app/entry/PR:000054228", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054229", "url": "https://proconsortium.org/app/entry/PR:000054229", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054230", "url": "https://proconsortium.org/app/entry/PR:000054230", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054231", "url": "https://proconsortium.org/app/entry/PR:000054231", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054232", "url": "https://proconsortium.org/app/entry/PR:000054232", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054233", "url": "https://proconsortium.org/app/entry/PR:000054233", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054234", "url": "https://proconsortium.org/app/entry/PR:000054234", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054235", "url": "https://proconsortium.org/app/entry/PR:000054235", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054236", "url": "https://proconsortium.org/app/entry/PR:000054236", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054237", "url": "https://proconsortium.org/app/entry/PR:000054237", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054238", "url": "https://proconsortium.org/app/entry/PR:000054238", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054239", "url": "https://proconsortium.org/app/entry/PR:000054239", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054240", "url": "https://proconsortium.org/app/entry/PR:000054240", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054241", "url": "https://proconsortium.org/app/entry/PR:000054241", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054242", "url": "https://proconsortium.org/app/entry/PR:000054242", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054243", "url": "https://proconsortium.org/app/entry/PR:000054243", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054244", "url": "https://proconsortium.org/app/entry/PR:000054244", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054245", "url": "https://proconsortium.org/app/entry/PR:000054245", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054246", "url": "https://proconsortium.org/app/entry/PR:000054246", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054247", "url": "https://proconsortium.org/app/entry/PR:000054247", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054248", "url": "https://proconsortium.org/app/entry/PR:000054248", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054249", "url": "https://proconsortium.org/app/entry/PR:000054249", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054250", "url": "https://proconsortium.org/app/entry/PR:000054250", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054251", "url": "https://proconsortium.org/app/entry/PR:000054251", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054252", "url": "https://proconsortium.org/app/entry/PR:000054252", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054253", "url": "https://proconsortium.org/app/entry/PR:000054253", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054254", "url": "https://proconsortium.org/app/entry/PR:000054254", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054255", "url": "https://proconsortium.org/app/entry/PR:000054255", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054256", "url": "https://proconsortium.org/app/entry/PR:000054256", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054257", "url": "https://proconsortium.org/app/entry/PR:000054257", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054258", "url": "https://proconsortium.org/app/entry/PR:000054258", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054259", "url": "https://proconsortium.org/app/entry/PR:000054259", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054260", "url": "https://proconsortium.org/app/entry/PR:000054260", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054261", "url": "https://proconsortium.org/app/entry/PR:000054261", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054262", "url": "https://proconsortium.org/app/entry/PR:000054262", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054263", "url": "https://proconsortium.org/app/entry/PR:000054263", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054264", "url": "https://proconsortium.org/app/entry/PR:000054264", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054265", "url": "https://proconsortium.org/app/entry/PR:000054265", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054266", "url": "https://proconsortium.org/app/entry/PR:000054266", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054267", "url": "https://proconsortium.org/app/entry/PR:000054267", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054268", "url": "https://proconsortium.org/app/entry/PR:000054268", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054269", "url": "https://proconsortium.org/app/entry/PR:000054269", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054270", "url": "https://proconsortium.org/app/entry/PR:000054270", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054271", "url": "https://proconsortium.org/app/entry/PR:000054271", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054272", "url": "https://proconsortium.org/app/entry/PR:000054272", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054273", "url": "https://proconsortium.org/app/entry/PR:000054273", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054274", "url": "https://proconsortium.org/app/entry/PR:000054274", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054275", "url": "https://proconsortium.org/app/entry/PR:000054275", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054276", "url": "https://proconsortium.org/app/entry/PR:000054276", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054277", "url": "https://proconsortium.org/app/entry/PR:000054277", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054278", "url": "https://proconsortium.org/app/entry/PR:000054278", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054279", "url": "https://proconsortium.org/app/entry/PR:000054279", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054280", "url": "https://proconsortium.org/app/entry/PR:000054280", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054281", "url": "https://proconsortium.org/app/entry/PR:000054281", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054282", "url": "https://proconsortium.org/app/entry/PR:000054282", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054283", "url": "https://proconsortium.org/app/entry/PR:000054283", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054284", "url": "https://proconsortium.org/app/entry/PR:000054284", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054285", "url": "https://proconsortium.org/app/entry/PR:000054285", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054286", "url": "https://proconsortium.org/app/entry/PR:000054286", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054287", "url": "https://proconsortium.org/app/entry/PR:000054287", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054288", "url": "https://proconsortium.org/app/entry/PR:000054288", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054289", "url": "https://proconsortium.org/app/entry/PR:000054289", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054290", "url": "https://proconsortium.org/app/entry/PR:000054290", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054291", "url": "https://proconsortium.org/app/entry/PR:000054291", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054292", "url": "https://proconsortium.org/app/entry/PR:000054292", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054293", "url": "https://proconsortium.org/app/entry/PR:000054293", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054294", "url": "https://proconsortium.org/app/entry/PR:000054294", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054295", "url": "https://proconsortium.org/app/entry/PR:000054295", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054296", "url": "https://proconsortium.org/app/entry/PR:000054296", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054297", "url": "https://proconsortium.org/app/entry/PR:000054297", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054298", "url": "https://proconsortium.org/app/entry/PR:000054298", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054299", "url": "https://proconsortium.org/app/entry/PR:000054299", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054300", "url": "https://proconsortium.org/app/entry/PR:000054300", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054301", "url": "https://proconsortium.org/app/entry/PR:000054301", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054302", "url": "https://proconsortium.org/app/entry/PR:000054302", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054303", "url": "https://proconsortium.org/app/entry/PR:000054303", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054304", "url": "https://proconsortium.org/app/entry/PR:000054304", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054305", "url": "https://proconsortium.org/app/entry/PR:000054305", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054306", "url": "https://proconsortium.org/app/entry/PR:000054306", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054307", "url": "https://proconsortium.org/app/entry/PR:000054307", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054308", "url": "https://proconsortium.org/app/entry/PR:000054308", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054309", "url": "https://proconsortium.org/app/entry/PR:000054309", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054310", "url": "https://proconsortium.org/app/entry/PR:000054310", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054311", "url": "https://proconsortium.org/app/entry/PR:000054311", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054312", "url": "https://proconsortium.org/app/entry/PR:000054312", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054313", "url": "https://proconsortium.org/app/entry/PR:000054313", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054314", "url": "https://proconsortium.org/app/entry/PR:000054314", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054315", "url": "https://proconsortium.org/app/entry/PR:000054315", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054316", "url": "https://proconsortium.org/app/entry/PR:000054316", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054317", "url": "https://proconsortium.org/app/entry/PR:000054317", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054318", "url": "https://proconsortium.org/app/entry/PR:000054318", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054319", "url": "https://proconsortium.org/app/entry/PR:000054319", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054320", "url": "https://proconsortium.org/app/entry/PR:000054320", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054321", "url": "https://proconsortium.org/app/entry/PR:000054321", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054322", "url": "https://proconsortium.org/app/entry/PR:000054322", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054323", "url": "https://proconsortium.org/app/entry/PR:000054323", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054324", "url": "https://proconsortium.org/app/entry/PR:000054324", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054325", "url": "https://proconsortium.org/app/entry/PR:000054325", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054326", "url": "https://proconsortium.org/app/entry/PR:000054326", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054327", "url": "https://proconsortium.org/app/entry/PR:000054327", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054328", "url": "https://proconsortium.org/app/entry/PR:000054328", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054329", "url": "https://proconsortium.org/app/entry/PR:000054329", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054330", "url": "https://proconsortium.org/app/entry/PR:000054330", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054331", "url": "https://proconsortium.org/app/entry/PR:000054331", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054332", "url": "https://proconsortium.org/app/entry/PR:000054332", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054333", "url": "https://proconsortium.org/app/entry/PR:000054333", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054334", "url": "https://proconsortium.org/app/entry/PR:000054334", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054335", "url": "https://proconsortium.org/app/entry/PR:000054335", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054336", "url": "https://proconsortium.org/app/entry/PR:000054336", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054337", "url": "https://proconsortium.org/app/entry/PR:000054337", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054338", "url": "https://proconsortium.org/app/entry/PR:000054338", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054339", "url": "https://proconsortium.org/app/entry/PR:000054339", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054340", "url": "https://proconsortium.org/app/entry/PR:000054340", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054341", "url": "https://proconsortium.org/app/entry/PR:000054341", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054342", "url": "https://proconsortium.org/app/entry/PR:000054342", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054343", "url": "https://proconsortium.org/app/entry/PR:000054343", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054344", "url": "https://proconsortium.org/app/entry/PR:000054344", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054345", "url": "https://proconsortium.org/app/entry/PR:000054345", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054346", "url": "https://proconsortium.org/app/entry/PR:000054346", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054347", "url": "https://proconsortium.org/app/entry/PR:000054347", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054348", "url": "https://proconsortium.org/app/entry/PR:000054348", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054349", "url": "https://proconsortium.org/app/entry/PR:000054349", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054350", "url": "https://proconsortium.org/app/entry/PR:000054350", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054351", "url": "https://proconsortium.org/app/entry/PR:000054351", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054352", "url": "https://proconsortium.org/app/entry/PR:000054352", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054353", "url": "https://proconsortium.org/app/entry/PR:000054353", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054354", "url": "https://proconsortium.org/app/entry/PR:000054354", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054355", "url": "https://proconsortium.org/app/entry/PR:000054355", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054356", "url": "https://proconsortium.org/app/entry/PR:000054356", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054357", "url": "https://proconsortium.org/app/entry/PR:000054357", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054358", "url": "https://proconsortium.org/app/entry/PR:000054358", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054359", "url": "https://proconsortium.org/app/entry/PR:000054359", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054360", "url": "https://proconsortium.org/app/entry/PR:000054360", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054361", "url": "https://proconsortium.org/app/entry/PR:000054361", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054362", "url": "https://proconsortium.org/app/entry/PR:000054362", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054363", "url": "https://proconsortium.org/app/entry/PR:000054363", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054364", "url": "https://proconsortium.org/app/entry/PR:000054364", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054365", "url": "https://proconsortium.org/app/entry/PR:000054365", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054366", "url": "https://proconsortium.org/app/entry/PR:000054366", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054367", "url": "https://proconsortium.org/app/entry/PR:000054367", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054368", "url": "https://proconsortium.org/app/entry/PR:000054368", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054369", "url": "https://proconsortium.org/app/entry/PR:000054369", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054370", "url": "https://proconsortium.org/app/entry/PR:000054370", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054371", "url": "https://proconsortium.org/app/entry/PR:000054371", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054372", "url": "https://proconsortium.org/app/entry/PR:000054372", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054373", "url": "https://proconsortium.org/app/entry/PR:000054373", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054374", "url": "https://proconsortium.org/app/entry/PR:000054374", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054375", "url": "https://proconsortium.org/app/entry/PR:000054375", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054376", "url": "https://proconsortium.org/app/entry/PR:000054376", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054377", "url": "https://proconsortium.org/app/entry/PR:000054377", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054378", "url": "https://proconsortium.org/app/entry/PR:000054378", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054379", "url": "https://proconsortium.org/app/entry/PR:000054379", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054380", "url": "https://proconsortium.org/app/entry/PR:000054380", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054381", "url": "https://proconsortium.org/app/entry/PR:000054381", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054382", "url": "https://proconsortium.org/app/entry/PR:000054382", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054383", "url": "https://proconsortium.org/app/entry/PR:000054383", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054384", "url": "https://proconsortium.org/app/entry/PR:000054384", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054385", "url": "https://proconsortium.org/app/entry/PR:000054385", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054386", "url": "https://proconsortium.org/app/entry/PR:000054386", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054387", "url": "https://proconsortium.org/app/entry/PR:000054387", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054388", "url": "https://proconsortium.org/app/entry/PR:000054388", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054389", "url": "https://proconsortium.org/app/entry/PR:000054389", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054390", "url": "https://proconsortium.org/app/entry/PR:000054390", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054391", "url": "https://proconsortium.org/app/entry/PR:000054391", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054392", "url": "https://proconsortium.org/app/entry/PR:000054392", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054393", "url": "https://proconsortium.org/app/entry/PR:000054393", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054394", "url": "https://proconsortium.org/app/entry/PR:000054394", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054395", "url": "https://proconsortium.org/app/entry/PR:000054395", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054396", "url": "https://proconsortium.org/app/entry/PR:000054396", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054397", "url": "https://proconsortium.org/app/entry/PR:000054397", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054398", "url": "https://proconsortium.org/app/entry/PR:000054398", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054399", "url": "https://proconsortium.org/app/entry/PR:000054399", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054400", "url": "https://proconsortium.org/app/entry/PR:000054400", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054401", "url": "https://proconsortium.org/app/entry/PR:000054401", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054402", "url": "https://proconsortium.org/app/entry/PR:000054402", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054403", "url": "https://proconsortium.org/app/entry/PR:000054403", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054404", "url": "https://proconsortium.org/app/entry/PR:000054404", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054405", "url": "https://proconsortium.org/app/entry/PR:000054405", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054406", "url": "https://proconsortium.org/app/entry/PR:000054406", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054407", "url": "https://proconsortium.org/app/entry/PR:000054407", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054408", "url": "https://proconsortium.org/app/entry/PR:000054408", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054409", "url": "https://proconsortium.org/app/entry/PR:000054409", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054410", "url": "https://proconsortium.org/app/entry/PR:000054410", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054411", "url": "https://proconsortium.org/app/entry/PR:000054411", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054412", "url": "https://proconsortium.org/app/entry/PR:000054412", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P07911", "url": "http://purl.obolibrary.org/obo/PR_P07911", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-446203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001008390", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008390", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P07911", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "I3L1M3", "url": "https://www.uniprot.org/uniprot/I3L1M3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L1M3-1", "url": "https://www.uniprot.org/uniprot/I3L1M3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L2J2", "url": "https://www.uniprot.org/uniprot/I3L2J2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L2J2-1", "url": "https://www.uniprot.org/uniprot/I3L2J2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L2K2", "url": "https://www.uniprot.org/uniprot/I3L2K2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L2K2-1", "url": "https://www.uniprot.org/uniprot/I3L2K2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L3E0", "url": "https://www.uniprot.org/uniprot/I3L3E0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L3E0-1", "url": "https://www.uniprot.org/uniprot/I3L3E0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L3Z4", "url": "https://www.uniprot.org/uniprot/I3L3Z4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L3Z4-1", "url": "https://www.uniprot.org/uniprot/I3L3Z4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L4B0", "url": "https://www.uniprot.org/uniprot/I3L4B0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L4B0-1", "url": "https://www.uniprot.org/uniprot/I3L4B0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L4Y6", "url": "https://www.uniprot.org/uniprot/I3L4Y6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L4Y6-1", "url": "https://www.uniprot.org/uniprot/I3L4Y6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07911-1", "url": "https://www.uniprot.org/uniprot/P07911-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07911-2", "url": "https://www.uniprot.org/uniprot/P07911-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07911-3", "url": "https://www.uniprot.org/uniprot/P07911-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07911-4", "url": "https://www.uniprot.org/uniprot/P07911-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07911-5", "url": "https://www.uniprot.org/uniprot/P07911-5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8NHW8", "url": "https://www.uniprot.org/uniprot/Q8NHW8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8NHW8-1", "url": "https://www.uniprot.org/uniprot/Q8NHW8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "X6RBG4", "url": "https://www.uniprot.org/uniprot/X6RBG4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "X6RBG4-1", "url": "https://www.uniprot.org/uniprot/X6RBG4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGQPSLTWMLMVVVASWFITTAATDTSEARWCSECHSNATCTEDEAVTTCTCQEGFTGDGLTCVDLDECAIPGAHNCSANSSCVNTPGSFSCVCPEGFRLSPGLGCTDVDECAEPGLSHCHALATCVNVVGSYLCVCPAGYRGDGWHCECSPGSCGPGLDCVPEGDALVCADPCQAHRTLDEYWRSTEYGEGYACDTDLRGWYRFVGQGGARMAETCVPVLRCNTAAPMWLNGTHPSSDEGIVSRKACAHWSGHCCLWDASVQVKACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGRWHCQCKQDFNITDISLLEHRLECGANDMKVSLGKCQLKSLGFDKVFMYLSDSRCSGFNDRDNRDWVSVVTPARDGPCGTVLTRNETHATYSNTLYLADEIIIRDLNIKINFACSYPLDMKVSLKTALQPMVSALNIRVGGTGMFTVRMALFQTPSYTQPYQGSSVTLSTEAFLYVGTMLDGGDLSRFALLMTNCYATPSSNATDPLKYFIIQDRCPHTRDSTIQVVENGESSQGRFSVQMFRFAGNYDLVYLHCEVYLCDTMNEKCKPTCSGTRFRSGSVIDQSRVLNLGPITRKGVQATVSRAFSSLGLLKVWLPLLLSATLTLTFQ", "length": 640, "header": "sp|P07911-1|UROM_HUMAN Isoform 1 of Uromodulin OS=Homo sapiens OX=9606 GN=UMOD PE=1 SV=1 CANONICAL=P07911-1" }, "isoforms": [ { "isoform_ac": "I3L1M3-1", "url": "", "sequence": { "sequence": "MGQPSLTWMLMVVVASWFITTAATDTSEARWCSECHSNATCTEDEAVTTCTCQEGFTGDGLTCVDLDECAIPGAHNCSANSSCVNTPGSFSCVCPEGFRLSPGLGCTDVDECAEPGLSHCHALAT", "length": 125, "header": "tr|I3L1M3-1|UROM_HUMAN Computationally mapped isoform of Uromodulin OS=Homo sapiens OX=9606 GN=UMOD PE=1 SV=1 CANONICAL=P07911-1" }, "locus": { "chromosome": "16", "start_pos": 20350737, "end_pos": 20348926, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000571174.5", "url": "https://www.ensembl.org/id/ENST00000571174.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000458939.1", "url": "https://www.ensembl.org/id/ENSP00000458939.1" } ] } }, { "isoform_ac": "I3L2J2-1", "url": "", "sequence": { "sequence": "MGQPSLTWMLMVVVASWFITTAATDTSEARWCSECHSNATCTEDEAVTTCTCQEGFTGDGLTCVDLDECAIPGAHNCSANSSCVNTPG", "length": 88, "header": "tr|I3L2J2-1|I3L2J2_HUMAN Computationally mapped isoform of Uromodulin OS=Homo sapiens OX=9606 GN=UMOD PE=4 SV=1 CANONICAL=P07911-1" }, "locus": { "chromosome": "16", "start_pos": 20350737, "end_pos": 20349037, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000570757.5", "url": "https://www.ensembl.org/id/ENST00000570757.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000459724.1", "url": "https://www.ensembl.org/id/ENSP00000459724.1" } ] } }, { "isoform_ac": "I3L2K2-1", "url": "", "sequence": { "sequence": "MGQPSLTWMLMVVVASWFITTAATDTSEARWCSECHSNATCTEDEAVTTCTCQEGFTGDGLTCVDLDECAIPGAHNCSANSSCVNTPGSFSCVCPEGFRLSPGLGCTDVD", "length": 110, "header": "tr|I3L2K2-1|I3L2K2_HUMAN Computationally mapped isoform of Uromodulin OS=Homo sapiens OX=9606 GN=UMOD PE=4 SV=2 CANONICAL=P07911-1" }, "locus": { "chromosome": "16", "start_pos": 20350737, "end_pos": 20348971, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000577168.2", "url": "https://www.ensembl.org/id/ENST00000577168.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000459738.2", "url": "https://www.ensembl.org/id/ENSP00000459738.2" } ] } }, { "isoform_ac": "I3L3E0-1", "url": "", "sequence": { "sequence": "MGQPSLTWMLMVVVASWFITTAATDTSEARTKYNCPARWSWRTPQRGGDTEQGWCSECHSNATCTEDEAVTTCTCQEGFTGDGLTCVDLDECAIPGAHNCSANSSCVNTPGSFSCVCPEGFRLSPGLGCTDVDECAEPGLSHCHALATCVNVVGSYLCVCP", "length": 161, "header": "tr|I3L3E0-1|I3L3E0_HUMAN Computationally mapped isoform of Uromodulin OS=Homo sapiens OX=9606 GN=UMOD PE=1 SV=1 CANONICAL=P07911-1" }, "locus": { "chromosome": "16", "start_pos": 20350737, "end_pos": 20348887, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000573567.5", "url": "https://www.ensembl.org/id/ENST00000573567.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000460374.1", "url": "https://www.ensembl.org/id/ENSP00000460374.1" } ] } }, { "isoform_ac": "I3L3Z4-1", "url": "", "sequence": { "sequence": "MGQPSLTWMLMVVVASWFITTAATDTSEARTKYNCPARWSWRTPQRGGDTEQGPDEDFTSQGSRKHKMCKEREGQQVHRKSYQRWCSECHSNATCTEDEAVTTCTCQEGFTGDGLTCVDLDECAIPGAHNCSANSSCVNTPGSFSCVCPEGFRLSPGLGCT", "length": 161, "header": "tr|I3L3Z4-1|I3L3Z4_HUMAN Computationally mapped isoform of Uromodulin OS=Homo sapiens OX=9606 GN=UMOD PE=4 SV=1 CANONICAL=P07911-1" }, "locus": { "chromosome": "16", "start_pos": 20350737, "end_pos": 20348980, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000574195.5", "url": "https://www.ensembl.org/id/ENST00000574195.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000460845.1", "url": "https://www.ensembl.org/id/ENSP00000460845.1" } ] } }, { "isoform_ac": "I3L4B0-1", "url": "", "sequence": { "sequence": "MGQPSLTWMLMVVVASWFITTAATDTSEARWCSECHSNATCTEDEAVTTCTCQEGFTGDGLTCVDLDECAIPGAHNCSANSSCVNT", "length": 86, "header": "tr|I3L4B0-1|I3L4B0_HUMAN Computationally mapped isoform of Uromodulin OS=Homo sapiens OX=9606 GN=UMOD PE=4 SV=1 CANONICAL=P07911-1" }, "locus": { "chromosome": "16", "start_pos": 20350737, "end_pos": 20349043, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000576546.1", "url": "https://www.ensembl.org/id/ENST00000576546.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000461120.1", "url": "https://www.ensembl.org/id/ENSP00000461120.1" } ] } }, { "isoform_ac": "I3L4Y6-1", "url": "", "sequence": { "sequence": "MGQPSLTWMLMVVVASWFITTAATDTSEARWCSECHSNATCTEDEAVTTCTCQEGFTGDGLTCVDLDECAIPGAHNCSANSSCVNTPGSFSCVCPEGFRLSP", "length": 102, "header": "tr|I3L4Y6-1|I3L4Y6_HUMAN Computationally mapped isoform of Uromodulin OS=Homo sapiens OX=9606 GN=UMOD PE=4 SV=8 CANONICAL=P07911-1" }, "locus": { "chromosome": "16", "start_pos": 20350737, "end_pos": 20348995, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000576688.2", "url": "https://www.ensembl.org/id/ENST00000576688.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000461641.1", "url": "https://www.ensembl.org/id/ENSP00000461641.1" } ] } }, { "isoform_ac": "P07911-1", "url": "", "sequence": { "sequence": "MGQPSLTWMLMVVVASWFITTAATDTSEARWCSECHSNATCTEDEAVTTCTCQEGFTGDGLTCVDLDECAIPGAHNCSANSSCVNTPGSFSCVCPEGFRLSPGLGCTDVDECAEPGLSHCHALATCVNVVGSYLCVCPAGYRGDGWHCECSPGSCGPGLDCVPEGDALVCADPCQAHRTLDEYWRSTEYGEGYACDTDLRGWYRFVGQGGARMAETCVPVLRCNTAAPMWLNGTHPSSDEGIVSRKACAHWSGHCCLWDASVQVKACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGRWHCQCKQDFNITDISLLEHRLECGANDMKVSLGKCQLKSLGFDKVFMYLSDSRCSGFNDRDNRDWVSVVTPARDGPCGTVLTRNETHATYSNTLYLADEIIIRDLNIKINFACSYPLDMKVSLKTALQPMVSALNIRVGGTGMFTVRMALFQTPSYTQPYQGSSVTLSTEAFLYVGTMLDGGDLSRFALLMTNCYATPSSNATDPLKYFIIQDRCPHTRDSTIQVVENGESSQGRFSVQMFRFAGNYDLVYLHCEVYLCDTMNEKCKPTCSGTRFRSGSVIDQSRVLNLGPITRKGVQATVSRAFSSLGLLKVWLPLLLSATLTLTFQ", "length": 640, "header": "sp|P07911-1|UROM_HUMAN Isoform 1 of Uromodulin OS=Homo sapiens OX=9606 GN=UMOD PE=1 SV=1 CANONICAL=P07911-1" }, "locus": { "chromosome": "16", "start_pos": 20350737, "end_pos": 20333317, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000570689.5", "url": "https://www.ensembl.org/id/ENST00000570689.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000460548.1", "url": "https://www.ensembl.org/id/ENSP00000460548.1" } ] } }, { "isoform_ac": "P07911-2", "url": "", "sequence": { "sequence": "MGQPSLTWMLMVVVASWFITTAATDTSEARWCSECHSNATCTEDEAVTTCTCQEGFTGDGLTCVDLRGWYRFVGQGGARMAETCVPVLRCNTAAPMWLNGTHPSSDEGIVSRKACAHWSGHCCLWDASVQVKACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGRWHCQCKQDFNITDISLLEHRLECGANDMKVSLGKCQLKSLGFDKVFMYLSDSRCSGFNDRDNRDWVSVVTPARDGPCGTVLTRNETHATYSNTLYLADEIIIRDLNIKINFACSYPLDMKVSLKTALQPMVSALNIRVGGTGMFTVRMALFQTPSYTQPYQGSSVTLSTEAFLYVGTMLDGGDLSRFALLMTNCYATPSSNATDPLKYFIIQDRCPHTRDSTIQVVENGESSQGRFSVQMFRFAGNYDLVYLHCEVYLCDTMNEKCKPTCSGTRFRSGSVIDQSRVLNLGPITRKGVQATVSRAFSSLGLLKVWLPLLLSATLTLTFQ", "length": 507, "header": "sp|P07911-2|UROM_HUMAN Isoform 2 of Uromodulin OS=Homo sapiens OX=9606 GN=UMOD PE=1 SV=1 CANONICAL=P07911-1" }, "locus": {} }, { "isoform_ac": "P07911-3", "url": "", "sequence": { "sequence": "MGQPSLTWMLMVVVASWFITTAATDTSEARWCSECHSNATCTEDEAVTTCTCQEGFTGDGLTCVDLDECAIPGAHNCSANSSCVNTPGSFSCVCPEGFRLSPGLGCTDVDECAEPGLSHCHALATCVNVVGSYLCVCPAGYRGDGWHCECSPGSCGPGLDCVPEGDALVCADPCQAHRTLDEYWRSTEYGEGYACDTDLRGWYRPHPSSDEGIVSRKACAHWSGHCCLWDASVQVKACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGRWHCQCKQDFNITDISLLEHRLECGANDMKVSLGKCQLKSLGFDKVFMYLSDSRCSGFNDRDNRDWVSVVTPARDGPCGTVLTRNETHATYSNTLYLADEIIIRDLNIKINFACSYPLDMKVSLKTALQPMVSALNIRVGGTGMFTVRMALFQTPSYTQPYQGSSVTLSTEAFLYVGTMLDGGDLSRFALLMTNCYATPSSNATDPLKYFIIQDRCPHTRDSTIQVVENGESSQGRFSVQMFRFAGNYDLVYLHCEVYLCDTMNEKCKPTCSGTRFRSGSVIDQSRVLNLGPITRKGVQATVSRAFSSLGLLKVWLPLLLSATLTLTFQ", "length": 611, "header": "sp|P07911-3|UROM_HUMAN Isoform 3 of Uromodulin OS=Homo sapiens OX=9606 GN=UMOD PE=1 SV=1 CANONICAL=P07911-1" }, "locus": {} }, { "isoform_ac": "P07911-4", "url": "", "sequence": { "sequence": "MGQPSLTWMLMVVVASWFITTAATDTSEARWCSECHSNATCTEDEAVTTCTCQEGFTGDGLTCVDLDECAIPGAHNCSANSSCVNTPGSFSCVCPEGFRLSPGLGCTDVDECAEPGLSHCHALATCVNVVGSCGPGLDCVPEGDALVCADPCQAHRTLDEYWRSTEYGEGYACDTDLRGWYRFVGQGGARMAETCVPVLRCNTAAPMWLNGTHPSSDEGIVSRKACAHWSGHCCLWDASVQVKACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGRWHCQCKQDFNITDISLLEHRLECGANDMKVSLGKCQLKSLGFDKVFMYLSDSRCSGFNDRDNRDWVSVVTPARDGPCGTVLTRNETHATYSNTLYLADEIIIRDLNIKINFACSYPLDMKVSLKTALQPMVSALNIRVGGTGMFTVRMALFQTPSYTQPYQGSSVTLSTEAFLYVGTMLDGGDLSRFALLMTNCYATPSSNATDPLKYFIIQDRCPHTRDSTIQVVENGESSQGRFSVQMFRFAGNYDLVYLHCEVYLCDTMNEKCKPTCSGTRFRSGSVIDQSRVLNLGPITRKGVQATVSRAFSSLGLLKVWLPLLLSATLTLTFQ", "length": 618, "header": "sp|P07911-4|UROM_HUMAN Isoform 4 of Uromodulin OS=Homo sapiens OX=9606 GN=UMOD PE=1 SV=1 CANONICAL=P07911-1" }, "locus": {} }, { "isoform_ac": "P07911-5", "url": "", "sequence": { "sequence": "MGQPSLTWMLMVVVASWFITTAATDTSEARTKYNCPARWSWRTPQRGGDTEQGPDEDFTSQGRWCSECHSNATCTEDEAVTTCTCQEGFTGDGLTCVDLDECAIPGAHNCSANSSCVNTPGSFSCVCPEGFRLSPGLGCTDVDECAEPGLSHCHALATCVNVVGSYLCVCPAGYRGDGWHCECSPGSCGPGLDCVPEGDALVCADPCQAHRTLDEYWRSTEYGEGYACDTDLRGWYRFVGQGGARMAETCVPVLRCNTAAPMWLNGTHPSSDEGIVSRKACAHWSGHCCLWDASVQVKACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGRWHCQCKQDFNITDISLLEHRLECGANDMKVSLGKCQLKSLGFDKVFMYLSDSRCSGFNDRDNRDWVSVVTPARDGPCGTVLTRNETHATYSNTLYLADEIIIRDLNIKINFACSYPLDMKVSLKTALQPMVSALNIRVGGTGMFTVRMALFQTPSYTQPYQGSSVTLSTEAFLYVGTMLDGGDLSRFALLMTNCYATPSSNATDPLKYFIIQDRCPHTRDSTIQVVENGESSQGRFSVQMFRFAGNYDLVYLHCEVYLCDTMNEKCKPTCSGTRFRSGSVIDQSRVLNLGPITRKGVQATVSRAFSSLGLLKVWLPLLLSATLTLTFQ", "length": 673, "header": "sp|P07911-5|UROM_HUMAN Isoform 5 of Uromodulin OS=Homo sapiens OX=9606 GN=UMOD PE=1 SV=1 CANONICAL=P07911-1" }, "locus": { "chromosome": "16", "start_pos": 20350737, "end_pos": 20333317, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000396134.6", "url": "https://www.ensembl.org/id/ENST00000396134.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000379438.2", "url": "https://www.ensembl.org/id/ENSP00000379438.2" } ] } }, { "isoform_ac": "Q8NHW8-1", "url": "", "sequence": { "sequence": "MGQPSLTWMLMVVVASWFITTAATDTSEA", "length": 29, "header": "tr|Q8NHW8-1|Q8NHW8_HUMAN Computationally mapped isoform of Uromodulin OS=Homo sapiens OX=9606 GN=UMOD PE=4 SV=1 CANONICAL=P07911-1" }, "locus": { "chromosome": "16", "start_pos": 20350737, "end_pos": 20350651, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000570972.2", "url": "https://www.ensembl.org/id/ENST00000570972.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000458695.2", "url": "https://www.ensembl.org/id/ENSP00000458695.2" } ] } }, { "isoform_ac": "X6RBG4-1", "url": "", "sequence": { "sequence": "MRHIMTRLTLPFWLQDTRHQRQREKFKGPTRLSFGQVLSRPEVAGRAERMGQPSLTWMLMVVVASWFITTAATDTSEARWCSECHSNATCTEDEAVTTCTCQEGFTGDGLTCVDLDECAIPGAHNCSANSSCVNTPGSFSCVCPEGFRLSPGLGCTDVDECAEPGLSHCHALATCVNVVGSYLCVCPAGYRGDGWHCECSPGSCGPGLDCVPEGDALVCADPCQAHRTLDEYWRSTEYGEGYACDTDLRGWYRFVGQGGARMAETCVPVLRCNTAAPMWLNGTHPSSDEGIVSRKACAHWSGHCCLWDASVQVKACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGRWHCQCKQDFNITDISLLEHRLECGANDMKVSLGKCQLKSLGFDKVFMYLSDSRCSGFNDRDNRDWVSVVTPARDGPCGTVLTRNETHATYSNTLYLADEIIIRDLNIKINFACSYPLDMKVSLKTALQPMVSALNIRVGGTGMFTVRMALFQTPSYTQPYQGSSVTLSTEAFLYVGTMLDGGDLSRFALLMTNCYATPSSNATDPLKYFIIQDRCPHTRDSTIQVVENGESSQGRFSVQMFRFAGNYDLVYLHCEVYLCDTMNEKCKPTCSGTRFRSGSVIDQSRVLNLGPITRKGVQATVSRAFSSLGLLKVWLPLLLSATLTLTFQ", "length": 689, "header": "tr|X6RBG4-1|X6RBG4_HUMAN Computationally mapped isoform of Uromodulin OS=Homo sapiens OX=9606 GN=UMOD PE=1 SV=1 CANONICAL=P07911-1" }, "locus": { "chromosome": "16", "start_pos": 20350737, "end_pos": 20333317, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000396138", "url": "https://www.ensembl.org/id/ENST00000396138" }, { "database": "Ensembl Peptide", "id": "ENSP00000379442", "url": "https://www.ensembl.org/id/ENSP00000379442" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G60554YG", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 154, "start_aa": "Ser", "end_pos": 154, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser154", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 225, "start_aa": "Thr", "end_pos": 225, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr225", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G03895SR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G09118YK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G11041DA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G11671GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G12222NC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G12793SR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G14047PA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G16774YZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G17540HT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G17689DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G19469VZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G19603RR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G23345GE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G24413UY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G26403SG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G26935KA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G29676WX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G31532GK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G31685JQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G32659RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G33241WC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G38022PE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G39595FH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G40554DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G41882MT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G41981MA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G43669FQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "22171320", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22171320" } ] }, { "glytoucan_ac": "G44305KR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G45560HM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G46185ND", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G46665ZP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G46902YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G47007PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "22171320", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22171320" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G47975JA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G48584BU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G49305IN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G50427EO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G51098AA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G52676LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G53752TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G54018RP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G56318NV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G56499YQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G57565TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G57835AK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G57955DP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G60227QI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G60439QY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G65449BO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G66088HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G67173FM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G68668TB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G68873DS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G69170UT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G69834CE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G71906BW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G72735IY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G75120WS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G75607BQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G76294TY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G77252PU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G78030KJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G79565XA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G80319WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G80966KZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G81198YO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G82811EP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G82894XV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G90542MP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G90987JA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G91365ZQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G91413ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G91473PK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G92681HQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G92974UU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G93656SY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G94047VH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G94531EZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G94876HV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G95977AE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G96921ZU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G99808VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "P07911", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07911#ptm_processing" }, { "id": "26811476", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26811476" }, { "id": "32616672", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32616672" }, { "id": "22171320", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22171320" }, { "id": "7Q3N", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/7Q3N" }, { "id": "7PFP", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/7PFP" }, { "id": "35273390", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35273390" } ] }, { "glytoucan_ac": "G60145BJ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 252, "start_aa": "Ser", "end_pos": 252, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser252", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G00433UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G03895SR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G09118YK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G11041DA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G11671GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G12222NC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G14047PA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G14456RI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G16774YZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G17540HT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G17689DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G19469VZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G22355FZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G23345GE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G24413UY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G26935KA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G29676WX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G31532GK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G32659RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G33241WC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G35697OJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G38022PE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G40554DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G41981MA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G45560HM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G46185ND", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G47007PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G47975JA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G49305IN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G49874UX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G51098AA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G52676LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G53752TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G54018RP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G55220VL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "ASN-275 ; ASN-275", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ] }, { "glytoucan_ac": "G56318NV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G56499YQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G57565TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G57835AK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G57955DP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G60227QI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G60439QY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G65092SV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G65449BO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G66538GV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G67173FM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G68668TB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "ASN-275 ; ASN-275", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ] }, { "glytoucan_ac": "G69170UT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G71906BW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G72735IY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G74430RZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G75120WS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G76294TY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G76329HL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G77252PU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G78030KJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G79565XA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G80319WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G80966KZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: ASN-275", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ] }, { "glytoucan_ac": "G82811EP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G82894XV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G90542MP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G90987JA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G91365ZQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G91413ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G92681HQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G92974UU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: ASN-275", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ] }, { "glytoucan_ac": "G93683YO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G94047VH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G94531EZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G94876HV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G96921ZU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G99808VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "P07911", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07911#ptm_processing" }, { "id": "32616672", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32616672" }, { "id": "7Q3N", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/7Q3N" }, { "id": "7PFP", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/7PFP" }, { "id": "35273390", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35273390" } ] }, { "glytoucan_ac": "G49874UX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 277, "start_aa": "Thr", "end_pos": 277, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr277", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G22355FZ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 292, "start_aa": "Ser", "end_pos": 292, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser292", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G22625SJ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 296, "start_aa": "Thr", "end_pos": 296, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr296", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G49874UX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 296, "start_aa": "Thr", "end_pos": 296, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr296", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G60145BJ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 296, "start_aa": "Thr", "end_pos": 296, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr296", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G03895SR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G05813WO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G09118YK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G11041DA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G11611PG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G11671GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G12222NC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G14047PA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G16774YZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G17540HT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G17689DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G19469VZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G23345GE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G23811SR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G24413UY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G26935KA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G27322BI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G29676WX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G29972TM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G31532GK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G32659RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G33241WC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G34617SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G35697OJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G37773JL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G37881RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G38022PE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G39595FH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G40554DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G41981MA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G42459UQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G45560HM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G46185ND", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G47007PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G47975JA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G48488CO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G49084LP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G49305IN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G49739MP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "22171320", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22171320" } ] }, { "glytoucan_ac": "G51098AA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G52676LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G53193KA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G53752TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G54018RP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G56318NV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G56499YQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G57565TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G57581QG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G57835AK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G57955DP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G60227QI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G60439QY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G64275UO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G65449BO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G65540UB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G66088HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G67173FM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G68668TB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G69170UT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G69834CE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G71906BW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G72886NH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G75120WS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G76294TY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G77023TY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G77252PU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G78030KJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G78726CB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G79565XA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G80319WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G80966KZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G81198YO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G82811EP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G82894XV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G84735GS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "22171320", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22171320" } ] }, { "glytoucan_ac": "G90542MP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G90987JA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G91365ZQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G91413ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G91473PK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G92681HQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G92974UU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G94047VH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G94531EZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G94876HV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G96921ZU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G99808VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "P07911", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07911#ptm_processing" }, { "id": "32616672", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32616672" }, { "id": "22171320", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22171320" }, { "id": "33196145", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33196145" }, { "id": "6TQK", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/6TQK" }, { "id": "6TQL", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/6TQL" }, { "id": "7PFP", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/7PFP" }, { "id": "35273390", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35273390" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 38, "start_aa": "Asn", "end_pos": 38, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn38", "evidence": [ { "id": "P07911", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07911#ptm_processing" }, { "id": "32616672", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32616672" } ] }, { "glytoucan_ac": "G03895SR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G09118YK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G11041DA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G11671GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G12222NC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G14047PA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G16774YZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G17540HT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G17689DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G19469VZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "22171320", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22171320" } ] }, { "glytoucan_ac": "G23345GE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G24413UY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G26935KA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G29676WX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G31532GK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G32659RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G33241WC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G38022PE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G40554DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G41981MA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G45560HM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G46185ND", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G47007PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G47975JA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G49305IN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G51098AA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G52676LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G53752TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G54018RP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G56318NV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G56499YQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G57565TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G57835AK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G57955DP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G60033FS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "22171320", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22171320" } ] }, { "glytoucan_ac": "G60227QI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G60439QY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G65449BO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G67173FM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G68668TB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G69170UT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G71906BW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G75120WS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G76294TY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G77252PU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G78030KJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G79565XA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G80319WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G80966KZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G82811EP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G82894XV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G90542MP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G90987JA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G91365ZQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G91413ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G92681HQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G92974UU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G94047VH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G94531EZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G94876HV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G96921ZU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G99808VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "P07911", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07911#ptm_processing" }, { "id": "32815518", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32815518" }, { "id": "32616672", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32616672" }, { "id": "22171320", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22171320" }, { "id": "33196145", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33196145" }, { "id": "6TQK", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/6TQK" }, { "id": "6TQL", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/6TQL" }, { "id": "6ZS5", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/6ZS5" }, { "id": "7PFP", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/7PFP" }, { "id": "35273390", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35273390" }, { "id": "6ZYA", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/6ZYA" } ] }, { "glytoucan_ac": "G46524LG", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 504, "start_aa": "Thr", "end_pos": 504, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr504", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G47681UP", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 504, "start_aa": "Thr", "end_pos": 504, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr504", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G46524LG", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 511, "start_aa": "Ser", "end_pos": 511, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser511", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G49874UX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 511, "start_aa": "Ser", "end_pos": 511, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser511", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G85228QD", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 511, "start_aa": "Ser", "end_pos": 511, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser511", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G02315DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G02628JF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G03693IY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G03895SR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G04672QB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G06330RB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G09118YK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G11041DA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G11611PG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G11671GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G12222NC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G12793SR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G14047PA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G14456RI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G15488CF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G16774YZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G17540HT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G17689DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G18590ZR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G18804KX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G19116TW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G19469VZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G19603RR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G20312EM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G23345GE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G24413UY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G24835MQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G25379SA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G25418HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G26101XB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G26403SG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G26759AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G26935KA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G27516OE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G29501UT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G29676WX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G30751OD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G30799SW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G31532GK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G31615DN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G31973KL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G32659RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G33241WC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G37881RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G38022PE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G39064KU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G39595FH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G39619TI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G39643OJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G40554DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G41882MT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G41981MA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G44173IH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G45560HM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G46185ND", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G46487SG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G46524LG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G46665ZP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G46842SD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G47007PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G47975JA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G49305IN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G50457PU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G51098AA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G52358QA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G52676LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G53752TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G54018RP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G54612UD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G54740VA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G56087PR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G56318NV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G56499YQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G57565TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G57835AK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G57888GL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G57955DP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G60227QI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G60439QY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G61011OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G61053JL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G61806WR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G62461SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G64275UO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G65092SV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G65449BO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G65540UB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G66621EA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G66760KM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G67173FM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G67900CJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G68668TB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G68833MP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G69170UT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G70822IO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G71906BW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G72398FA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G75120WS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G75256KV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G75607BQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G76294TY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G76915KR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G77252PU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G78030KJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G78701GW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G79565XA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G80319WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G80966KZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G81375TC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G81976CN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G82811EP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G82894XV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G85228QD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G89098OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G90335NR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G90542MP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G90987JA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G91365ZQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G91413ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G92681HQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G92974UU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G93656SY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G94047VH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G94531EZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G94876HV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G96416FQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G96577RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G96921ZU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G99198RV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G99808VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G99966GV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 513, "start_aa": "Asn", "end_pos": 513, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn513", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "P07911", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07911#ptm_processing" }, { "id": "32815518", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32815518" }, { "id": "32616672", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32616672" }, { "id": "33196145", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33196145" }, { "id": "6TQK", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/6TQK" }, { "id": "6TQL", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/6TQL" }, { "id": "6ZS5", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/6ZS5" }, { "id": "7PFP", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/7PFP" }, { "id": "6ZYA", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/6ZYA" }, { "id": "35273390", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35273390" } ] }, { "glytoucan_ac": "G03895SR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G09118YK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G11041DA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G11671GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G12222NC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G14047PA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G16774YZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G17540HT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G17689DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G19469VZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G23345GE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G24413UY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G26935KA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G29676WX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G31532GK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G32659RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G33241WC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G38022PE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G40554DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G41981MA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G45560HM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G46185ND", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G47007PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G47975JA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G49305IN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G51098AA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G52676LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G53752TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G54018RP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G56318NV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G56499YQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G57565TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G57835AK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G57955DP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G60227QI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G60439QY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G65449BO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G67173FM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G68668TB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G69170UT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G71906BW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G75120WS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G76294TY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G77252PU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G78030KJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G79565XA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G80319WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G80966KZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G82811EP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G82894XV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G90542MP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G90987JA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G91365ZQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G91413ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G92681HQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G92974UU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G94047VH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G94531EZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G94876HV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G96921ZU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G99808VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "P07911", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07911#ptm_processing" }, { "id": "32616672", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32616672" }, { "id": "7Q3N", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/7Q3N" }, { "id": "7PFP", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/7PFP" }, { "id": "35273390", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35273390" } ] }, { "glytoucan_ac": "G03895SR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G09118YK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G11041DA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G11671GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G12222NC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G14047PA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G16774YZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G17540HT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G17689DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G19469VZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G23345GE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G24413UY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G26935KA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G29676WX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G31532GK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G32659RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G33241WC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G38022PE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G40554DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G41981MA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G45560HM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G46185ND", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G47007PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G47975JA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G49305IN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G51098AA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G52676LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G53752TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G54018RP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G56318NV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G56499YQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G57565TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G57835AK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G57955DP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G60227QI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G60439QY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G65449BO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G67173FM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G68668TB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G69170UT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G71906BW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G75120WS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G76294TY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G77252PU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G78030KJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G79565XA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G80319WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G80966KZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G82811EP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G82894XV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G90542MP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G90987JA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G91365ZQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G91413ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G92681HQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G92974UU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G94047VH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G94531EZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G94876HV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G96921ZU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" } ] }, { "glytoucan_ac": "G99808VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-76, N-80, N-232, N-275, N-322, N-396, N-513", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07911", "database": "UniCarbKB", "url": "" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" }, { "id": "9884403", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9884403" }, { "id": "P07911", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07911#ptm_processing" }, { "id": "32616672", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32616672" }, { "id": "7Q3N", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/7Q3N" }, { "id": "7PFP", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/7PFP" }, { "id": "35273390", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35273390" } ] }, { "glytoucan_ac": "G71142DF", "type": "O-linked", "subtype": "O-glucosylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-glucosylation", "start_pos": 89, "start_aa": "Ser", "end_pos": 89, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser89", "evidence": [ { "id": "PRU00076", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00076" }, { "id": "GLY_000716", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000716" } ] }, { "glytoucan_ac": "G02620FP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G03622KA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G03895SR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G09118YK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G09285QR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G11041DA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G11671GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G12222NC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G13238MZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G14047PA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G16265OF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G16774YZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G17540HT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G17689DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G19469VZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G20014JD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G23092XT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G23345GE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G24413UY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G26935KA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G28209TJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G28975ZZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G29676WX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G31532GK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G32659RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G33241WC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G37881RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G38022PE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G40554DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G40843RG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G41981MA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G45560HM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G45841FE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G46185ND", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G46422KL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G47007PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G47975JA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G49305IN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G49356OF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G50911BZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G51098AA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G52676LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G53752TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G54018RP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G54330GJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G56318NV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G56499YQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G57097ZE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G57565TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G57835AK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G57888GL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G57955DP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G60227QI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G60439QY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G62168IR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G62461SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G64160PL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G65449BO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G65766QU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G66088HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G67173FM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G67596QA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G68668TB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G69170UT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G69560OI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G69834CE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G71906BW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G72755ZH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G75120WS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G75325GX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G76294TY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G77252PU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G78030KJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G79565XA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G80319WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G80961YY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G80966KZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "2136357", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "glytoucan_ac": "G82233NS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G82811EP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G82894XV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G83487DQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G87932HN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G90542MP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G90987JA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G91365ZQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G91413ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G92681HQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G94047VH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G94222SG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G94531EZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G94788LD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G94876HV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G96921ZU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "glytoucan_ac": "G98846QS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "1425697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1425697" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G99025FY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "glytoucan_ac": "G99808VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "613", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/613" }, { "id": "9760189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9760189" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Tamm-Horsfall protein binds to type 1 fimbriated Escherichia coli and prevents E. coli from binding to uroplakin Ia and Ib receptors.", "journal": "The Journal of biological chemistry", "date": "2001-03-30", "authors": "Pak J, Pu Y, Zhang Z T, Hasty D L, Wu X R", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "reference": [ { "type": "PubMed", "id": "11134021", "url": "https://glygen.org/publication/PubMed/11134021" } ] }, { "title": "Oligosaccharyltransferase is highly specific for the hydroxy amino acid in Asn-Xaa-Thr/Ser.", "journal": "FEBS letters", "date": "2001", "authors": "Breuer W, Klein RA, Hardt B, Bartoschek A, Bause E", "evidence": [ { "database": "Reactome", "id": "R-HSA-446203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203" } ], "reference": [ { "type": "PubMed", "id": "11470266", "url": "https://glygen.org/publication/PubMed/11470266" } ] }, { "title": "H2, the minor subunit of the human asialoglycoprotein receptor, trafficks intracellularly and forms homo-oligomers, but does not bind asialo-orosomucoid.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Saxena A, Yik JH, Weigel PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-446203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203" } ], "reference": [ { "type": "PubMed", "id": "12089159", "url": "https://glygen.org/publication/PubMed/12089159" } ] }, { "title": "Nonpalmitoylated human asialoglycoprotein receptors recycle constitutively but are defective in coated pit-mediated endocytosis, dissociation, and delivery of ligand to lysosomes.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Yik JH, Saxena A, Weigel JA, Weigel PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-446203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203" } ], "reference": [ { "type": "PubMed", "id": "12171918", "url": "https://glygen.org/publication/PubMed/12171918" } ] }, { "title": "Mutations of the UMOD gene are responsible for medullary cystic kidney disease 2 and familial juvenile hyperuricaemic nephropathy.", "journal": "Journal of medical genetics", "date": "2002", "authors": "Hart TC, Gorry MC, Hart PS, Woodard AS, Shihabi Z, Sandhu J, Shirts B, Xu L, Zhu H, Barmada MM, Bleyer AJ", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "reference": [ { "type": "PubMed", "id": "12471200", "url": "https://glygen.org/publication/PubMed/12471200" } ] }, { "title": "UROMODULIN mutations cause familial juvenile hyperuricemic nephropathy.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2003", "authors": "Turner JJ, Stacey JM, Harding B, Kotanko P, Lhotta K, Puig JG, Roberts I, Torres RJ, Thakker RV", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "reference": [ { "type": "PubMed", "id": "12629136", "url": "https://glygen.org/publication/PubMed/12629136" } ] }, { "title": "Molecular cloning, gene organization and expression of the human UDP-GalNAc:Neu5Acalpha2-3Galbeta-R beta1,4-N-acetylgalactosaminyltransferase responsible for the biosynthesis of the blood group Sda/Cad antigen: evidence for an unusual extended cytoplasmic domain.", "journal": "The Biochemical journal", "date": "2003", "authors": "Montiel MD, Krzewinski-Recchi MA, Delannoy P, Harduin-Lepers A", "evidence": [ { "database": "Reactome", "id": "R-HSA-446203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203" } ], "reference": [ { "type": "PubMed", "id": "12678917", "url": "https://glygen.org/publication/PubMed/12678917" } ] }, { "title": "Renal manifestations of a mutation in the uromodulin (Tamm Horsfall protein) gene.", "journal": "American journal of kidney diseases : the official journal of the National Kidney Foundation", "date": "2003", "authors": "Bleyer AJ, Trachtman H, Sandhu J, Gorry MC, Hart TC", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "reference": [ { "type": "PubMed", "id": "12900848", "url": "https://glygen.org/publication/PubMed/12900848" } ] }, { "title": "The Asn-linked carbohydrate chains of human Tamm-Horsfall glycoprotein of one male. Novel sulfated and novel N-acetylgalactosamine-containing N-linked carbohydrate chains.", "journal": "European journal of biochemistry", "date": "1992", "authors": "Hard K, Van Zadelhoff G, Moonen P, Kamerling JP, Vliegenthart FG", "evidence": [ { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "reference": [ { "type": "PubMed", "id": "1425697", "url": "https://glygen.org/publication/PubMed/1425697" } ] }, { "title": "Statistical analysis of the protein environment of N-glycosylation sites: implications for occupancy, structure, and folding.", "journal": "Glycobiology", "date": "2004", "authors": "Petrescu AJ, Milac AL, Petrescu SM, Dwek RA, Wormald MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-446203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203" } ], "reference": [ { "type": "PubMed", "id": "14514716", "url": "https://glygen.org/publication/PubMed/14514716" } ] }, { "title": "Mutations of the Uromodulin gene in MCKD type 2 patients cluster in exon 4, which encodes three EGF-like domains.", "journal": "Kidney international", "date": "2003", "authors": "Wolf MT, Mucha BE, Attanasio M, Zalewski I, Karle SM, Neumann HP, Rahman N, Bader B, Baldamus CA, Otto E, Witzgall R, Fuchshuber A, Hildebrandt F", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "reference": [ { "type": "PubMed", "id": "14531790", "url": "https://glygen.org/publication/PubMed/14531790" } ] }, { "title": "A cluster of mutations in the UMOD gene causes familial juvenile hyperuricemic nephropathy with abnormal expression of uromodulin.", "journal": "Journal of the American Society of Nephrology : JASN", "date": "2003", "authors": "Dahan K, Devuyst O, Smaers M, Vertommen D, Loute G, Poux JM, Viron B, Jacquot C, Gagnadoux MF, Chauveau D, Buchler M, Cochat P, Cosyns JP, Mougenot B, Rider MH, Antignac C, Verellen-Dumoulin C, Pirson Y", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "reference": [ { "type": "PubMed", "id": "14569098", "url": "https://glygen.org/publication/PubMed/14569098" } ] }, { "title": "Allelism of MCKD, FJHN and GCKD caused by impairment of uromodulin export dynamics.", "journal": "Human molecular genetics", "date": "2003", "authors": "Rampoldi L, Caridi G, Santon D, Boaretto F, Bernascone I, Lamorte G, Tardanico R, Dagnino M, Colussi G, Scolari F, Ghiggeri GM, Amoroso A, Casari G", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "reference": [ { "type": "PubMed", "id": "14570709", "url": "https://glygen.org/publication/PubMed/14570709" } ] }, { "title": "Molecular cloning of the human beta1,4 N-acetylgalactosaminyltransferase responsible for the biosynthesis of the Sd(a) histo-blood group antigen: the sequence predicts a very long cytoplasmic domain.", "journal": "Journal of biochemistry", "date": "2003", "authors": "Lo Presti L, Cabuy E, Chiricolo M, Dall'Olio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-446203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203" } ], "reference": [ { "type": "PubMed", "id": "14688233", "url": "https://glygen.org/publication/PubMed/14688233" } ] }, { "title": "Familial juvenile hyperuricemic nephropathy: detection of mutations in the uromodulin gene in five Japanese families.", "journal": "Kidney international", "date": "2004", "authors": "Kudo E, Kamatani N, Tezuka O, Taniguchi A, Yamanaka H, Yabe S, Osabe D, Shinohara S, Nomura K, Segawa M, Miyamoto T, Moritani M, Kunika K, Itakura M", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "reference": [ { "type": "PubMed", "id": "15086896", "url": "https://glygen.org/publication/PubMed/15086896" } ] }, { "title": "Functional consequences of a novel uromodulin mutation in a family with familial juvenile hyperuricaemic nephropathy.", "journal": "Nephrology, dialysis, transplantation : official publication of the European Dialysis and Transplant Association - European Renal Association", "date": "2004", "authors": "Tinschert S, Ruf N, Bernascone I, Sacherer K, Lamorte G, Neumayer HH, Nurnberg P, Luft FC, Rampoldi L", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "reference": [ { "type": "PubMed", "id": "15575003", "url": "https://glygen.org/publication/PubMed/15575003" } ] }, { "title": "A novel pattern of mutation in uromodulin disorders: autosomal dominant medullary cystic kidney disease type 2, familial juvenile hyperuricemic nephropathy, and autosomal dominant glomerulocystic kidney disease.", "journal": "American journal of kidney diseases : the official journal of the National Kidney Foundation", "date": "2005", "authors": "Lens XM, Banet JF, Outeda P, Barrio-Lucia V", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "reference": [ { "type": "PubMed", "id": "15983957", "url": "https://glygen.org/publication/PubMed/15983957" } ] }, { "title": "An evolving view of the eukaryotic oligosaccharyltransferase.", "journal": "Glycobiology", "date": "2006", "authors": "Kelleher DJ, Gilmore R", "evidence": [ { "database": "Reactome", "id": "R-HSA-446203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203" } ], "reference": [ { "type": "PubMed", "id": "16317064", "url": "https://glygen.org/publication/PubMed/16317064" } ] }, { "title": "Defective intracellular trafficking of uromodulin mutant isoforms.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2006", "authors": "Bernascone I, Vavassori S, Di Pentima A, Santambrogio S, Lamorte G, Amoroso A, Scolari F, Ghiggeri GM, Casari G, Polishchuk R, Rampoldi L", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "reference": [ { "type": "PubMed", "id": "17010121", "url": "https://glygen.org/publication/PubMed/17010121" } ] }, { "title": "Urinary uromodulin carries an intact ZP domain generated by a conserved C-terminal proteolytic cleavage.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Santambrogio S, Cattaneo A, Bernascone I, Schwend T, Jovine L, Bachi A, Rampoldi L", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" }, { "database": "RefSeq", "id": "NP_001008390", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008390" } ], "reference": [ { "type": "PubMed", "id": "18375198", "url": "https://glygen.org/publication/PubMed/18375198" } ] }, { "title": "Analysis of uromodulin polymerization provides new insights into the mechanisms regulating ZP domain-mediated protein assembly.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Schaeffer C, Santambrogio S, Perucca S, Casari G, Rampoldi L", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "reference": [ { "type": "PubMed", "id": "19005207", "url": "https://glygen.org/publication/PubMed/19005207" } ] }, { "title": "Screening for OST deficiencies in unsolved CDG-I patients.", "journal": "Biochemical and biophysical research communications", "date": "2009", "authors": "Vleugels W, Schollen E, Foulquier F, Matthijs G", "evidence": [ { "database": "Reactome", "id": "R-HSA-446203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203" } ], "reference": [ { "type": "PubMed", "id": "19835842", "url": "https://glygen.org/publication/PubMed/19835842" } ] }, { "title": "Uromodulin is expressed in renal primary cilia and UMOD mutations result in decreased ciliary uromodulin expression.", "journal": "Hum. Mol. Genet.", "date": "2010", "authors": "Zaucke Frank, Boehnlein Joana M, Steffens Sarah, Polishchuk Roman S, Rampoldi Luca, Fischer Andreas, Pasch Andreas, Boehm Christoph W A, Baasner Anne, Attanasio Massimo, Hoppe Bernd, Hopfer Helmut, Beck Bodo B, Sayer John A, Hildebrandt Friedhelm, Wolf Matthias T F", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "reference": [ { "type": "PubMed", "id": "20172860", "url": "https://glygen.org/publication/PubMed/20172860" } ] }, { "title": "Uromodulin facilitates neutrophil migration across renal epithelial monolayers.", "journal": "Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology", "date": "2010", "authors": "Schmid M, Prajczer S, Gruber LN, Bertocchi C, Gandini R, Pfaller W, Jennings P, Joannidis M", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" }, { "database": "Reactome", "id": "R-HSA-446203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203" } ], "reference": [ { "type": "PubMed", "id": "20798515", "url": "https://glygen.org/publication/PubMed/20798515" } ] }, { "title": "A case of familial juvenile hyperuricemic nephropathy with novel uromodulin gene mutation, a novel heterozygous missense mutation in Korea.", "journal": "Journal of Korean medical science", "date": "2010", "authors": "Lee DH, Kim JK, Oh SE, Noh JW, Lee YK", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "reference": [ { "type": "PubMed", "id": "21060763", "url": "https://glygen.org/publication/PubMed/21060763" } ] }, { "title": "Pregnancy-associated changes in oligomannose oligosaccharides of human and bovine uromodulin (Tamm-Horsfall glycoprotein).", "journal": "Glycoconjugate journal", "date": "1990", "authors": "Smagula RM, Van Halbeek H, Decker JM, Muchmore AV, Moody CE, Sherblom AP", "evidence": [ { "database": "UniCarbKB", "id": "P07911", "url": "" }, { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "reference": [ { "type": "PubMed", "id": "2136357", "url": "https://glygen.org/publication/PubMed/2136357" } ] }, { "title": "Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.", "journal": "Molecular & cellular proteomics : MCP", "date": "2012", "authors": "Halim A, Nilsson J, Ruetschi U, Hesse C, Larson G", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911#ptm_processing" }, { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" }, { "database": "UniCarbKB", "id": "P07911", "url": "" }, { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "reference": [ { "type": "PubMed", "id": "22171320", "url": "https://glygen.org/publication/PubMed/22171320" } ] }, { "title": "Uromodulin (Tamm-Horsfall glycoprotein/uromucoid) is a phosphatidylinositol-linked membrane protein.", "journal": "J. Biol. Chem.", "date": "1990", "authors": "Rindler MJ, Naik SS, Li N, Hoops TC, Peraldi MN", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "reference": [ { "type": "PubMed", "id": "2249987", "url": "https://glygen.org/publication/PubMed/2249987" } ] }, { "title": "Novel uromodulin mutation in familial juvenile hyperuricemic nephropathy.", "journal": "Am. J. Nephrol.", "date": "2012", "authors": "Wei Xin, Xu Ricong, Yang Zhenhua, Li Zhijian, Liao Yunhua, Johnson Richard J, Yu Xueqing, Chen Wei", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "reference": [ { "type": "PubMed", "id": "22776760", "url": "https://glygen.org/publication/PubMed/22776760" } ] }, { "title": "A Japanese Family Suffering from Familial Juvenile Hyperuricemic Nephropathy due to a Rare Mutation of the Uromodulin Gene.", "journal": "Case reports in nephrology and urology", "date": "2012", "authors": "Nakayama M, Mori Y, Ota N, Ishida M, Shiotsu Y, Matsuoka E, Kado H, Ishida R, Nakata M, Kitani T, Tamagaki K, Sekita C, Taniguchi A", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "reference": [ { "type": "PubMed", "id": "23197950", "url": "https://glygen.org/publication/PubMed/23197950" } ] }, { "title": "Novel UMOD mutations in familial juvenile hyperuricemic nephropathy lead to abnormal uromodulin intracellular trafficking.", "journal": "Gene", "date": "2013", "authors": "Liu M, Chen Y, Liang Y, Liu Y, Wang S, Hou P, Zhang H, Zhao M", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "reference": [ { "type": "PubMed", "id": "23988501", "url": "https://glygen.org/publication/PubMed/23988501" } ] }, { "title": "The expanding roles of the Sd(a)/Cad carbohydrate antigen and its cognate glycosyltransferase B4GALNT2.", "journal": "Biochimica et biophysica acta", "date": "2014", "authors": "Dall'Olio F, Malagolini N, Chiricolo M, Trinchera M, Harduin-Lepers A", "evidence": [ { "database": "Reactome", "id": "R-HSA-446203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203" } ], "reference": [ { "type": "PubMed", "id": "24112972", "url": "https://glygen.org/publication/PubMed/24112972" } ] }, { "title": "Pathogenic uromodulin mutations result in premature intracellular polymerization.", "journal": "FEBS letters", "date": "2015", "authors": "Stewart AP, Sandford RN, Karet Frankl FE, Edwardson JM", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "reference": [ { "type": "PubMed", "id": "25436415", "url": "https://glygen.org/publication/PubMed/25436415" } ] }, { "title": "The serine protease hepsin mediates urinary secretion and polymerisation of Zona Pellucida domain protein uromodulin.", "journal": "eLife", "date": "2015", "authors": "Brunati M, Perucca S, Han L, Cattaneo A, Consolato F, Andolfo A, Schaeffer C, Olinger E, Peng J, Santambrogio S, Perrier R, Li S, Bokhove M, Bachi A, Hummler E, Devuyst O, Wu Q, Jovine L, Rampoldi L", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "reference": [ { "type": "PubMed", "id": "26673890", "url": "https://glygen.org/publication/PubMed/26673890" } ] }, { "title": "A structured interdomain linker directs self-polymerization of human uromodulin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2016", "authors": "Bokhove M, Nishimura K, Brunati M, Han L, de Sanctis D, Rampoldi L, Jovine L", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911#ptm_processing" }, { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "reference": [ { "type": "PubMed", "id": "26811476", "url": "https://glygen.org/publication/PubMed/26811476" } ] }, { "title": "A new missense mutation in UMOD gene leads to severely reduced serum uromodulin concentrations - A tool for the diagnosis of uromodulin-associated kidney disease.", "journal": "Clinical biochemistry", "date": "2017", "authors": "Satanovskij R, Bader A, Block M, Herbst V, Schlumberger W, Haack T, Nockher WA, Heemann U, Renders L, Schmaderer C, Angermann S, Wen M, Meitinger T, Scherberich J, Steubl D", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "reference": [ { "type": "PubMed", "id": "27729211", "url": "https://glygen.org/publication/PubMed/27729211" } ] }, { "title": "The H1 and H2 polypeptides associate to form the asialoglycoprotein receptor in human hepatoma cells.", "journal": "The Journal of cell biology", "date": "1988", "authors": "Bischoff J, Libresco S, Shia MA, Lodish HF", "evidence": [ { "database": "Reactome", "id": "R-HSA-446203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203" } ], "reference": [ { "type": "PubMed", "id": "2834401", "url": "https://glygen.org/publication/PubMed/2834401" } ] }, { "title": "Large-scale intact glycopeptide identification by Mascot database search.", "journal": "Scientific reports", "date": "2018", "authors": "Bollineni RC, Koehler CJ, Gislefoss RE, Anonsen JH, Thiede B", "evidence": [ { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "reference": [ { "type": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "title": "Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and alpha-1B-Glycoprotein.", "journal": "Analytical chemistry", "date": "2018", "authors": "Sun S, Hu Y, Jia L, Eshghi ST, Liu Y, Shah P, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P07911", "url": "" }, { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "reference": [ { "type": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "title": "Distinct urinary glycoprotein signatures in prostate cancer patients.", "journal": "Oncotarget", "date": "2018", "authors": "Kawahara R, Ortega F, Rosa-Fernandes L, Guimaraes V, Quina D, Nahas W, Schwammle V, Srougi M, Leite KRM, Thaysen-Andersen M, Larsen MR, Palmisano G", "evidence": [ { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "reference": [ { "type": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "title": "Architecture and function of human uromodulin filaments in urinary tract infections.", "journal": "Science (New York, N.Y.)", "date": "2020", "authors": "Weiss GL, Stanisich JJ, Sauer MM, Lin CW, Eras J, Zyla DS, Truck J, Devuyst O, Aebi M, Pilhofer M, Glockshuber R", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911#ptm_processing" }, { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "reference": [ { "type": "PubMed", "id": "32616672", "url": "https://glygen.org/publication/PubMed/32616672" } ] }, { "title": "The cryo-EM structure of the human uromodulin filament core reveals a unique assembly mechanism.", "journal": "eLife", "date": "2020", "authors": "Stanisich JJ, Zyla DS, Afanasyev P, Xu J, Kipp A, Olinger E, Devuyst O, Pilhofer M, Boehringer D, Glockshuber R", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911#ptm_processing" }, { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "reference": [ { "type": "PubMed", "id": "32815518", "url": "https://glygen.org/publication/PubMed/32815518" } ] }, { "title": "Cryo-EM structure of native human uromodulin, a zona pellucida module polymer.", "journal": "The EMBO journal", "date": "2020", "authors": "Stsiapanava A, Xu C, Brunati M, Zamora-Caballero S, Schaeffer C, Bokhove M, Han L, Hebert H, Carroni M, Yasumasu S, Rampoldi L, Wu B, Jovine L", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911#ptm_processing" }, { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "reference": [ { "type": "PubMed", "id": "33196145", "url": "https://glygen.org/publication/PubMed/33196145" } ] }, { "title": "Identification of human uromodulin as the Tamm-Horsfall urinary glycoprotein.", "journal": "Science", "date": "1987", "authors": "Pennica D, Kohr W J, Kuang W J, Glaister D, Aggarwal B B, Chen E Y, Goeddel D V", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "reference": [ { "type": "PubMed", "id": "3453112", "url": "https://glygen.org/publication/PubMed/3453112" } ] }, { "title": "Uromodulin (Tamm-Horsfall glycoprotein): a renal ligand for lymphokines.", "journal": "Science (New York, N.Y.)", "date": "1987", "authors": "Hession C, Decker JM, Sherblom AP, Kumar S, Yue CC, Mattaliano RJ, Tizard R, Kawashima E, Schmeissner U, Heletky S, et al.", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "reference": [ { "type": "PubMed", "id": "3498215", "url": "https://glygen.org/publication/PubMed/3498215" } ] }, { "title": "Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.", "journal": "Nature structural & molecular biology", "date": "2022", "authors": "Stsiapanava A, Xu C, Nishio S, Han L, Yamakawa N, Carroni M, Tunyasuvunakool K, Jumper J, de Sanctis D, Wu B, Jovine L", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911#ptm_processing" }, { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "reference": [ { "type": "PubMed", "id": "35273390", "url": "https://glygen.org/publication/PubMed/35273390" } ] }, { "title": "Kidney function may partially mediated the protective effect of urinary uromodulin on kidney stone.", "journal": "Urolithiasis", "date": "2023-04-06", "authors": "Jian Zhongyu, Yuan Chi, Xiong Zheyu, Li Hong, Jin Xi, Wang Kunjie", "evidence": [ { "database": "RefSeq", "id": "NP_001008390", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008390" } ], "reference": [ { "type": "PubMed", "id": "37022471", "url": "https://glygen.org/publication/PubMed/37022471" } ] }, { "title": "Healthy Women Have Higher Systemic Uromodulin Levels: Identification of Uromodulin as an Estrogen Responsive Gene.", "journal": "Kidney360", "date": "2023-09-01", "authors": "Nanamatsu Azuma, Micanovic Radmila, Khan Shehnaz, El-Achkar Tarek M, LaFavers Kaice A", "evidence": [ { "database": "RefSeq", "id": "NP_001008390", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008390" } ], "reference": [ { "type": "PubMed", "id": "37340540", "url": "https://glygen.org/publication/PubMed/37340540" } ] }, { "title": "The relationship between the N-acetylgalactosamine content and the blood group Sda activity of Tamm and Horsfall urinary glycoprotein.", "journal": "Biochemical and biophysical research communications", "date": "1980", "authors": "Soh CP, Morgan WT, Watkins WM, Donald AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-446203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203" } ], "reference": [ { "type": "PubMed", "id": "6156677", "url": "https://glygen.org/publication/PubMed/6156677" } ] }, { "title": "Localization of Tamm-Horsfall glycoprotein in the human kidney using immuno-fluorescence and immuno-electron microscopical techniques.", "journal": "J. Anat.", "date": "1981", "authors": "Sikri KL, Foster CL, MacHugh N, Marshall RD", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "reference": [ { "type": "PubMed", "id": "7028707", "url": "https://glygen.org/publication/PubMed/7028707" } ] }, { "title": "Precipitin reaction between Sda-active human Tamm-Horsfall glycoprotein and anti-Sda-serum.", "journal": "Vox sanguinis", "date": "1982", "authors": "Serafini-Cessi F, Conte R", "evidence": [ { "database": "Reactome", "id": "R-HSA-446203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203" } ], "reference": [ { "type": "PubMed", "id": "7072193", "url": "https://glygen.org/publication/PubMed/7072193" } ] }, { "title": "Sulfated di-, tri- and tetraantennary N-glycans in human Tamm-Horsfall glycoprotein.", "journal": "European journal of biochemistry", "date": "1998", "authors": "van Rooijen JJ, Kamerling JP, Vliegenthart JF", "evidence": [ { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "reference": [ { "type": "PubMed", "id": "9760189", "url": "https://glygen.org/publication/PubMed/9760189" } ] }, { "title": "Glycosylation sites and site-specific glycosylation in human Tamm-Horsfall glycoprotein.", "journal": "Glycobiology", "date": "1999", "authors": "van Rooijen JJ, Voskamp AF, Kamerling JP, Vliegenthart JF", "evidence": [ { "database": "UniCarbKB", "id": "P07911", "url": "" }, { "database": "GlyConnect", "id": "613", "url": "https://glyconnect.expasy.org/browser/proteins/613" } ], "reference": [ { "type": "PubMed", "id": "9884403", "url": "https://glygen.org/publication/PubMed/9884403" } ] } ], "pathway": [ { "id": "hsa:7369", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7369", "resource": "KEGG Pathway" }, { "id": "R-HSA-446203", "name": "Asparagine N-linked glycosylation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203", "resource": "Reactome", "description": "Asparagine N-linked glycosylation" } ], "orthologs": [ { "uniprot_canonical_ac": "F1RPA9-1", "protein_name": "Uromodulin", "gene_name": "UMOD", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MRWLFSLPSIWMVVAVTSWIIMAAAEDTSEARSCSECHSNATCVEDGAATTCTCRVGFTGDGLECVDLDECSLPGAHDCSANSSCVNTPGSYTCVCSDGFRLSPELGCIDVDECAEPGLSRCHALATCVNGEGNYSCVCPAGYWGDGWHCECSPGSCGPGLDCVPSGDALMCADPCQAHRILDEYWRSAGYGAGYDCDSDLSGWYRFVGQGGVRLADTCVPVLRCNTAAPMWLNGTHPSSDEGIVDRTACAHWSGHCCLWNTPVQVKACDGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSDNGKWHCQCKQDVNITDFSLLEHRLECGVNDIKMSLSKCQLKNLGFEKIFMYLRDSQCSGFAERGNRDWISVVTPTRDGPCGTVMTRNETHATYSNTLYLADEIIIRDLNIKINFACSYPLDMKVSLKTSLQPMVSALNISVGGTGMFTVRMALFQSPTYTQPYQGSSVTLSTEAFLFVGTMLDGGDLSRFVLLMTNCYATPSSSATDPLKYFIIQDRCPRSQDPTIQVEENGESPQGRFSVQMFRFAGNYDLVYLHCEVYLCDSVNEKCKPTCSGTRFRSGGALDQSRVLNLGPITRKGGQAAVSRAASSSLGFLKVWLPLLLSATLTLMSQ", "length": 642 }, "evidence": [ { "id": "P07911", "url": "https://omabrowser.org/oma/group/P07911/", "database": "OMA" } ], "common_name": "Pig" }, { "uniprot_canonical_ac": "P27590-1", "protein_name": "Uromodulin", "gene_name": "Umod", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGQLLSLTWLLLVMVVTPWFTVAGANDSPEARRCSECHDNATCVLDGVVTTCSCQAGFTGDGLVCEDIDECATPWTHNCSNSICMNTLGSYECSCQDGFRLTPGLGCIDVNECTEQGLSNCHSLATCVNTEGSYSCVCPKGYRGDGWYCECSPGFCEPGLDCLPQGPSGKLVCQDPCNVYETLTEYWRSTDYGAGYSCDSDMHGWYRFTGQGGVRMAETCVPVLRCNTAAPMWLNGSHPSSREGIVSRTACAHWSDHCCLWSTEIQVKACPGGFYVYNLTEPPECNLAYCTDPSSVEGTCEECGVDEDCVSDNGRWRCQCKQDFNVTDVSLLEHRLECEANEIKISLSKCQLQSLGFMKVFMYLNDRQCSGFSERGERDWMSIVTPARDGPCGTVLRRNETHATYSNTLYLASEIIIRDINIRINFECSYPLDMKVSLKTSLQPMVSALNISLGGTGKFTVQMALFQNPTYTQPYQGPSVMLSTEAFLYVGTMLDGGDLSRFVLLMTNCYATPSSNSTDPVKYFIIQDRCPHTEDTTIQVTENGESSQARFSIQMFRFAGNSDLVYLHCEVYLCDTMSEQCKPTCSGTRYRSGNFIDQTRVLNLGPITRQGVQASVSKAASSNLGFLSIWLLLFLSATLTLMVH", "length": 644 }, "evidence": [ { "id": "45923550", "url": "http://www.informatics.jax.org/homology/45923550", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q91X17-1", "protein_name": "Uromodulin", "gene_name": "Umod", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGIPLTWMLLVMMVTSWFTLAEASNSTEARRCSECHNNATCTVDGVVTTCSCQTGFTGDGLVCEDMDECATPWTHNCSNSSCVNTPGSFKCSCQDGFRLTPELSCTDVDECSEQGLSNCHALATCVNTEGDYLCVCPEGFTGDGWYCECSPGSCEPGLDCLPQGPDGKLVCQDPCNTYETLTEYWRSTEYGVGYSCDAGLHGWYRFTGQGGVRMAETCVPVLRCNTAAPMWLNGSHPSSSEGIVSRTACAHWSDQCCRWSTEIQVKACPGGFYIYNLTAPPECNLAYCTDPSSVEGTCEECRVDEDCISDNGRWRCQCKQDSNITDVSQLEYRLECGANDIKMSLRKCQLQSLGFMNVFMYLNDRQCSGFSESDERDWMSIVTPARNGPCGTVLRRNETHATYSNTLYLANAIIIRDIIIRMNFECSYPLDMKVSLKTSLQPMVSALNISLGGTGKFTVRMALFQSPTYTQPHQGPSVMLSTEAFLYVGTMLDGGDLSRFVLLMTNCYATPSSNSTDPVKYFIIQDSCPRTEDTTIQVTENGESSQARFSVQMFRFAGNYDLVYLHCEVYLCDSTSEQCKPTCSGTRFRSGNFIDQTRVLNLGPITRQGVQASVSKAASSNLRLLSIWLLLFPSATLIFMVQ", "length": 642 }, "evidence": [ { "id": "45923550", "url": "http://www.informatics.jax.org/homology/45923550", "database": "MGI" }, { "id": "P07911", "url": "https://omabrowser.org/oma/group/P07911/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "IgG binding", "id": "GO:0019864", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019864", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 47, "go_terms": [ { "name": "urea transmembrane transport", "id": "GO:0071918", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071918", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "regulation of protein transport", "id": "GO:0051223", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051223", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "intracellular chloride ion homeostasis", "id": "GO:0030644", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030644", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "metanephric ascending thin limb development", "id": "GO:0072218", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072218", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "renal water homeostasis", "id": "GO:0003091", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003091", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "lipid metabolic process", "id": "GO:0006629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006629", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "inflammatory response", "id": "GO:0006954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "response to lipopolysaccharide", "id": "GO:0032496", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032496", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "innate immune response", "id": "GO:0045087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "defense response to Gram-negative bacterium", "id": "GO:0050829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050829", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "intracellular calcium ion homeostasis", "id": "GO:0006874", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006874", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "regulation of blood pressure", "id": "GO:0008217", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008217", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "apoptotic signaling pathway", "id": "GO:0097190", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097190", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "intracellular sodium ion homeostasis", "id": "GO:0006883", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006883", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "autophagy", "id": "GO:0006914", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006914", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "RNA splicing", "id": "GO:0008380", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008380", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "response to water deprivation", "id": "GO:0009414", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009414", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "regulation of urine volume", "id": "GO:0035809", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035809", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "ubiquitin-dependent ERAD pathway", "id": "GO:0030433", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030433", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "response to xenobiotic stimulus", "id": "GO:0009410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009410", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "tumor necrosis factor-mediated signaling pathway", "id": "GO:0033209", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033209", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "micturition", "id": "GO:0060073", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060073", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "potassium ion homeostasis", "id": "GO:0055075", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055075", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "collecting duct development", "id": "GO:0072044", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072044", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "glomerular filtration", "id": "GO:0003094", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003094", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "protein transport into plasma membrane raft", "id": "GO:0044861", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044861", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "metanephric distal convoluted tubule development", "id": "GO:0072221", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072221", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "metanephric thick ascending limb development", "id": "GO:0072233", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072233", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "endoplasmic reticulum organization", "id": "GO:0007029", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007029", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "chaperone-mediated protein folding", "id": "GO:0061077", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061077", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "cellular response to unfolded protein", "id": "GO:0034620", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034620", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "renal sodium ion absorption", "id": "GO:0070294", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070294", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "multicellular organismal response to stress", "id": "GO:0033555", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033555", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "urate transport", "id": "GO:0015747", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015747", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "intracellular phosphate ion homeostasis", "id": "GO:0030643", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030643", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "protein localization to vacuole", "id": "GO:0072665", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072665", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "organ or tissue specific immune response", "id": "GO:0002251", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002251", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "renal urate salt excretion", "id": "GO:0097744", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097744", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "citric acid secretion", "id": "GO:0046720", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046720", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "juxtaglomerular apparatus development", "id": "GO:0072051", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072051", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "connective tissue replacement", "id": "GO:0097709", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097709", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "negative regulation of cell population proliferation", "id": "GO:0008285", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008285", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "cellular defense response", "id": "GO:0006968", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006968", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "leukocyte cell-cell adhesion", "id": "GO:0007159", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007159", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules", "id": "GO:0007157", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007157", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "neutrophil migration", "id": "GO:1990266", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990266", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "antibacterial innate immune response", "id": "GO:0140367", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140367", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 13, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "basolateral plasma membrane", "id": "GO:0016323", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016323", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "apical plasma membrane", "id": "GO:0016324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016324", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "ciliary membrane", "id": "GO:0060170", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060170", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "side of membrane", "id": "GO:0098552", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098552", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "spindle pole", "id": "GO:0000922", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000922", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "Golgi lumen", "id": "GO:0005796", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005796", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "cilium", "id": "GO:0005929", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005929", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" }, { "name": "extrinsic component of membrane", "id": "GO:0019898", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019898", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "uromodulin N-glycosylated 1 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:2136357, PMID:29671580, PMID:9884403]", "evidence": [ { "id": "PR:000053980", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053980" } ] }, { "name": "uromodulin N-glycosylated 2 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G03895SR. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G03895SR. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000053981", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053981" } ] }, { "name": "uromodulin N-glycosylated 3 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G09118YK. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G09118YK. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000053982", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053982" } ] }, { "name": "uromodulin N-glycosylated 4 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G11041DA. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G11041DA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000053983", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053983" } ] }, { "name": "uromodulin N-glycosylated 5 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G11671GQ. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G11671GQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000053984", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053984" } ] }, { "name": "uromodulin N-glycosylated 6 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G12222NC. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G12222NC. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000053985", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053985" } ] }, { "name": "uromodulin N-glycosylated 7 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G14047PA. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G14047PA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000053986", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053986" } ] }, { "name": "uromodulin N-glycosylated 8 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G16774YZ. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G16774YZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000053987", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053987" } ] }, { "name": "uromodulin N-glycosylated 9 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G17540HT. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G17540HT. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000053988", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053988" } ] }, { "name": "uromodulin N-glycosylated 10 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G17689DH. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G17689DH. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000053989", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053989" } ] }, { "name": "uromodulin N-glycosylated 11 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G19469VZ. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G19469VZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000053990", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053990" } ] }, { "name": "uromodulin N-glycosylated 12 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G23345GE. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G23345GE. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000053991", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053991" } ] }, { "name": "uromodulin N-glycosylated 13 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G24413UY. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G24413UY. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000053992", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053992" } ] }, { "name": "uromodulin N-glycosylated 14 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G26935KA. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G26935KA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000053993", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053993" } ] }, { "name": "uromodulin N-glycosylated 15 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G29676WX. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G29676WX. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000053994", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053994" } ] }, { "name": "uromodulin N-glycosylated 16 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G31532GK. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G31532GK. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000053995", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053995" } ] }, { "name": "uromodulin N-glycosylated 17 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G32659RY. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G32659RY. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000053996", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053996" } ] }, { "name": "uromodulin N-glycosylated 18 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G33241WC. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G33241WC. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000053997", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053997" } ] }, { "name": "uromodulin N-glycosylated 19 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G38022PE. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G38022PE. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000053998", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053998" } ] }, { "name": "uromodulin N-glycosylated 20 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G40554DX. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G40554DX. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000053999", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053999" } ] }, { "name": "uromodulin N-glycosylated 21 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G41981MA. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G41981MA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054000", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054000" } ] }, { "name": "uromodulin N-glycosylated 22 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan composition is represented by GlyTouCan:G43669FQ. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G43669FQ. [PRO:DNx, PMID:22171320]", "evidence": [ { "id": "PR:000054001", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054001" } ] }, { "name": "uromodulin N-glycosylated 23 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G45560HM. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G45560HM. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054002", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054002" } ] }, { "name": "uromodulin N-glycosylated 24 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G46185ND. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G46185ND. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054003", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054003" } ] }, { "name": "uromodulin N-glycosylated 25 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G47007PV. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G47007PV. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054004", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054004" } ] }, { "name": "uromodulin N-glycosylated 26 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G47975JA. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G47975JA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054005", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054005" } ] }, { "name": "uromodulin N-glycosylated 27 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G49305IN. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G49305IN. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054006", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054006" } ] }, { "name": "uromodulin N-glycosylated 28 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G51098AA. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G51098AA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054007", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054007" } ] }, { "name": "uromodulin N-glycosylated 29 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G52676LZ. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G52676LZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054008", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054008" } ] }, { "name": "uromodulin N-glycosylated 30 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G53752TA. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G53752TA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054009", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054009" } ] }, { "name": "uromodulin N-glycosylated 31 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G54018RP. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G54018RP. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054010", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054010" } ] }, { "name": "uromodulin N-glycosylated 32 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G56318NV. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G56318NV. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054011", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054011" } ] }, { "name": "uromodulin N-glycosylated 33 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G56499YQ. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G56499YQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054012", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054012" } ] }, { "name": "uromodulin N-glycosylated 34 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G57565TQ. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G57565TQ. [PRO:DNx, PMID:2136357, PMID:29671580, PMID:9884403]", "evidence": [ { "id": "PR:000054013", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054013" } ] }, { "name": "uromodulin N-glycosylated 35 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G57835AK. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G57835AK. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054014", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054014" } ] }, { "name": "uromodulin N-glycosylated 36 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G57955DP. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G57955DP. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054015", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054015" } ] }, { "name": "uromodulin N-glycosylated 37 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G60227QI. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G60227QI. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054016", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054016" } ] }, { "name": "uromodulin N-glycosylated 38 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G60439QY. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G60439QY. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054017", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054017" } ] }, { "name": "uromodulin N-glycosylated 39 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G65449BO. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G65449BO. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054018", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054018" } ] }, { "name": "uromodulin N-glycosylated 40 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G67173FM. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G67173FM. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054019", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054019" } ] }, { "name": "uromodulin N-glycosylated 41 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G68668TB. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G68668TB. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054020", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054020" } ] }, { "name": "uromodulin N-glycosylated 42 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G69170UT. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G69170UT. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054021", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054021" } ] }, { "name": "uromodulin N-glycosylated 43 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G71906BW. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G71906BW. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054022", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054022" } ] }, { "name": "uromodulin N-glycosylated 44 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G75120WS. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G75120WS. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054023", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054023" } ] }, { "name": "uromodulin N-glycosylated 45 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G76294TY. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G76294TY. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054024", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054024" } ] }, { "name": "uromodulin N-glycosylated 46 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G77252PU. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G77252PU. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054025", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054025" } ] }, { "name": "uromodulin N-glycosylated 47 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G78030KJ. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G78030KJ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054026", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054026" } ] }, { "name": "uromodulin N-glycosylated 48 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G79565XA. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G79565XA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054027", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054027" } ] }, { "name": "uromodulin N-glycosylated 49 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G80319WU. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G80319WU. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054028", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054028" } ] }, { "name": "uromodulin N-glycosylated 50 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G80966KZ. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G80966KZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054029", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054029" } ] }, { "name": "uromodulin N-glycosylated 51 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G82811EP. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G82811EP. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054030", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054030" } ] }, { "name": "uromodulin N-glycosylated 52 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G82894XV. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G82894XV. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054031", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054031" } ] }, { "name": "uromodulin N-glycosylated 53 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G90542MP. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G90542MP. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054032", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054032" } ] }, { "name": "uromodulin N-glycosylated 54 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G90987JA. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G90987JA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054033", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054033" } ] }, { "name": "uromodulin N-glycosylated 55 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G91365ZQ. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G91365ZQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054034", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054034" } ] }, { "name": "uromodulin N-glycosylated 56 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G91413ZX. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G91413ZX. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054035", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054035" } ] }, { "name": "uromodulin N-glycosylated 57 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G92681HQ. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G92681HQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054036", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054036" } ] }, { "name": "uromodulin N-glycosylated 58 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G92974UU. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G92974UU. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054037", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054037" } ] }, { "name": "uromodulin N-glycosylated 59 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G94047VH. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G94047VH. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054038", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054038" } ] }, { "name": "uromodulin N-glycosylated 60 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G94531EZ. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G94531EZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054039", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054039" } ] }, { "name": "uromodulin N-glycosylated 61 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G94876HV. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G94876HV. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054040", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054040" } ] }, { "name": "uromodulin N-glycosylated 62 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G96921ZU. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G96921ZU. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054041", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054041" } ] }, { "name": "uromodulin N-glycosylated 63 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-232 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G99808VS. Example: UniProtKB:P07911-1, Asn-232, MOD:00160~GNO:G99808VS. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054042", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054042" } ] }, { "name": "uromodulin N-glycosylated 64 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:2136357, PMID:29671580, PMID:9884403]", "evidence": [ { "id": "PR:000054043", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054043" } ] }, { "name": "uromodulin N-glycosylated 65 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G03895SR. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G03895SR. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054044", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054044" } ] }, { "name": "uromodulin N-glycosylated 66 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G09118YK. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G09118YK. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054045", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054045" } ] }, { "name": "uromodulin N-glycosylated 67 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G11041DA. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G11041DA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054046", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054046" } ] }, { "name": "uromodulin N-glycosylated 68 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G11671GQ. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G11671GQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054047", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054047" } ] }, { "name": "uromodulin N-glycosylated 69 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G12222NC. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G12222NC. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054048", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054048" } ] }, { "name": "uromodulin N-glycosylated 70 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G14047PA. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G14047PA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054049", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054049" } ] }, { "name": "uromodulin N-glycosylated 71 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G16774YZ. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G16774YZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054050", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054050" } ] }, { "name": "uromodulin N-glycosylated 72 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G17540HT. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G17540HT. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054051", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054051" } ] }, { "name": "uromodulin N-glycosylated 73 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G17689DH. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G17689DH. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054052", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054052" } ] }, { "name": "uromodulin N-glycosylated 74 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G19469VZ. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G19469VZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054053", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054053" } ] }, { "name": "uromodulin N-glycosylated 75 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G23345GE. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G23345GE. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054054", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054054" } ] }, { "name": "uromodulin N-glycosylated 76 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G24413UY. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G24413UY. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054055", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054055" } ] }, { "name": "uromodulin N-glycosylated 77 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G26935KA. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G26935KA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054056", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054056" } ] }, { "name": "uromodulin N-glycosylated 78 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G29676WX. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G29676WX. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054057", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054057" } ] }, { "name": "uromodulin N-glycosylated 79 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G31532GK. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G31532GK. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054058", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054058" } ] }, { "name": "uromodulin N-glycosylated 80 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G32659RY. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G32659RY. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054059", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054059" } ] }, { "name": "uromodulin N-glycosylated 81 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G33241WC. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G33241WC. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054060", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054060" } ] }, { "name": "uromodulin N-glycosylated 82 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G38022PE. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G38022PE. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054061", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054061" } ] }, { "name": "uromodulin N-glycosylated 83 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G40554DX. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G40554DX. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054062", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054062" } ] }, { "name": "uromodulin N-glycosylated 84 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G41981MA. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G41981MA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054063", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054063" } ] }, { "name": "uromodulin N-glycosylated 85 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G45560HM. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G45560HM. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054064", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054064" } ] }, { "name": "uromodulin N-glycosylated 86 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G46185ND. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G46185ND. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054065", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054065" } ] }, { "name": "uromodulin N-glycosylated 87 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G47007PV. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G47007PV. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054066", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054066" } ] }, { "name": "uromodulin N-glycosylated 88 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G47975JA. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G47975JA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054067", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054067" } ] }, { "name": "uromodulin N-glycosylated 89 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G49305IN. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G49305IN. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054068", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054068" } ] }, { "name": "uromodulin N-glycosylated 90 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G51098AA. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G51098AA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054069", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054069" } ] }, { "name": "uromodulin N-glycosylated 91 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G52676LZ. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G52676LZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054070", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054070" } ] }, { "name": "uromodulin N-glycosylated 92 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G53752TA. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G53752TA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054071", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054071" } ] }, { "name": "uromodulin N-glycosylated 93 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G54018RP. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G54018RP. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054072", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054072" } ] }, { "name": "uromodulin N-glycosylated 94 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G55220VL. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G55220VL. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054073", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054073" } ] }, { "name": "uromodulin N-glycosylated 95 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G56318NV. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G56318NV. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054074", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054074" } ] }, { "name": "uromodulin N-glycosylated 96 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G56499YQ. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G56499YQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054075", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054075" } ] }, { "name": "uromodulin N-glycosylated 97 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G57565TQ. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G57565TQ. [PRO:DNx, PMID:2136357, PMID:29671580, PMID:9884403]", "evidence": [ { "id": "PR:000054076", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054076" } ] }, { "name": "uromodulin N-glycosylated 98 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G57835AK. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G57835AK. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054077", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054077" } ] }, { "name": "uromodulin N-glycosylated 99 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G57955DP. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G57955DP. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054078", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054078" } ] }, { "name": "uromodulin N-glycosylated 100 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G60227QI. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G60227QI. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054079", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054079" } ] }, { "name": "uromodulin N-glycosylated 101 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G60439QY. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G60439QY. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054080", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054080" } ] }, { "name": "uromodulin N-glycosylated 102 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G65449BO. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G65449BO. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054081", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054081" } ] }, { "name": "uromodulin N-glycosylated 103 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G67173FM. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G67173FM. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054082", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054082" } ] }, { "name": "uromodulin N-glycosylated 104 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G68668TB. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G68668TB. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054083", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054083" } ] }, { "name": "uromodulin N-glycosylated 105 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G69170UT. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G69170UT. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054084", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054084" } ] }, { "name": "uromodulin N-glycosylated 106 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G71906BW. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G71906BW. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054085", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054085" } ] }, { "name": "uromodulin N-glycosylated 107 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G75120WS. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G75120WS. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054086", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054086" } ] }, { "name": "uromodulin N-glycosylated 108 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G76294TY. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G76294TY. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054087", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054087" } ] }, { "name": "uromodulin N-glycosylated 109 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G77252PU. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G77252PU. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054088", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054088" } ] }, { "name": "uromodulin N-glycosylated 110 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G78030KJ. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G78030KJ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054089", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054089" } ] }, { "name": "uromodulin N-glycosylated 111 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G79565XA. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G79565XA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054090", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054090" } ] }, { "name": "uromodulin N-glycosylated 112 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G80319WU. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G80319WU. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054091", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054091" } ] }, { "name": "uromodulin N-glycosylated 113 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G80966KZ. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G80966KZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054092", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054092" } ] }, { "name": "uromodulin N-glycosylated 114 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G82811EP. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G82811EP. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054093", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054093" } ] }, { "name": "uromodulin N-glycosylated 115 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G82894XV. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G82894XV. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054094", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054094" } ] }, { "name": "uromodulin N-glycosylated 116 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G90542MP. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G90542MP. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054095", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054095" } ] }, { "name": "uromodulin N-glycosylated 117 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G90987JA. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G90987JA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054096", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054096" } ] }, { "name": "uromodulin N-glycosylated 118 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G91365ZQ. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G91365ZQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054097", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054097" } ] }, { "name": "uromodulin N-glycosylated 119 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G91413ZX. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G91413ZX. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054098", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054098" } ] }, { "name": "uromodulin N-glycosylated 120 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G92681HQ. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G92681HQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054099", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054099" } ] }, { "name": "uromodulin N-glycosylated 121 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G92974UU. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G92974UU. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054100", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054100" } ] }, { "name": "uromodulin N-glycosylated 122 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G94047VH. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G94047VH. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054101", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054101" } ] }, { "name": "uromodulin N-glycosylated 123 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G94531EZ. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G94531EZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054102", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054102" } ] }, { "name": "uromodulin N-glycosylated 124 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G94876HV. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G94876HV. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054103", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054103" } ] }, { "name": "uromodulin N-glycosylated 125 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G96921ZU. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G96921ZU. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054104", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054104" } ] }, { "name": "uromodulin N-glycosylated 126 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-275 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G99808VS. Example: UniProtKB:P07911-1, Asn-275, MOD:00160~GNO:G99808VS. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054105", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054105" } ] }, { "name": "uromodulin N-glycosylated 127 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G03895SR. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G03895SR. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054106", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054106" } ] }, { "name": "uromodulin N-glycosylated 128 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G09118YK. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G09118YK. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054107", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054107" } ] }, { "name": "uromodulin N-glycosylated 129 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G11041DA. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G11041DA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054108", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054108" } ] }, { "name": "uromodulin N-glycosylated 130 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G11671GQ. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G11671GQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054109", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054109" } ] }, { "name": "uromodulin N-glycosylated 131 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G12222NC. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G12222NC. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054110", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054110" } ] }, { "name": "uromodulin N-glycosylated 132 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G14047PA. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G14047PA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054111", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054111" } ] }, { "name": "uromodulin N-glycosylated 133 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G16774YZ. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G16774YZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054112", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054112" } ] }, { "name": "uromodulin N-glycosylated 134 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G17540HT. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G17540HT. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054113", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054113" } ] }, { "name": "uromodulin N-glycosylated 135 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G17689DH. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G17689DH. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054114", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054114" } ] }, { "name": "uromodulin N-glycosylated 136 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G19469VZ. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G19469VZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054115", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054115" } ] }, { "name": "uromodulin N-glycosylated 137 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G23345GE. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G23345GE. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054116", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054116" } ] }, { "name": "uromodulin N-glycosylated 138 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G24413UY. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G24413UY. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054117", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054117" } ] }, { "name": "uromodulin N-glycosylated 139 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G26935KA. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G26935KA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054118", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054118" } ] }, { "name": "uromodulin N-glycosylated 140 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G29676WX. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G29676WX. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054119", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054119" } ] }, { "name": "uromodulin N-glycosylated 141 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G31532GK. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G31532GK. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054120", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054120" } ] }, { "name": "uromodulin N-glycosylated 142 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G32659RY. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G32659RY. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054121", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054121" } ] }, { "name": "uromodulin N-glycosylated 143 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G33241WC. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G33241WC. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054122", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054122" } ] }, { "name": "uromodulin N-glycosylated 144 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G38022PE. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G38022PE. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054123", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054123" } ] }, { "name": "uromodulin N-glycosylated 145 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G40554DX. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G40554DX. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054124", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054124" } ] }, { "name": "uromodulin N-glycosylated 146 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G41981MA. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G41981MA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054125", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054125" } ] }, { "name": "uromodulin N-glycosylated 147 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G45560HM. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G45560HM. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054126", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054126" } ] }, { "name": "uromodulin N-glycosylated 148 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G46185ND. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G46185ND. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054127", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054127" } ] }, { "name": "uromodulin N-glycosylated 149 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G47007PV. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G47007PV. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054128", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054128" } ] }, { "name": "uromodulin N-glycosylated 150 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G47975JA. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G47975JA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054129", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054129" } ] }, { "name": "uromodulin N-glycosylated 151 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G49305IN. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G49305IN. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054130", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054130" } ] }, { "name": "uromodulin N-glycosylated 152 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan composition is represented by GlyTouCan:G49739MP. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G49739MP. [PRO:DNx, PMID:22171320]", "evidence": [ { "id": "PR:000054131", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054131" } ] }, { "name": "uromodulin N-glycosylated 153 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G51098AA. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G51098AA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054132", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054132" } ] }, { "name": "uromodulin N-glycosylated 154 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G52676LZ. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G52676LZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054133", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054133" } ] }, { "name": "uromodulin N-glycosylated 155 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G53752TA. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G53752TA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054134", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054134" } ] }, { "name": "uromodulin N-glycosylated 156 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G54018RP. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G54018RP. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054135", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054135" } ] }, { "name": "uromodulin N-glycosylated 157 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G56318NV. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G56318NV. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054136", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054136" } ] }, { "name": "uromodulin N-glycosylated 158 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G56499YQ. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G56499YQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054137", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054137" } ] }, { "name": "uromodulin N-glycosylated 159 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G57565TQ. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G57565TQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054138", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054138" } ] }, { "name": "uromodulin N-glycosylated 160 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G57835AK. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G57835AK. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054139", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054139" } ] }, { "name": "uromodulin N-glycosylated 161 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G57955DP. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G57955DP. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054140", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054140" } ] }, { "name": "uromodulin N-glycosylated 162 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G60227QI. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G60227QI. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054141", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054141" } ] }, { "name": "uromodulin N-glycosylated 163 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G60439QY. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G60439QY. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054142", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054142" } ] }, { "name": "uromodulin N-glycosylated 164 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G65449BO. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G65449BO. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054143", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054143" } ] }, { "name": "uromodulin N-glycosylated 165 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G67173FM. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G67173FM. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054144", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054144" } ] }, { "name": "uromodulin N-glycosylated 166 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G68668TB. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G68668TB. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054145", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054145" } ] }, { "name": "uromodulin N-glycosylated 167 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G69170UT. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G69170UT. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054146", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054146" } ] }, { "name": "uromodulin N-glycosylated 168 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G71906BW. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G71906BW. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054147", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054147" } ] }, { "name": "uromodulin N-glycosylated 169 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G75120WS. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G75120WS. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054148", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054148" } ] }, { "name": "uromodulin N-glycosylated 170 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G76294TY. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G76294TY. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054149", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054149" } ] }, { "name": "uromodulin N-glycosylated 171 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G77252PU. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G77252PU. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054150", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054150" } ] }, { "name": "uromodulin N-glycosylated 172 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G78030KJ. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G78030KJ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054151", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054151" } ] }, { "name": "uromodulin N-glycosylated 173 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G79565XA. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G79565XA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054152", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054152" } ] }, { "name": "uromodulin N-glycosylated 174 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G80319WU. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G80319WU. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054153", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054153" } ] }, { "name": "uromodulin N-glycosylated 175 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G80966KZ. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G80966KZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054154", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054154" } ] }, { "name": "uromodulin N-glycosylated 176 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G82811EP. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G82811EP. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054155", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054155" } ] }, { "name": "uromodulin N-glycosylated 177 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G82894XV. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G82894XV. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054156", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054156" } ] }, { "name": "uromodulin N-glycosylated 178 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G90542MP. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G90542MP. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054157", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054157" } ] }, { "name": "uromodulin N-glycosylated 179 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G90987JA. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G90987JA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054158", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054158" } ] }, { "name": "uromodulin N-glycosylated 180 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G91365ZQ. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G91365ZQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054159", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054159" } ] }, { "name": "uromodulin N-glycosylated 181 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G91413ZX. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G91413ZX. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054160", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054160" } ] }, { "name": "uromodulin N-glycosylated 182 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G92681HQ. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G92681HQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054161", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054161" } ] }, { "name": "uromodulin N-glycosylated 183 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G92974UU. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G92974UU. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054162", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054162" } ] }, { "name": "uromodulin N-glycosylated 184 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G94047VH. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G94047VH. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054163", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054163" } ] }, { "name": "uromodulin N-glycosylated 185 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G94531EZ. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G94531EZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054164", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054164" } ] }, { "name": "uromodulin N-glycosylated 186 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G94876HV. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G94876HV. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054165", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054165" } ] }, { "name": "uromodulin N-glycosylated 187 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G96921ZU. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G96921ZU. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054166", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054166" } ] }, { "name": "uromodulin N-glycosylated 188 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G99808VS. Example: UniProtKB:P07911-1, Asn-322, MOD:00160~GNO:G99808VS. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054167", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054167" } ] }, { "name": "uromodulin N-glycosylated 189 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G03895SR. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G03895SR. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054168", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054168" } ] }, { "name": "uromodulin N-glycosylated 190 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G09118YK. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G09118YK. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054169", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054169" } ] }, { "name": "uromodulin N-glycosylated 191 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G11041DA. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G11041DA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054170", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054170" } ] }, { "name": "uromodulin N-glycosylated 192 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G11671GQ. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G11671GQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054171", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054171" } ] }, { "name": "uromodulin N-glycosylated 193 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G12222NC. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G12222NC. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054172", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054172" } ] }, { "name": "uromodulin N-glycosylated 194 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G14047PA. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G14047PA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054173", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054173" } ] }, { "name": "uromodulin N-glycosylated 195 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G16774YZ. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G16774YZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054174", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054174" } ] }, { "name": "uromodulin N-glycosylated 196 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G17540HT. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G17540HT. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054175", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054175" } ] }, { "name": "uromodulin N-glycosylated 197 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G17689DH. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G17689DH. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054176", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054176" } ] }, { "name": "uromodulin N-glycosylated 198 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G19469VZ. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G19469VZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054177", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054177" } ] }, { "name": "uromodulin N-glycosylated 199 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G23345GE. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G23345GE. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054178", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054178" } ] }, { "name": "uromodulin N-glycosylated 200 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G24413UY. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G24413UY. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054179", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054179" } ] }, { "name": "uromodulin N-glycosylated 201 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G26935KA. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G26935KA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054180", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054180" } ] }, { "name": "uromodulin N-glycosylated 202 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G29676WX. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G29676WX. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054181", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054181" } ] }, { "name": "uromodulin N-glycosylated 203 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G31532GK. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G31532GK. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054182", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054182" } ] }, { "name": "uromodulin N-glycosylated 204 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G32659RY. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G32659RY. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054183", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054183" } ] }, { "name": "uromodulin N-glycosylated 205 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G33241WC. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G33241WC. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054184", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054184" } ] }, { "name": "uromodulin N-glycosylated 206 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G38022PE. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G38022PE. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054185", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054185" } ] }, { "name": "uromodulin N-glycosylated 207 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G40554DX. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G40554DX. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054186", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054186" } ] }, { "name": "uromodulin N-glycosylated 208 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G41981MA. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G41981MA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054187", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054187" } ] }, { "name": "uromodulin N-glycosylated 209 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G45560HM. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G45560HM. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054188", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054188" } ] }, { "name": "uromodulin N-glycosylated 210 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G46185ND. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G46185ND. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054189", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054189" } ] }, { "name": "uromodulin N-glycosylated 211 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G47007PV. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G47007PV. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054190", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054190" } ] }, { "name": "uromodulin N-glycosylated 212 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G47975JA. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G47975JA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054191", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054191" } ] }, { "name": "uromodulin N-glycosylated 213 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G49305IN. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G49305IN. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054192", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054192" } ] }, { "name": "uromodulin N-glycosylated 214 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G51098AA. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G51098AA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054193", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054193" } ] }, { "name": "uromodulin N-glycosylated 215 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G52676LZ. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G52676LZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054194", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054194" } ] }, { "name": "uromodulin N-glycosylated 216 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G53752TA. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G53752TA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054195", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054195" } ] }, { "name": "uromodulin N-glycosylated 217 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G54018RP. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G54018RP. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054196", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054196" } ] }, { "name": "uromodulin N-glycosylated 218 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G56318NV. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G56318NV. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054197", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054197" } ] }, { "name": "uromodulin N-glycosylated 219 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G56499YQ. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G56499YQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054198", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054198" } ] }, { "name": "uromodulin N-glycosylated 220 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G57565TQ. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G57565TQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054199", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054199" } ] }, { "name": "uromodulin N-glycosylated 221 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G57835AK. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G57835AK. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054200", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054200" } ] }, { "name": "uromodulin N-glycosylated 222 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G57955DP. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G57955DP. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054201", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054201" } ] }, { "name": "uromodulin N-glycosylated 223 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan composition is represented by GlyTouCan:G60033FS. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G60033FS. [PRO:DNx, PMID:22171320]", "evidence": [ { "id": "PR:000054202", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054202" } ] }, { "name": "uromodulin N-glycosylated 224 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G60227QI. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G60227QI. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054203", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054203" } ] }, { "name": "uromodulin N-glycosylated 225 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G60439QY. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G60439QY. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054204", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054204" } ] }, { "name": "uromodulin N-glycosylated 226 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G65449BO. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G65449BO. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054205", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054205" } ] }, { "name": "uromodulin N-glycosylated 227 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G67173FM. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G67173FM. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054206", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054206" } ] }, { "name": "uromodulin N-glycosylated 228 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G68668TB. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G68668TB. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054207", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054207" } ] }, { "name": "uromodulin N-glycosylated 229 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G69170UT. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G69170UT. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054208", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054208" } ] }, { "name": "uromodulin N-glycosylated 230 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G71906BW. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G71906BW. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054209", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054209" } ] }, { "name": "uromodulin N-glycosylated 231 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G75120WS. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G75120WS. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054210", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054210" } ] }, { "name": "uromodulin N-glycosylated 232 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G76294TY. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G76294TY. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054211", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054211" } ] }, { "name": "uromodulin N-glycosylated 233 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G77252PU. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G77252PU. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054212", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054212" } ] }, { "name": "uromodulin N-glycosylated 234 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G78030KJ. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G78030KJ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054213", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054213" } ] }, { "name": "uromodulin N-glycosylated 235 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G79565XA. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G79565XA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054214", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054214" } ] }, { "name": "uromodulin N-glycosylated 236 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G80319WU. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G80319WU. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054215", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054215" } ] }, { "name": "uromodulin N-glycosylated 237 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G80966KZ. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G80966KZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054216", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054216" } ] }, { "name": "uromodulin N-glycosylated 238 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G82811EP. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G82811EP. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054217", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054217" } ] }, { "name": "uromodulin N-glycosylated 239 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G82894XV. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G82894XV. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054218", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054218" } ] }, { "name": "uromodulin N-glycosylated 240 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G90542MP. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G90542MP. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054219", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054219" } ] }, { "name": "uromodulin N-glycosylated 241 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G90987JA. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G90987JA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054220", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054220" } ] }, { "name": "uromodulin N-glycosylated 242 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G91365ZQ. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G91365ZQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054221", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054221" } ] }, { "name": "uromodulin N-glycosylated 243 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G91413ZX. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G91413ZX. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054222", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054222" } ] }, { "name": "uromodulin N-glycosylated 244 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G92681HQ. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G92681HQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054223", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054223" } ] }, { "name": "uromodulin N-glycosylated 245 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G92974UU. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G92974UU. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054224", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054224" } ] }, { "name": "uromodulin N-glycosylated 246 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G94047VH. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G94047VH. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054225", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054225" } ] }, { "name": "uromodulin N-glycosylated 247 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G94531EZ. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G94531EZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054226", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054226" } ] }, { "name": "uromodulin N-glycosylated 248 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G94876HV. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G94876HV. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054227", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054227" } ] }, { "name": "uromodulin N-glycosylated 249 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G96921ZU. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G96921ZU. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054228", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054228" } ] }, { "name": "uromodulin N-glycosylated 250 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G99808VS. Example: UniProtKB:P07911-1, Asn-396, MOD:00160~GNO:G99808VS. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054229", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054229" } ] }, { "name": "uromodulin N-glycosylated 251 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G03895SR. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G03895SR. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054230", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054230" } ] }, { "name": "uromodulin N-glycosylated 252 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G09118YK. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G09118YK. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054231", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054231" } ] }, { "name": "uromodulin N-glycosylated 253 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G11041DA. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G11041DA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054232", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054232" } ] }, { "name": "uromodulin N-glycosylated 254 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G11671GQ. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G11671GQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054233", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054233" } ] }, { "name": "uromodulin N-glycosylated 255 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G12222NC. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G12222NC. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054234", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054234" } ] }, { "name": "uromodulin N-glycosylated 256 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G14047PA. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G14047PA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054235", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054235" } ] }, { "name": "uromodulin N-glycosylated 257 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G16774YZ. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G16774YZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054236", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054236" } ] }, { "name": "uromodulin N-glycosylated 258 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G17540HT. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G17540HT. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054237", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054237" } ] }, { "name": "uromodulin N-glycosylated 259 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G17689DH. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G17689DH. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054238", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054238" } ] }, { "name": "uromodulin N-glycosylated 260 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G19469VZ. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G19469VZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054239", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054239" } ] }, { "name": "uromodulin N-glycosylated 261 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G23345GE. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G23345GE. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054240", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054240" } ] }, { "name": "uromodulin N-glycosylated 262 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G24413UY. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G24413UY. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054241", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054241" } ] }, { "name": "uromodulin N-glycosylated 263 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G26935KA. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G26935KA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054242", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054242" } ] }, { "name": "uromodulin N-glycosylated 264 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G29676WX. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G29676WX. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054243", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054243" } ] }, { "name": "uromodulin N-glycosylated 265 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G31532GK. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G31532GK. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054244", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054244" } ] }, { "name": "uromodulin N-glycosylated 266 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G32659RY. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G32659RY. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054245", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054245" } ] }, { "name": "uromodulin N-glycosylated 267 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G33241WC. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G33241WC. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054246", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054246" } ] }, { "name": "uromodulin N-glycosylated 268 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G38022PE. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G38022PE. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054247", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054247" } ] }, { "name": "uromodulin N-glycosylated 269 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G40554DX. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G40554DX. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054248", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054248" } ] }, { "name": "uromodulin N-glycosylated 270 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G41981MA. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G41981MA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054249", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054249" } ] }, { "name": "uromodulin N-glycosylated 271 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G45560HM. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G45560HM. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054250", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054250" } ] }, { "name": "uromodulin N-glycosylated 272 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G46185ND. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G46185ND. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054251", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054251" } ] }, { "name": "uromodulin N-glycosylated 273 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G47007PV. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G47007PV. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054252", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054252" } ] }, { "name": "uromodulin N-glycosylated 274 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G47975JA. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G47975JA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054253", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054253" } ] }, { "name": "uromodulin N-glycosylated 275 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G49305IN. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G49305IN. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054254", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054254" } ] }, { "name": "uromodulin N-glycosylated 276 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G51098AA. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G51098AA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054255", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054255" } ] }, { "name": "uromodulin N-glycosylated 277 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G52676LZ. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G52676LZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054256", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054256" } ] }, { "name": "uromodulin N-glycosylated 278 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G53752TA. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G53752TA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054257", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054257" } ] }, { "name": "uromodulin N-glycosylated 279 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G54018RP. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G54018RP. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054258", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054258" } ] }, { "name": "uromodulin N-glycosylated 280 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G56318NV. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G56318NV. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054259", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054259" } ] }, { "name": "uromodulin N-glycosylated 281 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G56499YQ. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G56499YQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054260", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054260" } ] }, { "name": "uromodulin N-glycosylated 282 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G57565TQ. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G57565TQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054261", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054261" } ] }, { "name": "uromodulin N-glycosylated 283 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G57835AK. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G57835AK. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054262", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054262" } ] }, { "name": "uromodulin N-glycosylated 284 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G57955DP. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G57955DP. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054263", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054263" } ] }, { "name": "uromodulin N-glycosylated 285 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G60227QI. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G60227QI. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054264", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054264" } ] }, { "name": "uromodulin N-glycosylated 286 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G60439QY. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G60439QY. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054265", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054265" } ] }, { "name": "uromodulin N-glycosylated 287 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G65449BO. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G65449BO. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054266", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054266" } ] }, { "name": "uromodulin N-glycosylated 288 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G67173FM. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G67173FM. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054267", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054267" } ] }, { "name": "uromodulin N-glycosylated 289 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G68668TB. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G68668TB. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054268", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054268" } ] }, { "name": "uromodulin N-glycosylated 290 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G69170UT. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G69170UT. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054269", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054269" } ] }, { "name": "uromodulin N-glycosylated 291 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G71906BW. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G71906BW. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054270", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054270" } ] }, { "name": "uromodulin N-glycosylated 292 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G75120WS. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G75120WS. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054271", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054271" } ] }, { "name": "uromodulin N-glycosylated 293 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G76294TY. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G76294TY. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054272", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054272" } ] }, { "name": "uromodulin N-glycosylated 294 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G77252PU. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G77252PU. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054273", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054273" } ] }, { "name": "uromodulin N-glycosylated 295 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G78030KJ. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G78030KJ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054274", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054274" } ] }, { "name": "uromodulin N-glycosylated 296 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G79565XA. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G79565XA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054275", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054275" } ] }, { "name": "uromodulin N-glycosylated 297 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G80319WU. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G80319WU. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054276", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054276" } ] }, { "name": "uromodulin N-glycosylated 298 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G80966KZ. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G80966KZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054277", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054277" } ] }, { "name": "uromodulin N-glycosylated 299 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G82811EP. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G82811EP. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054278", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054278" } ] }, { "name": "uromodulin N-glycosylated 300 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G82894XV. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G82894XV. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054279", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054279" } ] }, { "name": "uromodulin N-glycosylated 301 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G90542MP. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G90542MP. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054280", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054280" } ] }, { "name": "uromodulin N-glycosylated 302 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G90987JA. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G90987JA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054281", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054281" } ] }, { "name": "uromodulin N-glycosylated 303 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G91365ZQ. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G91365ZQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054282", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054282" } ] }, { "name": "uromodulin N-glycosylated 304 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G91413ZX. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G91413ZX. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054283", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054283" } ] }, { "name": "uromodulin N-glycosylated 305 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G92681HQ. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G92681HQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054284", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054284" } ] }, { "name": "uromodulin N-glycosylated 306 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G92974UU. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G92974UU. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054285", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054285" } ] }, { "name": "uromodulin N-glycosylated 307 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G94047VH. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G94047VH. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054286", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054286" } ] }, { "name": "uromodulin N-glycosylated 308 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G94531EZ. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G94531EZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054287", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054287" } ] }, { "name": "uromodulin N-glycosylated 309 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G94876HV. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G94876HV. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054288", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054288" } ] }, { "name": "uromodulin N-glycosylated 310 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G96921ZU. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G96921ZU. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054289", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054289" } ] }, { "name": "uromodulin N-glycosylated 311 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-513 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G99808VS. Example: UniProtKB:P07911-1, Asn-513, MOD:00160~GNO:G99808VS. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054290", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054290" } ] }, { "name": "uromodulin N-glycosylated 312 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G03895SR. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G03895SR. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054291", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054291" } ] }, { "name": "uromodulin N-glycosylated 313 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G09118YK. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G09118YK. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054292", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054292" } ] }, { "name": "uromodulin N-glycosylated 314 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G11041DA. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G11041DA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054293", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054293" } ] }, { "name": "uromodulin N-glycosylated 315 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G11671GQ. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G11671GQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054294", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054294" } ] }, { "name": "uromodulin N-glycosylated 316 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G12222NC. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G12222NC. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054295", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054295" } ] }, { "name": "uromodulin N-glycosylated 317 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G14047PA. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G14047PA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054296", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054296" } ] }, { "name": "uromodulin N-glycosylated 318 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G16774YZ. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G16774YZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054297", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054297" } ] }, { "name": "uromodulin N-glycosylated 319 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G17540HT. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G17540HT. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054298", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054298" } ] }, { "name": "uromodulin N-glycosylated 320 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G17689DH. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G17689DH. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054299", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054299" } ] }, { "name": "uromodulin N-glycosylated 321 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G19469VZ. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G19469VZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054300", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054300" } ] }, { "name": "uromodulin N-glycosylated 322 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G23345GE. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G23345GE. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054301", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054301" } ] }, { "name": "uromodulin N-glycosylated 323 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G24413UY. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G24413UY. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054302", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054302" } ] }, { "name": "uromodulin N-glycosylated 324 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G26935KA. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G26935KA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054303", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054303" } ] }, { "name": "uromodulin N-glycosylated 325 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G29676WX. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G29676WX. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054304", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054304" } ] }, { "name": "uromodulin N-glycosylated 326 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G31532GK. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G31532GK. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054305", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054305" } ] }, { "name": "uromodulin N-glycosylated 327 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G32659RY. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G32659RY. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054306", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054306" } ] }, { "name": "uromodulin N-glycosylated 328 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G33241WC. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G33241WC. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054307", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054307" } ] }, { "name": "uromodulin N-glycosylated 329 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G38022PE. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G38022PE. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054308", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054308" } ] }, { "name": "uromodulin N-glycosylated 330 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G40554DX. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G40554DX. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054309", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054309" } ] }, { "name": "uromodulin N-glycosylated 331 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G41981MA. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G41981MA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054310", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054310" } ] }, { "name": "uromodulin N-glycosylated 332 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G45560HM. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G45560HM. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054311", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054311" } ] }, { "name": "uromodulin N-glycosylated 333 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G46185ND. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G46185ND. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054312", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054312" } ] }, { "name": "uromodulin N-glycosylated 334 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G47007PV. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G47007PV. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054313", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054313" } ] }, { "name": "uromodulin N-glycosylated 335 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G47975JA. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G47975JA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054314", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054314" } ] }, { "name": "uromodulin N-glycosylated 336 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G49305IN. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G49305IN. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054315", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054315" } ] }, { "name": "uromodulin N-glycosylated 337 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G51098AA. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G51098AA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054316", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054316" } ] }, { "name": "uromodulin N-glycosylated 338 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G52676LZ. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G52676LZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054317", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054317" } ] }, { "name": "uromodulin N-glycosylated 339 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G53752TA. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G53752TA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054318", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054318" } ] }, { "name": "uromodulin N-glycosylated 340 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G54018RP. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G54018RP. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054319", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054319" } ] }, { "name": "uromodulin N-glycosylated 341 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G56318NV. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G56318NV. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054320", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054320" } ] }, { "name": "uromodulin N-glycosylated 342 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G56499YQ. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G56499YQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054321", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054321" } ] }, { "name": "uromodulin N-glycosylated 343 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G57565TQ. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G57565TQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054322", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054322" } ] }, { "name": "uromodulin N-glycosylated 344 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G57835AK. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G57835AK. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054323", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054323" } ] }, { "name": "uromodulin N-glycosylated 345 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G57955DP. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G57955DP. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054324", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054324" } ] }, { "name": "uromodulin N-glycosylated 346 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G60227QI. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G60227QI. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054325", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054325" } ] }, { "name": "uromodulin N-glycosylated 347 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G60439QY. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G60439QY. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054326", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054326" } ] }, { "name": "uromodulin N-glycosylated 348 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G65449BO. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G65449BO. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054327", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054327" } ] }, { "name": "uromodulin N-glycosylated 349 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G67173FM. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G67173FM. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054328", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054328" } ] }, { "name": "uromodulin N-glycosylated 350 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G68668TB. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G68668TB. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054329", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054329" } ] }, { "name": "uromodulin N-glycosylated 351 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G69170UT. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G69170UT. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054330", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054330" } ] }, { "name": "uromodulin N-glycosylated 352 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G71906BW. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G71906BW. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054331", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054331" } ] }, { "name": "uromodulin N-glycosylated 353 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G75120WS. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G75120WS. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054332", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054332" } ] }, { "name": "uromodulin N-glycosylated 354 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G76294TY. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G76294TY. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054333", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054333" } ] }, { "name": "uromodulin N-glycosylated 355 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G77252PU. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G77252PU. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054334", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054334" } ] }, { "name": "uromodulin N-glycosylated 356 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G78030KJ. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G78030KJ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054335", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054335" } ] }, { "name": "uromodulin N-glycosylated 357 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G79565XA. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G79565XA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054336", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054336" } ] }, { "name": "uromodulin N-glycosylated 358 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G80319WU. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G80319WU. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054337", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054337" } ] }, { "name": "uromodulin N-glycosylated 359 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G80966KZ. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G80966KZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054338", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054338" } ] }, { "name": "uromodulin N-glycosylated 360 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G82811EP. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G82811EP. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054339", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054339" } ] }, { "name": "uromodulin N-glycosylated 361 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G82894XV. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G82894XV. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054340", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054340" } ] }, { "name": "uromodulin N-glycosylated 362 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G90542MP. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G90542MP. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054341", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054341" } ] }, { "name": "uromodulin N-glycosylated 363 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G90987JA. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G90987JA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054342", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054342" } ] }, { "name": "uromodulin N-glycosylated 364 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G91365ZQ. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G91365ZQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054343", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054343" } ] }, { "name": "uromodulin N-glycosylated 365 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G91413ZX. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G91413ZX. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054344", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054344" } ] }, { "name": "uromodulin N-glycosylated 366 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G92681HQ. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G92681HQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054345", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054345" } ] }, { "name": "uromodulin N-glycosylated 367 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G92974UU. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G92974UU. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054346", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054346" } ] }, { "name": "uromodulin N-glycosylated 368 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G94047VH. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G94047VH. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054347", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054347" } ] }, { "name": "uromodulin N-glycosylated 369 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G94531EZ. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G94531EZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054348", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054348" } ] }, { "name": "uromodulin N-glycosylated 370 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G94876HV. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G94876HV. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054349", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054349" } ] }, { "name": "uromodulin N-glycosylated 371 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G96921ZU. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G96921ZU. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054350", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054350" } ] }, { "name": "uromodulin N-glycosylated 372 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-76 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G99808VS. Example: UniProtKB:P07911-1, Asn-76, MOD:00160~GNO:G99808VS. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054351", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054351" } ] }, { "name": "uromodulin N-glycosylated 373 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G03895SR. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G03895SR. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054352", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054352" } ] }, { "name": "uromodulin N-glycosylated 374 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G09118YK. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G09118YK. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054353", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054353" } ] }, { "name": "uromodulin N-glycosylated 375 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G11041DA. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G11041DA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054354", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054354" } ] }, { "name": "uromodulin N-glycosylated 376 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G11671GQ. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G11671GQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054355", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054355" } ] }, { "name": "uromodulin N-glycosylated 377 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G12222NC. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G12222NC. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054356", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054356" } ] }, { "name": "uromodulin N-glycosylated 378 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G14047PA. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G14047PA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054357", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054357" } ] }, { "name": "uromodulin N-glycosylated 379 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G16774YZ. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G16774YZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054358", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054358" } ] }, { "name": "uromodulin N-glycosylated 380 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G17540HT. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G17540HT. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054359", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054359" } ] }, { "name": "uromodulin N-glycosylated 381 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G17689DH. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G17689DH. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054360", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054360" } ] }, { "name": "uromodulin N-glycosylated 382 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G19469VZ. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G19469VZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054361", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054361" } ] }, { "name": "uromodulin N-glycosylated 383 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G23345GE. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G23345GE. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054362", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054362" } ] }, { "name": "uromodulin N-glycosylated 384 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G24413UY. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G24413UY. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054363", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054363" } ] }, { "name": "uromodulin N-glycosylated 385 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G26935KA. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G26935KA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054364", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054364" } ] }, { "name": "uromodulin N-glycosylated 386 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G29676WX. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G29676WX. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054365", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054365" } ] }, { "name": "uromodulin N-glycosylated 387 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G31532GK. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G31532GK. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054366", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054366" } ] }, { "name": "uromodulin N-glycosylated 388 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G32659RY. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G32659RY. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054367", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054367" } ] }, { "name": "uromodulin N-glycosylated 389 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G33241WC. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G33241WC. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054368", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054368" } ] }, { "name": "uromodulin N-glycosylated 390 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G38022PE. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G38022PE. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054369", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054369" } ] }, { "name": "uromodulin N-glycosylated 391 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G40554DX. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G40554DX. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054370", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054370" } ] }, { "name": "uromodulin N-glycosylated 392 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G41981MA. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G41981MA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054371", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054371" } ] }, { "name": "uromodulin N-glycosylated 393 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G45560HM. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G45560HM. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054372", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054372" } ] }, { "name": "uromodulin N-glycosylated 394 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G46185ND. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G46185ND. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054373", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054373" } ] }, { "name": "uromodulin N-glycosylated 395 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G47007PV. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G47007PV. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054374", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054374" } ] }, { "name": "uromodulin N-glycosylated 396 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G47975JA. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G47975JA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054375", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054375" } ] }, { "name": "uromodulin N-glycosylated 397 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G49305IN. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G49305IN. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054376", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054376" } ] }, { "name": "uromodulin N-glycosylated 398 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G51098AA. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G51098AA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054377", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054377" } ] }, { "name": "uromodulin N-glycosylated 399 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G52676LZ. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G52676LZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054378", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054378" } ] }, { "name": "uromodulin N-glycosylated 400 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G53752TA. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G53752TA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054379", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054379" } ] }, { "name": "uromodulin N-glycosylated 401 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G54018RP. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G54018RP. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054380", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054380" } ] }, { "name": "uromodulin N-glycosylated 402 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G56318NV. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G56318NV. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054381", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054381" } ] }, { "name": "uromodulin N-glycosylated 403 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G56499YQ. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G56499YQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054382", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054382" } ] }, { "name": "uromodulin N-glycosylated 404 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G57565TQ. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G57565TQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054383", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054383" } ] }, { "name": "uromodulin N-glycosylated 405 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G57835AK. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G57835AK. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054384", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054384" } ] }, { "name": "uromodulin N-glycosylated 406 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G57955DP. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G57955DP. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054385", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054385" } ] }, { "name": "uromodulin N-glycosylated 407 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G60227QI. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G60227QI. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054386", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054386" } ] }, { "name": "uromodulin N-glycosylated 408 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G60439QY. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G60439QY. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054387", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054387" } ] }, { "name": "uromodulin N-glycosylated 409 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G65449BO. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G65449BO. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054388", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054388" } ] }, { "name": "uromodulin N-glycosylated 410 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G67173FM. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G67173FM. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054389", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054389" } ] }, { "name": "uromodulin N-glycosylated 411 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G68668TB. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G68668TB. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054390", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054390" } ] }, { "name": "uromodulin N-glycosylated 412 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G69170UT. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G69170UT. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054391", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054391" } ] }, { "name": "uromodulin N-glycosylated 413 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G71906BW. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G71906BW. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054392", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054392" } ] }, { "name": "uromodulin N-glycosylated 414 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G75120WS. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G75120WS. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054393", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054393" } ] }, { "name": "uromodulin N-glycosylated 415 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G76294TY. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G76294TY. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054394", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054394" } ] }, { "name": "uromodulin N-glycosylated 416 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G77252PU. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G77252PU. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054395", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054395" } ] }, { "name": "uromodulin N-glycosylated 417 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G78030KJ. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G78030KJ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054396", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054396" } ] }, { "name": "uromodulin N-glycosylated 418 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G79565XA. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G79565XA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054397", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054397" } ] }, { "name": "uromodulin N-glycosylated 419 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G80319WU. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G80319WU. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054398", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054398" } ] }, { "name": "uromodulin N-glycosylated 420 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G80966KZ. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G80966KZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054399", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054399" } ] }, { "name": "uromodulin N-glycosylated 421 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G82811EP. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G82811EP. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054400", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054400" } ] }, { "name": "uromodulin N-glycosylated 422 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G82894XV. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G82894XV. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054401", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054401" } ] }, { "name": "uromodulin N-glycosylated 423 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G90542MP. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G90542MP. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054402", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054402" } ] }, { "name": "uromodulin N-glycosylated 424 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G90987JA. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G90987JA. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054403", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054403" } ] }, { "name": "uromodulin N-glycosylated 425 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G91365ZQ. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G91365ZQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054404", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054404" } ] }, { "name": "uromodulin N-glycosylated 426 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G91413ZX. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G91413ZX. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054405", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054405" } ] }, { "name": "uromodulin N-glycosylated 427 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G92681HQ. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G92681HQ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054406", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054406" } ] }, { "name": "uromodulin N-glycosylated 428 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G92974UU. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G92974UU. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054407", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054407" } ] }, { "name": "uromodulin N-glycosylated 429 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G94047VH. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G94047VH. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054408", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054408" } ] }, { "name": "uromodulin N-glycosylated 430 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G94531EZ. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G94531EZ. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054409", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054409" } ] }, { "name": "uromodulin N-glycosylated 431 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G94876HV. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G94876HV. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054410", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054410" } ] }, { "name": "uromodulin N-glycosylated 432 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G96921ZU. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G96921ZU. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054411", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054411" } ] }, { "name": "uromodulin N-glycosylated 433 (human)", "definition": "A uromodulin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07911-1, in which the glycan structure is represented by GlyTouCan:G99808VS. Example: UniProtKB:P07911-1, Asn-80, MOD:00160~GNO:G99808VS. [PRO:DNx, PMID:2136357, PMID:9884403]", "evidence": [ { "id": "PR:000054412", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054412" } ] } ], "site_annotation": [ { "start_pos": 232, "end_pos": 234, "annotation": "n_glycosylation_sequon" }, { "start_pos": 275, "end_pos": 277, "annotation": "n_glycosylation_sequon" }, { "start_pos": 322, "end_pos": 324, "annotation": "n_glycosylation_sequon" }, { "start_pos": 38, "end_pos": 40, "annotation": "n_glycosylation_sequon" }, { "start_pos": 396, "end_pos": 398, "annotation": "n_glycosylation_sequon" }, { "start_pos": 513, "end_pos": 515, "annotation": "n_glycosylation_sequon" }, { "start_pos": 76, "end_pos": 78, "annotation": "n_glycosylation_sequon" }, { "start_pos": 80, "end_pos": 82, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "N-glycosylated (PubMed:19005207, PubMed:26673890, PubMed:26811476, PubMed:32815518, PubMed:33196145). N-glycan heterogeneity at Asn-232: Hex7HexNAc6 (major) and dHex1Hex7HexNAc6 (minor); at Asn-322: dHex1Hex6HexNAc5 (minor), dHex1Hex7HexNAc6 (major) and dHex1Hex8HexNAc7 (minor); at Asn-396: Hex6HexNAc5 (major), dHex1Hex6HexNAc5 (minor) and Hex7HexNAc6 (minor) (PubMed:22171320). Glycosylated Asn-232 interacts with E.coli adhesin fimH (PubMed:32616672). Other complex glycosylation sites may serve as binding sites for proteins from other bacteria inclduding K.pneumoniae, P.aeruginosa and S.mitis (PubMed:32616672).", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" }, { "database": "PubMed", "id": "26811476", "url": "https://glygen.org/publication/PubMed/26811476" }, { "database": "PubMed", "id": "32815518", "url": "https://glygen.org/publication/PubMed/32815518" }, { "database": "PubMed", "id": "32616672", "url": "https://glygen.org/publication/PubMed/32616672" }, { "database": "PubMed", "id": "19005207", "url": "https://glygen.org/publication/PubMed/19005207" }, { "database": "PubMed", "id": "22171320", "url": "https://glygen.org/publication/PubMed/22171320" }, { "database": "PubMed", "id": "26673890", "url": "https://glygen.org/publication/PubMed/26673890" }, { "database": "PubMed", "id": "33196145", "url": "https://glygen.org/publication/PubMed/33196145" } ] }, { "annotation": "Proteolytically cleaved at a conserved C-terminal proteolytic cleavage site to generate the secreted form found in urine (PubMed:18375198, PubMed:19005207). This cleavage is catalyzed by HPN (PubMed:26673890).", "evidence": [ { "database": "UniProtKB", "id": "P07911", "url": "https://www.uniprot.org/uniprot/P07911" }, { "database": "PubMed", "id": "18375198", "url": "https://glygen.org/publication/PubMed/18375198" }, { "database": "PubMed", "id": "19005207", "url": "https://glygen.org/publication/PubMed/19005207" }, { "database": "PubMed", "id": "26673890", "url": "https://glygen.org/publication/PubMed/26673890" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 38, 76, 80, 232, 275, 322, 396, 513 ], "o_linked_sites": [ 89, 154, 225, 252, 277, 292, 296, 504, 511 ], "snv_sites": [ 25, 40, 76, 78, 80, 87, 232, 234, 252, 259, 275, 277, 292, 322, 324, 360, 396, 398, 403, 449, 495, 515, 581, 594, 634 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 232, "end_pos": 234 }, { "start_pos": 275, "end_pos": 277 }, { "start_pos": 322, "end_pos": 324 }, { "start_pos": 38, "end_pos": 40 }, { "start_pos": 396, "end_pos": 398 }, { "start_pos": 513, "end_pos": 515 }, { "start_pos": 76, "end_pos": 78 }, { "start_pos": 80, "end_pos": 82 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 724 }, { "field": "total_sites", "count": 18 }, { "field": "n_linked_glycans", "count": 230 }, { "field": "n_linked_glycan_sites", "count": 16 }, { "field": "o_linked_glycans", "count": 10 }, { "field": "o_linked_glycan_sites", "count": 9 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 8 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 716 }, { "field": "total_sites", "count": 17 }, { "field": "n_linked_glycans", "count": 230 }, { "field": "n_linked_glycan_sites", "count": 8 }, { "field": "o_linked_glycans", "count": 10 }, { "field": "o_linked_glycan_sites", "count": 9 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 32 }, { "field": "total_sites", "count": 25 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 30 }, { "field": "total_sites", "count": 23 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }