{ "uniprot_canonical_ac": "P07602-1", "uniprot_ac": "P07602", "uniprot_id": "SAP_HUMAN", "mass": { "chemical_mass": 58113.0, "monoisotopic_mass": 58113.0 }, "refseq": { "ac": "NP_001035930", "name": "prosaposin isoform b preproprotein", "summary": "This gene encodes a highly conserved preproprotein that is proteolytically processed to generate four main cleavage products including saposins A, B, C, and D. Each domain of the precursor protein is approximately 80 amino acid residues long with nearly identical placement of cysteine residues and glycosylation sites. Saposins A-D localize primarily to the lysosomal compartment where they facilitate the catabolism of glycosphingolipids with short oligosaccharide groups. The precursor protein exists both as a secretory protein and as an integral membrane protein and has neurotrophic activities. Mutations in this gene have been associated with Gaucher disease and metachromatic leukodystrophy. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Feb 2016].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035930" }, "gene_names": [ { "name": "PSAP", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P07602", "id": "P07602" }, { "name": "GLBA; PARK24; PSAPD; SAP1; SAP2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035930", "id": "NP_001035930" }, { "name": "GLBA", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P07602", "id": "P07602" }, { "name": "PSAP", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035930", "id": "NP_001035930" }, { "name": "SAP1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P07602", "id": "P07602" } ], "protein_names": [ { "name": "Prosaposin", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P07602" }, { "name": "A1 activator", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07602" }, { "name": "CSAct", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07602" }, { "name": "Cerebroside sulfate activator", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07602" }, { "name": "Co-beta-glucosidase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07602" }, { "name": "Component C", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07602" }, { "name": "Dispersin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07602" }, { "name": "Glucosylceramidase activator", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07602" }, { "name": "Proactivator polypeptide", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07602" }, { "name": "Protein A", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07602" }, { "name": "Protein C", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07602" }, { "name": "SAP-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07602" }, { "name": "SAP-2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07602" }, { "name": "Sphingolipid activator protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07602" }, { "name": "Sphingolipid activator protein 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07602" }, { "name": "Sulfatide/GM1 activator", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07602" }, { "name": "prosaposin isoform b preproprotein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035930", "id": "NP_001035930" }, { "name": "sphingolipid activator protein-1; proactivator polypeptide; sphingolipid activator protein-2; saposin-A; saposin-B; saposin-C; saposin-D; precursor of saposins", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035930", "id": "NP_001035930" } ], "function": [ { "annotation": "Behaves as a myelinotrophic and neurotrophic factor, these effects are mediated by its G-protein-coupled receptors, GPR37 and GPR37L1, undergoing ligand-mediated internalization followed by ERK phosphorylation signaling.", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602#function" }, { "database": "UniProtKB", "id": "Q61207", "url": "https://www.uniprot.org/uniprot/Q61207#function" }, { "database": "PubMed", "id": "10383054", "url": "https://glygen.org/publication/PubMed/10383054" } ] }, { "annotation": "Efficient progranulin exit from the ER requires its interaction with prosaposin, a Surf4 cargo.", "evidence": [ { "database": "RefSeq", "id": "NP_001035930", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035930" }, { "database": "PubMed", "id": "34919127", "url": "https://glygen.org/publication/PubMed/34919127" } ] }, { "annotation": "Loss of Lysosomal Proteins Progranulin and Prosaposin Associated with Increased Neurofibrillary Tangle Development in Alzheimer Disease.", "evidence": [ { "database": "RefSeq", "id": "NP_001035930", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035930" }, { "database": "PubMed", "id": "34374777", "url": "https://glygen.org/publication/PubMed/34374777" } ] }, { "annotation": "Prosaposin, tumor-secreted protein, promotes pancreatic cancer progression by decreasing tumor-infiltrating lymphocytes.", "evidence": [ { "database": "RefSeq", "id": "NP_001035930", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035930" }, { "database": "PubMed", "id": "35633503", "url": "https://glygen.org/publication/PubMed/35633503" } ] }, { "annotation": "Saposin-A and saposin-C stimulate the hydrolysis of glucosylceramide by beta-glucosylceramidase (EC 3.2.1.45) and galactosylceramide by beta-galactosylceramidase (EC 3.2.1.46). Saposin-C apparently acts by combining with the enzyme and acidic lipid to form an activated complex, rather than by solubilizing the substrate.", "evidence": [ { "database": "UniProtKB", "id": "A0A0J9YXB8", "url": "https://www.uniprot.org/uniprot/A0A0J9YXB8#function" }, { "database": "UniProtKB", "id": "ARBA00037150", "url": "https://www.uniprot.org/uniprot/ARBA00037150#function" }, { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602#function" } ] }, { "annotation": "Saposin-B stimulates the hydrolysis of galacto-cerebroside sulfate by arylsulfatase A (EC 3.1.6.8), GM1 gangliosides by beta-galactosidase (EC 3.2.1.23) and globotriaosylceramide by alpha-galactosidase A (EC 3.2.1.22). Saposin-B forms a solubilizing complex with the substrates of the sphingolipid hydrolases.", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602#function" } ] }, { "annotation": "Saposin-D is a specific sphingomyelin phosphodiesterase activator (EC 3.1.4.12).", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602#function" } ] }, { "annotation": "Saposins are specific low-molecular mass non-enzymic proteins, they participate in the lysosomal degradation of sphingolipids, which takes place by the sequential action of specific hydrolases.", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602#function" } ] }, { "annotation": "Single-cell RNA-sequencing analysis reveals enhanced non-canonical neurotrophic factor signaling in the subacute phase of traumatic brain injury.", "evidence": [ { "database": "RefSeq", "id": "NP_001035930", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035930" }, { "database": "PubMed", "id": "37269057", "url": "https://glygen.org/publication/PubMed/37269057" } ] }, { "annotation": "This gene encodes a highly conserved preproprotein that is proteolytically processed to generate four main cleavage products including saposins A, B, C, and D. Each domain of the precursor protein is approximately 80 amino acid residues long with nearly identical placement of cysteine residues and glycosylation sites. Saposins A-D localize primarily to the lysosomal compartment where they facilitate the catabolism of glycosphingolipids with short oligosaccharide groups. The precursor protein exists both as a secretory protein and as an integral membrane protein and has neurotrophic activities. Mutations in this gene have been associated with Gaucher disease and metachromatic leukodystrophy. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Feb 2016].", "evidence": [ { "database": "RefSeq", "id": "NP_001035930", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035930" } ] } ], "disease": [ { "disease_id": "DOID:0110961", "recommended_name": { "id": "DOID:0110961", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110961", "name": "atypical Gaucher's disease due to saposin c deficiency", "description": "A Gaucher's disease that has_material_basis_in compound heterozygous mutation in the PSAP gene on chromosome 10q22.1." }, "synonyms": [ { "id": "MONDO:0012517", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012517", "name": "Gaucher disease due to saposin C deficiency", "description": "Any Gaucher disease in which the cause of the disease is a mutation in the PSAP gene." }, { "id": "MONDO:0012517", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012517", "name": "Gaucher disease caused by mutation in PSAP", "description": "" }, { "id": "MONDO:0012517", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012517", "name": "PSAP Gaucher disease", "description": "" }, { "id": "MONDO:0012517", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012517", "name": "atypical Gaucher disease due to saposin C deficiency", "description": "" }, { "id": "MONDO:0012517", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012517", "name": "atypical Gaucher's disease due to saposin c deficiency", "description": "" }, { "id": "MONDO:0012517", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012517", "name": "Gaucher disease, atypical", "description": "" }, { "id": "MONDO:0012517", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012517", "name": "Gaucher disease, atypical, due to saposin C deficiency", "description": "" }, { "id": "MIM:610539", "resource": "MIM", "url": "https://www.omim.org/entry/610539", "name": "Gaucher disease, atypical, due to saposin C deficiency", "description": "Gaucher disease, atypical, due to saposin C deficiency" } ], "evidence": [ { "id": "0012517", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012517" }, { "id": "610539", "database": "MIM", "url": "https://www.omim.org/entry/610539" } ] }, { "disease_id": "DOID:0111330", "recommended_name": { "id": "DOID:0111330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111330", "name": "combined saposin deficiency", "description": "A sphingolipidosis characterized by absence of expression of both isoforms of PSAP (SAP1 and SAP2) resulting in hepatosplenomegaly and severe neurological disease that has_material_basis_in homozygous or coumpound heterozygous mutation in PSAP on 10q22.1." }, "synonyms": [ { "id": "DOID:0111330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111330", "name": "PSAPD", "description": "" }, { "id": "DOID:0111330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111330", "name": "combined SAP deficiency", "description": "" }, { "id": "DOID:0111330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111330", "name": "encephalopathy due to prosaposin deficiency", "description": "" }, { "id": "MONDO:0012719", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012719", "name": "combined PSAP deficiency", "description": "Encephalopathy due to prosaposin deficiency is a lysosomal storage disease belonging to the group of sphingolipidoses." }, { "id": "MONDO:0012719", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012719", "name": "combined prosaposin deficiency", "description": "" }, { "id": "MONDO:0012719", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012719", "name": "encephalopathy due to prosaposin deficiency", "description": "" }, { "id": "MONDO:0012719", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012719", "name": "PSAPD", "description": "" }, { "id": "MONDO:0012719", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012719", "name": "combined SAP deficiency", "description": "" }, { "id": "MONDO:0012719", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012719", "name": "combined Sap deficiency", "description": "" }, { "id": "MONDO:0012719", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012719", "name": "combined saposin deficiency", "description": "" }, { "id": "MONDO:0012719", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012719", "name": "prosaposin deficiency", "description": "" }, { "id": "MIM:611721", "resource": "MIM", "url": "https://www.omim.org/entry/611721", "name": "Combined saposin deficiency", "description": "Combined saposin deficiency" } ], "evidence": [ { "id": "0012719", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012719" }, { "id": "611721", "database": "MIM", "url": "https://www.omim.org/entry/611721" } ] }, { "disease_id": "DOID:10581", "recommended_name": { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system." }, "synonyms": [ { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "MLD", "description": "" }, { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "Scholz cerebral sclerosis", "description": "" }, { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "arylsulfatase A deficiency", "description": "" }, { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "deficiency of cerebroside-sulfatase", "description": "" }, { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "sulfatide lipoidosis", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, juvenile form", "description": "Metachromatic leukodystrophy is an inherited condition characterized by the accumulation of fats called sulfatides in cells, especially cells of the nervous system. This accumulation results in progressive destruction of white matter of the brain, which consists of nerve fibers covered by myelin.Affected individuals experience progressive deterioration of intellectual functions and motor skills, such as the ability to walk. They also develop loss of sensation in the extremities, incontinence, seizures, paralysis, inability to speak, blindness, and hearing loss. Eventually they lose awareness of their surroundings and become unresponsive. This condition is inherited in an autosomal recessive pattern and is caused by mutations in the ARSA and PSAP genes." }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "MLD, juvenile form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "arylsulfatase A deficiency, juvenile form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, juvenile form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "ARSA deficiency", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "MLD", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "Mld", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "arylsulfatase A deficiency", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "cerebral sclerosis diffuse metachromatic form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "cerebral sclerosis, diffuse, metachromatic form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "cerebroside sulfatase deficiency", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "leukodystrophy metachromatic", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, adult", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, juvenile", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, late infantile", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukoencephalopathy", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "pseudoarylsulfatase A deficiency", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "sulfatide lipidosis", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "metachromatic leukodystrophy due to saposin B deficiency", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "metachromatic leukodystrophy due to sap-B deficiency", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "metachromatic leukodystrophy due to saposin b deficiency", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "metachromatic leukodystrophy due to cerebroside sulfatase activator deficiency", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "saposin B deficiency", "description": "" }, { "id": "MIM:250100", "resource": "MIM", "url": "https://www.omim.org/entry/250100", "name": "Metachromatic leukodystrophy", "description": "Metachromatic leukodystrophy" }, { "id": "MIM:249900", "resource": "MIM", "url": "https://www.omim.org/entry/249900", "name": "Metachromatic leukodystrophy due to saposin B deficiency", "description": "Metachromatic leukodystrophy due to saposin B deficiency" } ], "evidence": [ { "id": "0009590", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590" }, { "id": "249900", "database": "MIM", "url": "https://www.omim.org/entry/249900" }, { "id": "5660", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/5660#disease" } ] }, { "disease_id": "MONDO:0012720", "recommended_name": { "id": "MONDO:0012720", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012720", "name": "Krabbe disease due to saposin A deficiency", "description": "" }, "synonyms": [ { "id": "MONDO:0012720", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012720", "name": "Krabbe disease, atypical", "description": "" }, { "id": "MONDO:0012720", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012720", "name": "Krabbe disease, atypical due to saposin A deficiency", "description": "" }, { "id": "MONDO:0012720", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012720", "name": "Krabbe disease, atypical, due to saposin A deficiency", "description": "" }, { "id": "MONDO:0012720", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012720", "name": "saposin A deficiency", "description": "" }, { "id": "MIM:611722", "resource": "MIM", "url": "https://www.omim.org/entry/611722", "name": "Krabbe disease, atypical, due to saposin A deficiency", "description": "Krabbe disease, atypical, due to saposin A deficiency" } ], "evidence": [ { "id": "611722", "database": "MIM", "url": "https://www.omim.org/entry/611722" } ] }, { "disease_id": "MONDO:0859183", "recommended_name": { "id": "MONDO:0859183", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0859183", "name": "Parkinson disease 24, autosomal dominant, susceptibility to", "description": "" }, "synonyms": [ { "id": "MIM:619491", "resource": "MIM", "url": "https://www.omim.org/entry/619491", "name": "Parkinson disease 24, autosomal dominant", "description": "Parkinson disease 24, autosomal dominant" } ], "evidence": [ { "id": "619491", "database": "MIM", "url": "https://www.omim.org/entry/619491" } ] } ], "snv": [ { "evidence": [ { "id": "P07602", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07602" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 103, "end_pos": 103, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "A", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NMS->NMA); o-glyco-site-loss (S->A).", "chr_id": "10", "chr_pos": "71831194", "ref_nt": "A", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "S103", "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs121918103", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs121918103" }, { "id": "rs121918103", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs121918103" }, { "id": "rs121918103", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs121918103#frequency_tab" }, { "id": "rs121918103", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs121918103" }, { "id": "2302219", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2302219" }, { "id": "2320574", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2320574" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 217, "end_pos": 217, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->NSI); o-glyco-site-loss (T->I).", "chr_id": "10", "chr_pos": "71828084", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T217", "keywords": [ "ebi", "germline", "disease" ], "disease": [ { "disease_id": "DOID:10581", "recommended_name": { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system." }, "synonyms": [ { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "MLD", "description": "" }, { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "Scholz cerebral sclerosis", "description": "" }, { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "arylsulfatase A deficiency", "description": "" }, { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "deficiency of cerebroside-sulfatase", "description": "" }, { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "sulfatide lipoidosis", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, juvenile form", "description": "Metachromatic leukodystrophy is an inherited condition characterized by the accumulation of fats called sulfatides in cells, especially cells of the nervous system. This accumulation results in progressive destruction of white matter of the brain, which consists of nerve fibers covered by myelin.Affected individuals experience progressive deterioration of intellectual functions and motor skills, such as the ability to walk. They also develop loss of sensation in the extremities, incontinence, seizures, paralysis, inability to speak, blindness, and hearing loss. Eventually they lose awareness of their surroundings and become unresponsive. This condition is inherited in an autosomal recessive pattern and is caused by mutations in the ARSA and PSAP genes." }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "MLD, juvenile form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "arylsulfatase A deficiency, juvenile form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, juvenile form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "ARSA deficiency", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "MLD", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "Mld", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "arylsulfatase A deficiency", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "cerebral sclerosis diffuse metachromatic form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "cerebral sclerosis, diffuse, metachromatic form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "cerebroside sulfatase deficiency", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "leukodystrophy metachromatic", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, adult", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, juvenile", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, late infantile", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukoencephalopathy", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "pseudoarylsulfatase A deficiency", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "sulfatide lipidosis", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "metachromatic leukodystrophy due to saposin B deficiency", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "metachromatic leukodystrophy due to sap-B deficiency", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "metachromatic leukodystrophy due to saposin b deficiency", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "metachromatic leukodystrophy due to cerebroside sulfatase activator deficiency", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "saposin B deficiency", "description": "" }, { "id": "MIM:250100", "resource": "MIM", "url": "https://www.omim.org/entry/250100", "name": "Metachromatic leukodystrophy", "description": "Metachromatic leukodystrophy" }, { "id": "MIM:249900", "resource": "MIM", "url": "https://www.omim.org/entry/249900", "name": "Metachromatic leukodystrophy due to saposin B deficiency", "description": "Metachromatic leukodystrophy due to saposin B deficiency" } ] } ] }, { "evidence": [ { "id": "rs121918107", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs121918107" }, { "id": "rs121918107", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs121918107" }, { "id": "10682309", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10682309" }, { "id": "17561962", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17561962" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 215, "end_pos": 215, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->HST).", "chr_id": "10", "chr_pos": "71828091", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N215", "disease": [ { "disease_id": "DOID:10581", "recommended_name": { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system." }, "synonyms": [ { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "MLD", "description": "" }, { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "Scholz cerebral sclerosis", "description": "" }, { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "arylsulfatase A deficiency", "description": "" }, { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "deficiency of cerebroside-sulfatase", "description": "" }, { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "sulfatide lipoidosis", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, juvenile form", "description": "Metachromatic leukodystrophy is an inherited condition characterized by the accumulation of fats called sulfatides in cells, especially cells of the nervous system. This accumulation results in progressive destruction of white matter of the brain, which consists of nerve fibers covered by myelin.Affected individuals experience progressive deterioration of intellectual functions and motor skills, such as the ability to walk. They also develop loss of sensation in the extremities, incontinence, seizures, paralysis, inability to speak, blindness, and hearing loss. Eventually they lose awareness of their surroundings and become unresponsive. This condition is inherited in an autosomal recessive pattern and is caused by mutations in the ARSA and PSAP genes." }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "MLD, juvenile form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "arylsulfatase A deficiency, juvenile form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, juvenile form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "ARSA deficiency", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "MLD", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "Mld", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "arylsulfatase A deficiency", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "cerebral sclerosis diffuse metachromatic form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "cerebral sclerosis, diffuse, metachromatic form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "cerebroside sulfatase deficiency", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "leukodystrophy metachromatic", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, adult", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, juvenile", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, late infantile", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukoencephalopathy", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "pseudoarylsulfatase A deficiency", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "sulfatide lipidosis", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "metachromatic leukodystrophy due to saposin B deficiency", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "metachromatic leukodystrophy due to sap-B deficiency", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "metachromatic leukodystrophy due to saposin b deficiency", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "metachromatic leukodystrophy due to cerebroside sulfatase activator deficiency", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "saposin B deficiency", "description": "" }, { "id": "MIM:250100", "resource": "MIM", "url": "https://www.omim.org/entry/250100", "name": "Metachromatic leukodystrophy", "description": "Metachromatic leukodystrophy" }, { "id": "MIM:249900", "resource": "MIM", "url": "https://www.omim.org/entry/249900", "name": "Metachromatic leukodystrophy due to saposin B deficiency", "description": "Metachromatic leukodystrophy due to saposin B deficiency" } ] } ], "keywords": [ "ebi", "germline", "disease" ] }, { "evidence": [ { "id": "rs770171865", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770171865" }, { "id": "rs770171865", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770171865" }, { "id": "rs770171865", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770171865" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 215, "end_pos": 215, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->KST).", "chr_id": "10", "chr_pos": "71828089", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N215", "disease": [ { "disease_id": "DOID:10581", "recommended_name": { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system." }, "synonyms": [ { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "MLD", "description": "" }, { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "Scholz cerebral sclerosis", "description": "" }, { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "arylsulfatase A deficiency", "description": "" }, { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "deficiency of cerebroside-sulfatase", "description": "" }, { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "sulfatide lipoidosis", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, juvenile form", "description": "Metachromatic leukodystrophy is an inherited condition characterized by the accumulation of fats called sulfatides in cells, especially cells of the nervous system. This accumulation results in progressive destruction of white matter of the brain, which consists of nerve fibers covered by myelin.Affected individuals experience progressive deterioration of intellectual functions and motor skills, such as the ability to walk. They also develop loss of sensation in the extremities, incontinence, seizures, paralysis, inability to speak, blindness, and hearing loss. Eventually they lose awareness of their surroundings and become unresponsive. This condition is inherited in an autosomal recessive pattern and is caused by mutations in the ARSA and PSAP genes." }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "MLD, juvenile form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "arylsulfatase A deficiency, juvenile form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, juvenile form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "ARSA deficiency", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "MLD", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "Mld", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "arylsulfatase A deficiency", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "cerebral sclerosis diffuse metachromatic form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "cerebral sclerosis, diffuse, metachromatic form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "cerebroside sulfatase deficiency", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "leukodystrophy metachromatic", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, adult", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, juvenile", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, late infantile", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukoencephalopathy", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "pseudoarylsulfatase A deficiency", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "sulfatide lipidosis", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "metachromatic leukodystrophy due to saposin B deficiency", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "metachromatic leukodystrophy due to sap-B deficiency", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "metachromatic leukodystrophy due to saposin b deficiency", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "metachromatic leukodystrophy due to cerebroside sulfatase activator deficiency", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "saposin B deficiency", "description": "" }, { "id": "MIM:250100", "resource": "MIM", "url": "https://www.omim.org/entry/250100", "name": "Metachromatic leukodystrophy", "description": "Metachromatic leukodystrophy" }, { "id": "MIM:249900", "resource": "MIM", "url": "https://www.omim.org/entry/249900", "name": "Metachromatic leukodystrophy due to saposin B deficiency", "description": "Metachromatic leukodystrophy due to saposin B deficiency" } ] } ], "keywords": [ "ebi", "germline", "disease" ] }, { "evidence": [ { "id": "rs1589449870", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1589449870" }, { "id": "rs1589449870", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1589449870" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 245, "end_pos": 245, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NYI->NYT).", "chr_id": "10", "chr_pos": "71825880", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I245", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs145404688", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145404688" }, { "id": "rs145404688", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145404688" }, { "id": "rs145404688", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs145404688#frequency_tab" }, { "id": "rs145404688", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs145404688" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 289, "end_pos": 289, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "10", "chr_pos": "71821920", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S289", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P07602", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07602" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 289, "end_pos": 289, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->Y).", "chr_id": "10", "chr_pos": "71821919", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S289", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs546727182", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs546727182" }, { "id": "rs546727182", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs546727182" }, { "id": "rs546727182", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs546727182" }, { "id": "rs546727182", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs546727182#frequency_tab" }, { "id": "rs546727182", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs546727182" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 332, "end_pos": 332, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->KKT).", "chr_id": "10", "chr_pos": "71820249", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "0.000399", "site_lbl": "N332", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P07602", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07602" }, { "id": "rs202125074", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs202125074" }, { "id": "rs202125074", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs202125074" }, { "id": "rs202125074", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs202125074" }, { "id": "rs202125074", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs202125074#frequency_tab" }, { "id": "rs202125074", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs202125074" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 391, "end_pos": 391, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "M", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->M).", "chr_id": "10", "chr_pos": "71819734", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "T391", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:0111330", "recommended_name": { "id": "DOID:0111330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111330", "name": "combined saposin deficiency", "description": "A sphingolipidosis characterized by absence of expression of both isoforms of PSAP (SAP1 and SAP2) resulting in hepatosplenomegaly and severe neurological disease that has_material_basis_in homozygous or coumpound heterozygous mutation in PSAP on 10q22.1." }, "synonyms": [ { "id": "DOID:0111330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111330", "name": "PSAPD", "description": "" }, { "id": "DOID:0111330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111330", "name": "combined SAP deficiency", "description": "" }, { "id": "DOID:0111330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111330", "name": "encephalopathy due to prosaposin deficiency", "description": "" }, { "id": "MONDO:0012719", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012719", "name": "combined PSAP deficiency", "description": "Encephalopathy due to prosaposin deficiency is a lysosomal storage disease belonging to the group of sphingolipidoses." }, { "id": "MONDO:0012719", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012719", "name": "combined prosaposin deficiency", "description": "" }, { "id": "MONDO:0012719", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012719", "name": "encephalopathy due to prosaposin deficiency", "description": "" }, { "id": "MONDO:0012719", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012719", "name": "PSAPD", "description": "" }, { "id": "MONDO:0012719", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012719", "name": "combined SAP deficiency", "description": "" }, { "id": "MONDO:0012719", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012719", "name": "combined Sap deficiency", "description": "" }, { "id": "MONDO:0012719", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012719", "name": "combined saposin deficiency", "description": "" }, { "id": "MONDO:0012719", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012719", "name": "prosaposin deficiency", "description": "" }, { "id": "MIM:611721", "resource": "MIM", "url": "https://www.omim.org/entry/611721", "name": "Combined saposin deficiency", "description": "Combined saposin deficiency" } ] }, { "disease_id": "DOID:0110961", "recommended_name": { "id": "DOID:0110961", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110961", "name": "atypical Gaucher's disease due to saposin c deficiency", "description": "A Gaucher's disease that has_material_basis_in compound heterozygous mutation in the PSAP gene on chromosome 10q22.1." }, "synonyms": [ { "id": "MONDO:0012517", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012517", "name": "Gaucher disease due to saposin C deficiency", "description": "Any Gaucher disease in which the cause of the disease is a mutation in the PSAP gene." }, { "id": "MONDO:0012517", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012517", "name": "Gaucher disease caused by mutation in PSAP", "description": "" }, { "id": "MONDO:0012517", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012517", "name": "PSAP Gaucher disease", "description": "" }, { "id": "MONDO:0012517", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012517", "name": "atypical Gaucher disease due to saposin C deficiency", "description": "" }, { "id": "MONDO:0012517", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012517", "name": "atypical Gaucher's disease due to saposin c deficiency", "description": "" }, { "id": "MONDO:0012517", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012517", "name": "Gaucher disease, atypical", "description": "" }, { "id": "MONDO:0012517", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012517", "name": "Gaucher disease, atypical, due to saposin C deficiency", "description": "" }, { "id": "MIM:610539", "resource": "MIM", "url": "https://www.omim.org/entry/610539", "name": "Gaucher disease, atypical, due to saposin C deficiency", "description": "Gaucher disease, atypical, due to saposin C deficiency" } ] }, { "disease_id": "DOID:10581", "recommended_name": { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system." }, "synonyms": [ { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "MLD", "description": "" }, { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "Scholz cerebral sclerosis", "description": "" }, { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "arylsulfatase A deficiency", "description": "" }, { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "deficiency of cerebroside-sulfatase", "description": "" }, { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "sulfatide lipoidosis", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, juvenile form", "description": "Metachromatic leukodystrophy is an inherited condition characterized by the accumulation of fats called sulfatides in cells, especially cells of the nervous system. This accumulation results in progressive destruction of white matter of the brain, which consists of nerve fibers covered by myelin.Affected individuals experience progressive deterioration of intellectual functions and motor skills, such as the ability to walk. They also develop loss of sensation in the extremities, incontinence, seizures, paralysis, inability to speak, blindness, and hearing loss. Eventually they lose awareness of their surroundings and become unresponsive. This condition is inherited in an autosomal recessive pattern and is caused by mutations in the ARSA and PSAP genes." }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "MLD, juvenile form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "arylsulfatase A deficiency, juvenile form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, juvenile form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "ARSA deficiency", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "MLD", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "Mld", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "arylsulfatase A deficiency", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "cerebral sclerosis diffuse metachromatic form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "cerebral sclerosis, diffuse, metachromatic form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "cerebroside sulfatase deficiency", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "leukodystrophy metachromatic", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, adult", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, juvenile", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, late infantile", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukoencephalopathy", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "pseudoarylsulfatase A deficiency", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "sulfatide lipidosis", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "metachromatic leukodystrophy due to saposin B deficiency", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "metachromatic leukodystrophy due to sap-B deficiency", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "metachromatic leukodystrophy due to saposin b deficiency", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "metachromatic leukodystrophy due to cerebroside sulfatase activator deficiency", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "saposin B deficiency", "description": "" }, { "id": "MIM:250100", "resource": "MIM", "url": "https://www.omim.org/entry/250100", "name": "Metachromatic leukodystrophy", "description": "Metachromatic leukodystrophy" }, { "id": "MIM:249900", "resource": "MIM", "url": "https://www.omim.org/entry/249900", "name": "Metachromatic leukodystrophy due to saposin B deficiency", "description": "Metachromatic leukodystrophy due to saposin B deficiency" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs568336161", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs568336161" }, { "id": "rs568336161", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs568336161" }, { "id": "rs568336161", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs568336161" }, { "id": "rs568336161", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs568336161" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 397, "end_pos": 397, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "10", "chr_pos": "71819716", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "T397", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs778297201", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778297201" }, { "id": "rs778297201", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778297201" }, { "id": "rs778297201", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778297201" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 401, "end_pos": 401, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->P).", "chr_id": "10", "chr_pos": "71819614", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T401", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs148676984", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs148676984" }, { "id": "rs148676984", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs148676984" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 427, "end_pos": 427, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "10", "chr_pos": "71819536", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S427", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs748633704", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748633704" }, { "id": "rs748633704", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748633704" }, { "id": "rs748633704", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748633704" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 427, "end_pos": 427, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->N).", "chr_id": "10", "chr_pos": "71819535", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S427", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs200379457", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200379457" }, { "id": "rs200379457", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200379457" }, { "id": "rs200379457", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200379457" }, { "id": "rs200379457", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200379457" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 428, "end_pos": 428, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->NSA).", "chr_id": "10", "chr_pos": "71819533", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "T428", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs754702748", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754702748" }, { "id": "rs754702748", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754702748" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 56, "end_pos": 56, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NKP->NKS).", "chr_id": "10", "chr_pos": "71834380", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P56", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P07602", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07602" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 60, "end_pos": 60, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "F", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "10", "chr_pos": "71831916", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S60", "disease": [ { "disease_id": "DOID:1319", "recommended_name": { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." }, "synonyms": [ { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "tumor of the Brain", "description": "" } ] }, { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] }, { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs570654892", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs570654892" }, { "id": "rs570654892", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs570654892" }, { "id": "rs570654892", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs570654892" }, { "id": "rs570654892", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs570654892#frequency_tab" }, { "id": "rs570654892", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs570654892" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 80, "end_pos": 80, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "10", "chr_pos": "71831856", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "0.000399", "site_lbl": "N80", "disease": [ { "disease_id": "DOID:10581", "recommended_name": { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "metachromatic leukodystrophy", "description": "A sphingolipidosis characterized by the accumulation of sulfatides in cells, especially the myelin producing cells of the nervous system." }, "synonyms": [ { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "MLD", "description": "" }, { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "Scholz cerebral sclerosis", "description": "" }, { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "arylsulfatase A deficiency", "description": "" }, { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "deficiency of cerebroside-sulfatase", "description": "" }, { "id": "DOID:10581", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10581", "name": "sulfatide lipoidosis", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, juvenile form", "description": "Metachromatic leukodystrophy is an inherited condition characterized by the accumulation of fats called sulfatides in cells, especially cells of the nervous system. This accumulation results in progressive destruction of white matter of the brain, which consists of nerve fibers covered by myelin.Affected individuals experience progressive deterioration of intellectual functions and motor skills, such as the ability to walk. They also develop loss of sensation in the extremities, incontinence, seizures, paralysis, inability to speak, blindness, and hearing loss. Eventually they lose awareness of their surroundings and become unresponsive. This condition is inherited in an autosomal recessive pattern and is caused by mutations in the ARSA and PSAP genes." }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "MLD, juvenile form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "arylsulfatase A deficiency, juvenile form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, juvenile form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "ARSA deficiency", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "MLD", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "Mld", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "arylsulfatase A deficiency", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "cerebral sclerosis diffuse metachromatic form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "cerebral sclerosis, diffuse, metachromatic form", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "cerebroside sulfatase deficiency", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "leukodystrophy metachromatic", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, adult", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, juvenile", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukodystrophy, late infantile", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "metachromatic leukoencephalopathy", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "pseudoarylsulfatase A deficiency", "description": "" }, { "id": "MONDO:0009591", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009591", "name": "sulfatide lipidosis", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "metachromatic leukodystrophy due to saposin B deficiency", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "metachromatic leukodystrophy due to sap-B deficiency", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "metachromatic leukodystrophy due to saposin b deficiency", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "metachromatic leukodystrophy due to cerebroside sulfatase activator deficiency", "description": "" }, { "id": "MONDO:0009590", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009590", "name": "saposin B deficiency", "description": "" }, { "id": "MIM:250100", "resource": "MIM", "url": "https://www.omim.org/entry/250100", "name": "Metachromatic leukodystrophy", "description": "Metachromatic leukodystrophy" }, { "id": "MIM:249900", "resource": "MIM", "url": "https://www.omim.org/entry/249900", "name": "Metachromatic leukodystrophy due to saposin B deficiency", "description": "Metachromatic leukodystrophy due to saposin B deficiency" } ] } ], "keywords": [ "ebi", "germline", "disease" ] }, { "evidence": [ { "id": "rs756941744", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756941744" }, { "id": "rs756941744", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756941744" }, { "id": "rs756941744", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs756941744#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 93, "end_pos": 93, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "10", "chr_pos": "71831224", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T93", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 240, "end_pos": 240, "sequence_org": "I", "sequence_mut": "C", "comment": "Strongly decreases stimulation of cerebroside sulfate hydrolysis.", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" }, { "database": "PubMed", "id": "12518053", "url": "https://glygen.org/publication/PubMed/12518053" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "99.6", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000197746", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197746" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "98.92", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000197746", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197746" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "99.6", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000197746", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197746" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "99.55", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000197746", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197746" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.77", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000197746", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197746" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "99.63", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000197746", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197746" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "98.86", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000197746", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197746" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "99.52", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000197746", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197746" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "99.65", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000197746", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197746" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "99.42", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000197746", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197746" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "99.35", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000197746", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197746" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "99.65", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000197746", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197746" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "99.68", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000197746", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197746" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P07602", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07602" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P07602", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07602" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P07602", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07602" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P07602", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07602" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P07602", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07602" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P07602", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07602" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P07602", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07602" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P07602", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07602" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P07602", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07602" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P07602", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07602" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P07602", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07602" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P07602", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07602" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "common_name": "Human" } ], "gene": [ { "name": "PSAP", "url": "https://www.uniprot.org/uniprot/P07602", "locus": { "chromosome": "10", "start_pos": 71816298, "end_pos": 71851251, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000197746", "url": "https://www.ensembl.org/id/ENSG00000197746" } ] } } ], "crossref": [ { "id": "ENSG00000197746", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000197746", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P07602", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07602", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "CHEMBL3580523", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3580523", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "PSAP", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=PSAP", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "5660", "url": "https://www.ncbi.nlm.nih.gov/gene/5660", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "9498", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=9498", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P07602", "url": "https://www.ebi.ac.uk/intact/interactors/id:P07602*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR003119", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003119", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007856", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007856", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008138", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008138", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008139", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008139", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008373", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008373", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011001", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011001", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR021165", "url": "https://www.ebi.ac.uk/interpro/entry/IPR021165", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:5660", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5660", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "176801", "url": "http://www.omim.org/entry/176801", "database": "MIM", "categories": [ "Other" ] }, { "id": "249900", "url": "http://www.omim.org/entry/249900", "database": "MIM", "categories": [ "Other" ] }, { "id": "610539", "url": "http://www.omim.org/entry/610539", "database": "MIM", "categories": [ "Other" ] }, { "id": "611721", "url": "http://www.omim.org/entry/611721", "database": "MIM", "categories": [ "Other" ] }, { "id": "611722", "url": "http://www.omim.org/entry/611722", "database": "MIM", "categories": [ "Other" ] }, { "id": "619491", "url": "http://www.omim.org/entry/619491", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P07602", "url": "https://www.nextprot.org/entry/NX_P07602", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P07602", "url": "https://oglcnac.org/atlas/detail/P07602", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P07602", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07602", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "7299at2759", "url": "http://www.orthodb.org/?query=7299at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11480", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11480", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11480:SF36", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11480:SF36", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1M12", "url": "https://www.rcsb.org/structure/1M12", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1N69", "url": "https://www.rcsb.org/structure/1N69", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1SN6", "url": "https://www.rcsb.org/structure/1SN6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2DOB", "url": "https://www.rcsb.org/structure/2DOB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2GTG", "url": "https://www.rcsb.org/structure/2GTG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2QYP", "url": "https://www.rcsb.org/structure/2QYP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2R0R", "url": "https://www.rcsb.org/structure/2R0R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2R1Q", "url": "https://www.rcsb.org/structure/2R1Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2RB3", "url": "https://www.rcsb.org/structure/2RB3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2Z9A", "url": "https://www.rcsb.org/structure/2Z9A", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3BQP", "url": "https://www.rcsb.org/structure/3BQP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3BQQ", "url": "https://www.rcsb.org/structure/3BQQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4DDJ", "url": "https://www.rcsb.org/structure/4DDJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4UEX", "url": "https://www.rcsb.org/structure/4UEX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4V2O", "url": "https://www.rcsb.org/structure/4V2O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6SLR", "url": "https://www.rcsb.org/structure/6SLR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8EQU", "url": "https://www.rcsb.org/structure/8EQU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF02199", "url": "http://pfam.xfam.org/family/PF02199", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF03489", "url": "http://pfam.xfam.org/family/PF03489", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF05184", "url": "http://pfam.xfam.org/family/PF05184", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P07602", "url": "https://pharos.nih.gov/targets/P07602", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000053864", "url": "https://proconsortium.org/app/entry/PR:000053864", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053865", "url": "https://proconsortium.org/app/entry/PR:000053865", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053866", "url": "https://proconsortium.org/app/entry/PR:000053866", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053867", "url": "https://proconsortium.org/app/entry/PR:000053867", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053868", "url": "https://proconsortium.org/app/entry/PR:000053868", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053869", "url": "https://proconsortium.org/app/entry/PR:000053869", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053870", "url": "https://proconsortium.org/app/entry/PR:000053870", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053871", "url": "https://proconsortium.org/app/entry/PR:000053871", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053872", "url": "https://proconsortium.org/app/entry/PR:000053872", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053873", "url": "https://proconsortium.org/app/entry/PR:000053873", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053874", "url": "https://proconsortium.org/app/entry/PR:000053874", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053875", "url": "https://proconsortium.org/app/entry/PR:000053875", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053876", "url": "https://proconsortium.org/app/entry/PR:000053876", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053877", "url": "https://proconsortium.org/app/entry/PR:000053877", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053878", "url": "https://proconsortium.org/app/entry/PR:000053878", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053879", "url": "https://proconsortium.org/app/entry/PR:000053879", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053880", "url": "https://proconsortium.org/app/entry/PR:000053880", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053881", "url": "https://proconsortium.org/app/entry/PR:000053881", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053882", "url": "https://proconsortium.org/app/entry/PR:000053882", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053883", "url": "https://proconsortium.org/app/entry/PR:000053883", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053884", "url": "https://proconsortium.org/app/entry/PR:000053884", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053885", "url": "https://proconsortium.org/app/entry/PR:000053885", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053886", "url": "https://proconsortium.org/app/entry/PR:000053886", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053887", "url": "https://proconsortium.org/app/entry/PR:000053887", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053888", "url": "https://proconsortium.org/app/entry/PR:000053888", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053889", "url": "https://proconsortium.org/app/entry/PR:000053889", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053890", "url": "https://proconsortium.org/app/entry/PR:000053890", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053891", "url": "https://proconsortium.org/app/entry/PR:000053891", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053892", "url": "https://proconsortium.org/app/entry/PR:000053892", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053893", "url": "https://proconsortium.org/app/entry/PR:000053893", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053894", "url": "https://proconsortium.org/app/entry/PR:000053894", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053895", "url": "https://proconsortium.org/app/entry/PR:000053895", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053896", "url": "https://proconsortium.org/app/entry/PR:000053896", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053897", "url": "https://proconsortium.org/app/entry/PR:000053897", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053898", "url": "https://proconsortium.org/app/entry/PR:000053898", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053899", "url": "https://proconsortium.org/app/entry/PR:000053899", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053900", "url": "https://proconsortium.org/app/entry/PR:000053900", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053901", "url": "https://proconsortium.org/app/entry/PR:000053901", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053902", "url": "https://proconsortium.org/app/entry/PR:000053902", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053903", "url": "https://proconsortium.org/app/entry/PR:000053903", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053904", "url": "https://proconsortium.org/app/entry/PR:000053904", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053905", "url": "https://proconsortium.org/app/entry/PR:000053905", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053906", "url": "https://proconsortium.org/app/entry/PR:000053906", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053907", "url": "https://proconsortium.org/app/entry/PR:000053907", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053908", "url": "https://proconsortium.org/app/entry/PR:000053908", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053909", "url": "https://proconsortium.org/app/entry/PR:000053909", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053910", "url": "https://proconsortium.org/app/entry/PR:000053910", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053911", "url": "https://proconsortium.org/app/entry/PR:000053911", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053912", "url": "https://proconsortium.org/app/entry/PR:000053912", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053913", "url": "https://proconsortium.org/app/entry/PR:000053913", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053914", "url": "https://proconsortium.org/app/entry/PR:000053914", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053915", "url": "https://proconsortium.org/app/entry/PR:000053915", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053916", "url": "https://proconsortium.org/app/entry/PR:000053916", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053917", "url": "https://proconsortium.org/app/entry/PR:000053917", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053918", "url": "https://proconsortium.org/app/entry/PR:000053918", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053919", "url": "https://proconsortium.org/app/entry/PR:000053919", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053920", "url": "https://proconsortium.org/app/entry/PR:000053920", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053921", "url": "https://proconsortium.org/app/entry/PR:000053921", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053922", "url": "https://proconsortium.org/app/entry/PR:000053922", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053923", "url": "https://proconsortium.org/app/entry/PR:000053923", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053924", "url": "https://proconsortium.org/app/entry/PR:000053924", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053925", "url": "https://proconsortium.org/app/entry/PR:000053925", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053926", "url": "https://proconsortium.org/app/entry/PR:000053926", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053927", "url": "https://proconsortium.org/app/entry/PR:000053927", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053928", "url": "https://proconsortium.org/app/entry/PR:000053928", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053929", "url": "https://proconsortium.org/app/entry/PR:000053929", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053930", "url": "https://proconsortium.org/app/entry/PR:000053930", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053931", "url": "https://proconsortium.org/app/entry/PR:000053931", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053932", "url": "https://proconsortium.org/app/entry/PR:000053932", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053933", "url": "https://proconsortium.org/app/entry/PR:000053933", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053934", "url": "https://proconsortium.org/app/entry/PR:000053934", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053935", "url": "https://proconsortium.org/app/entry/PR:000053935", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053936", "url": "https://proconsortium.org/app/entry/PR:000053936", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053937", "url": "https://proconsortium.org/app/entry/PR:000053937", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053938", "url": "https://proconsortium.org/app/entry/PR:000053938", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053939", "url": "https://proconsortium.org/app/entry/PR:000053939", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053940", "url": "https://proconsortium.org/app/entry/PR:000053940", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053941", "url": "https://proconsortium.org/app/entry/PR:000053941", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053942", "url": "https://proconsortium.org/app/entry/PR:000053942", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053943", "url": "https://proconsortium.org/app/entry/PR:000053943", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053944", "url": "https://proconsortium.org/app/entry/PR:000053944", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053945", "url": "https://proconsortium.org/app/entry/PR:000053945", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053946", "url": "https://proconsortium.org/app/entry/PR:000053946", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053947", "url": "https://proconsortium.org/app/entry/PR:000053947", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053948", "url": "https://proconsortium.org/app/entry/PR:000053948", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053949", "url": "https://proconsortium.org/app/entry/PR:000053949", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053950", "url": "https://proconsortium.org/app/entry/PR:000053950", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053951", "url": "https://proconsortium.org/app/entry/PR:000053951", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053952", "url": "https://proconsortium.org/app/entry/PR:000053952", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053953", "url": "https://proconsortium.org/app/entry/PR:000053953", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053954", "url": "https://proconsortium.org/app/entry/PR:000053954", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053955", "url": "https://proconsortium.org/app/entry/PR:000053955", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053956", "url": "https://proconsortium.org/app/entry/PR:000053956", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053957", "url": "https://proconsortium.org/app/entry/PR:000053957", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053958", "url": "https://proconsortium.org/app/entry/PR:000053958", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053959", "url": "https://proconsortium.org/app/entry/PR:000053959", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P07602", "url": "http://purl.obolibrary.org/obo/PR_P07602", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001035930", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035930", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P07602", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "A0A0J9YXB8", "url": "https://www.uniprot.org/uniprot/A0A0J9YXB8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0J9YXB8-1", "url": "https://www.uniprot.org/uniprot/A0A0J9YXB8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07602-1", "url": "https://www.uniprot.org/uniprot/P07602-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07602-2", "url": "https://www.uniprot.org/uniprot/P07602-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07602-3", "url": "https://www.uniprot.org/uniprot/P07602-3", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MYALFLLASLLGAALAGPVLGLKECTRGSAVWCQNVKTASDCGAVKHCLQTVWNKPTVKSLPCDICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYLPVILDIIKGEMSRPGEVCSALNLCESLQKHLAELNHQKQLESNKIPELDMTEVVAPFMANIPLLLYPQDGPRSKPQPKDNGDVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCDEVKEMPMQTLVPAKVASKNVIPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGTRLPALTVHVTQPKDGGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPSAHKPLLGTEKCIWGPSYWCQNTETAAQCNAVEHCKRHVWN", "length": 524, "header": "sp|P07602-1|SAP_HUMAN Isoform 1 of Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE=1 SV=2 CANONICAL=P07602-1" }, "isoforms": [ { "isoform_ac": "A0A0J9YXB8-1", "url": "", "sequence": { "sequence": "XCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQDQQPKEICALVGFCDEVKEMPMQTLVPAKVASKNVIPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDT", "length": 167, "header": "tr|A0A0J9YXB8-1|A0A0J9YXB8_HUMAN Computationally mapped isoform of Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE=1 SV=1 CANONICAL=P07602-1" }, "locus": { "chromosome": "10", "start_pos": 71828134, "end_pos": 71819816, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000633965.1", "url": "https://www.ensembl.org/id/ENST00000633965.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000488331.1", "url": "https://www.ensembl.org/id/ENSP00000488331.1" } ] } }, { "isoform_ac": "P07602-1", "url": "", "sequence": { "sequence": "MYALFLLASLLGAALAGPVLGLKECTRGSAVWCQNVKTASDCGAVKHCLQTVWNKPTVKSLPCDICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYLPVILDIIKGEMSRPGEVCSALNLCESLQKHLAELNHQKQLESNKIPELDMTEVVAPFMANIPLLLYPQDGPRSKPQPKDNGDVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCDEVKEMPMQTLVPAKVASKNVIPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGTRLPALTVHVTQPKDGGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPSAHKPLLGTEKCIWGPSYWCQNTETAAQCNAVEHCKRHVWN", "length": 524, "header": "sp|P07602-1|SAP_HUMAN Isoform 1 of Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE=1 SV=2 CANONICAL=P07602-1" }, "locus": { "chromosome": "10", "start_pos": 71851221, "end_pos": 71817444, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000394936.8", "url": "https://www.ensembl.org/id/ENST00000394936.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000378394.3", "url": "https://www.ensembl.org/id/ENSP00000378394.3" } ] } }, { "isoform_ac": "P07602-2", "url": "", "sequence": { "sequence": "MYALFLLASLLGAALAGPVLGLKECTRGSAVWCQNVKTASDCGAVKHCLQTVWNKPTVKSLPCDICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYLPVILDIIKGEMSRPGEVCSALNLCESLQKHLAELNHQKQLESNKIPELDMTEVVAPFMANIPLLLYPQDGPRSKPQPKDNGDVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMDQQPKEICALVGFCDEVKEMPMQTLVPAKVASKNVIPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGTRLPALTVHVTQPKDGGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPSAHKPLLGTEKCIWGPSYWCQNTETAAQCNAVEHCKRHVWN", "length": 526, "header": "sp|P07602-2|SAP_HUMAN Isoform 2 of Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE=1 SV=2 CANONICAL=P07602-1" }, "locus": {} }, { "isoform_ac": "P07602-3", "url": "", "sequence": { "sequence": "MYALFLLASLLGAALAGPVLGLKECTRGSAVWCQNVKTASDCGAVKHCLQTVWNKPTVKSLPCDICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYLPVILDIIKGEMSRPGEVCSALNLCESLQKHLAELNHQKQLESNKIPELDMTEVVAPFMANIPLLLYPQDGPRSKPQPKDNGDVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQDQQPKEICALVGFCDEVKEMPMQTLVPAKVASKNVIPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGTRLPALTVHVTQPKDGGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPSAHKPLLGTEKCIWGPSYWCQNTETAAQCNAVEHCKRHVWN", "length": 527, "header": "sp|P07602-3|SAP_HUMAN Isoform 3 of Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE=1 SV=2 CANONICAL=P07602-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G03930BU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G09724ZC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11911BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G12313PD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G12398HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G18183SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20030CU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G20312EM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G22625SJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25637MV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G27622TD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39619TI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G43299SD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G45359RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G45495MK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47448YK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G57888GL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G61207RZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G62894KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G63889NK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G65019XG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70822IO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G75607BQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G76417NN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G77582RK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G79809MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G80858MF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G80966KZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G81198YO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82348BZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G84820NF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G86357DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G89993FE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G95977AE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "P07602", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07602#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "2842863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2842863" }, { "id": "19167329", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19167329" }, { "id": "PRU00415", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00415" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 103, "start_aa": "Ser", "end_pos": 103, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser103", "evidence": [ { "id": "P07602", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07602" }, { "id": "28411811", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28411811" }, { "id": "29249144", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29249144" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P07602", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P07602" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 105, "start_aa": "Ser", "end_pos": 105, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser105", "evidence": [ { "id": "P07602", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07602" }, { "id": "28411811", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28411811" }, { "id": "29249144", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29249144" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 136, "start_aa": "Asn", "end_pos": 136, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn136", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 136, "start_aa": "Asn", "end_pos": 136, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn136", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 214, "start_aa": "Thr", "end_pos": 214, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr214", "evidence": [ { "id": "P07602", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07602" }, { "id": "28411811", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28411811" }, { "id": "29249144", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29249144" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" } ] }, { "glytoucan_ac": "G74724QE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 214, "start_aa": "Thr", "end_pos": 214, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr214", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G00395TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G00986YT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G03216SJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G04483SK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G04744XB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G07695ZT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G11994QC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G12398HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G18938DW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G20312EM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20956ZV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25079LO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25418HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G28347RJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G28663KH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G29857RC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G29905OR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G30633FJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G31685JQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G33609NS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G33734YD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G34617SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G36191CD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G37881RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G39213VZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G39602UU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G42264OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G42679AH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G43664YB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G45036WQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G45187EI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G45359RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47448YK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48584BU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G52428MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G56269EA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G56784JY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G61334IA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G61792ET", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G62894KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G63889NK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64581RP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G66937TJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G69411IG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72667IM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72735IY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G75607BQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G76417NN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G79286RS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G79809MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G80333GO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81198YO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81397LO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G82348BZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G83006TR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G83229XP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G85041WE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G86357DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G86795LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G87051GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G89993FE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G91473PK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G96577RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-215", "start_pos": 215, "start_aa": "Asn", "end_pos": 215, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn215", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "P07602", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07602#ptm_processing" }, { "id": "PRU00415", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00415" }, { "id": "19167329", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19167329" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "G31685JQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 216, "start_aa": "Ser", "end_pos": 216, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser216", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 216, "start_aa": "Ser", "end_pos": 216, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser216", "evidence": [ { "id": "P07602", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07602" }, { "id": "28411811", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28411811" }, { "id": "29249144", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29249144" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P07602", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P07602" } ] }, { "glytoucan_ac": "G74724QE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 217, "start_aa": "Thr", "end_pos": 217, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr217", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 281, "start_aa": "Thr", "end_pos": 281, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr281", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 289, "start_aa": "Ser", "end_pos": 289, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser289", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 331, "start_aa": "Asn", "end_pos": 331, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn331", "evidence": [ { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G00406II", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G09724ZC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-332", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G10773YW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11911BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G12313PD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G12398HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-332", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20030CU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-332", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G20312EM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23984SE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25637MV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G28663KH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-332", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G29905OR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-332", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G33609NS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G34527RW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-332", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G36191CD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-332", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G45359RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-332", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48584BU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G51640FO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G52890YB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G59471TH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-332", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G62894KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G63889NK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-332", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G64481DJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-332", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G65092SV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72735IY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72791KH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G76417NN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-332", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G80223IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G80333GO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G80966KZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-332", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G81198YO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G89098OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G93500PH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-332", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G98140IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-332", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "P07602", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07602#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "19167329", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19167329" }, { "id": "PRU00415", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00415" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 334, "start_aa": "Thr", "end_pos": 334, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr334", "evidence": [ { "id": "P07602", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07602" }, { "id": "28411811", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28411811" }, { "id": "29249144", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29249144" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P07602", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P07602" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 391, "start_aa": "Thr", "end_pos": 391, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr391", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "LPALTVHVTQPK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 393, "start_aa": "Leu", "end_pos": 404, "end_aa": "Lys", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "LPALTVHVTQPKDGGFCEVCK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 393, "start_aa": "Leu", "end_pos": 413, "end_aa": "Lys", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 397, "start_aa": "Thr", "end_pos": 397, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr397", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 401, "start_aa": "Thr", "end_pos": 401, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr401", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G00406II", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 426, "start_aa": "Asn", "end_pos": 426, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn426", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 426, "start_aa": "Asn", "end_pos": 426, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn426", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 426, "start_aa": "Asn", "end_pos": 426, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn426", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 426, "start_aa": "Asn", "end_pos": 426, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn426", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 426, "start_aa": "Asn", "end_pos": 426, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn426", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25637MV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 426, "start_aa": "Asn", "end_pos": 426, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn426", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G33609NS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 426, "start_aa": "Asn", "end_pos": 426, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn426", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G36191CD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-426", "start_pos": 426, "start_aa": "Asn", "end_pos": 426, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn426", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G37412TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 426, "start_aa": "Asn", "end_pos": 426, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn426", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 426, "start_aa": "Asn", "end_pos": 426, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn426", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 426, "start_aa": "Asn", "end_pos": 426, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn426", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G54612UD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 426, "start_aa": "Asn", "end_pos": 426, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn426", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G62894KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 426, "start_aa": "Asn", "end_pos": 426, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn426", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72735IY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 426, "start_aa": "Asn", "end_pos": 426, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn426", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 426, "start_aa": "Asn", "end_pos": 426, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn426", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G80966KZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-426", "start_pos": 426, "start_aa": "Asn", "end_pos": 426, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn426", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G82348BZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-426", "start_pos": 426, "start_aa": "Asn", "end_pos": 426, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn426", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-426", "start_pos": 426, "start_aa": "Asn", "end_pos": 426, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn426", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "P07602", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07602#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "19167329", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19167329" }, { "id": "PRU00415", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00415" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 427, "start_aa": "Ser", "end_pos": 427, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser427", "evidence": [ { "id": "P07602", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07602" }, { "id": "28411811", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28411811" }, { "id": "29249144", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29249144" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P07602", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P07602" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G09724ZC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G12398HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20030CU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G34617SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G43299SD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G45359RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G45495MK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G46524LG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G55383ZG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G61207RZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G62894KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G63889NK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G69834CE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72735IY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72791KH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07602@N80", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P07602@N80" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G76417NN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G77582RK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G79809MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G80858MF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G80966KZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G82348BZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G86357DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G89993FE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "glytoucan_ac": "G92050GC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "glytoucan_ac": "G96577RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-80, N-101", "start_pos": 80, "start_aa": "Asn", "end_pos": 80, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn80", "evidence": [ { "id": "P07602", "database": "UniCarbKB", "url": "" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" }, { "id": "11180632", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11180632" }, { "id": "P07602", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07602#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "2842863", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2842863" }, { "id": "19167329", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19167329" }, { "id": "PRU00415", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00415" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 82, "start_aa": "Thr", "end_pos": 82, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr82", "evidence": [ { "id": "P07602", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07602" }, { "id": "28411811", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28411811" }, { "id": "29249144", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29249144" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P07602", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P07602" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 93, "start_aa": "Thr", "end_pos": 93, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr93", "evidence": [ { "id": "P07602", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07602" }, { "id": "28411811", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28411811" }, { "id": "29249144", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29249144" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" } ] }, { "glytoucan_ac": "G00395TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G00986YT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G03216SJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G04483SK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G04744XB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G07695ZT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G09724ZC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G10256JP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G10756ZZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G11254FL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G11994QC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G12398HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G14260UH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G15407YE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G18938DW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G20030CU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G22355FZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G22573RC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G22768VO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G23453IV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G25381UC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G26145IL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G28347RJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G28663KH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G29857RC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G29905OR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G30633FJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G31685JQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G31936TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G32152BH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G32550BI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G33734YD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G34527RW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G36191CD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G39213VZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G39602UU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G42264OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G42666HT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G42679AH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G43299SD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G43664YB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G45036WQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G45187EI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G45359RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G49874UX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G52428MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G54702KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G55220VL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G56269EA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G59471TH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G61207RZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G61330YQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G61334IA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G61792ET", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G61884GF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G63628AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G63889NK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G64481DJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G66538GV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G66937TJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G69411IG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G71838YU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G79809MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G80858MF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G80966KZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G81397LO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G82348BZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G83006TR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G85041WE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G86357DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G89993FE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G93500PH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "glytoucan_ac": "G94854LT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G96771UL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "2110822", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "glytoucan_ac": "G98140IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1645" }, { "id": "8344278", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8344278" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Tumor cells express pauci- and oligomannosidic N-glycans in glycoproteins recognized by the mannose receptor (CD206)", "journal": "Cell Mol Life Sci", "date": "2021", "authors": "Stavenhagen K., Laan L.C., Gao C., Mehta A.Y., Heimburg-Molinaro J., Glickman J.N., van Die I., Cummings R.D.", "evidence": [ { "database": "UniCarbKB", "id": "P07602", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1007/s00018-021-03863-1", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology", "journal": "EMBO J", "date": "2013", "authors": "Steentoft C., Vakhrushev S.Y., Joshi H.J., Kong Y., Vester-Christensen M.B., Schjoldager K.T., Lavrsen K., Dabelsteen S., Pedersen N.B., Marcos-Silva L., Gupta R., Bennett E.P., Mandel U., Brunak S., Wandall H.H., Levery S.B., Clausen H.", "evidence": [ { "database": "UniCarbKB", "id": "P07602", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1038/emboj.2013.79", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "title": "Probing the O-Glycoproteome of Gastric Cancer Cell Lines for Biomarker Discovery", "journal": "Molecular & Cellular Proteomics", "date": "2015", "authors": "Campos D., Freitas D., Gomes J., Magalh\u00e3es A., Steentoft C., Gomes C., Vester-Christensen M. B., Ferreira J. A., Afonso L. P., Santos L. L., Pinto de Sousa J., Mandel U., Clausen H., Vakhrushev S. Y., Reis C. A.", "evidence": [ { "database": "UniCarbKB", "id": "P07602", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1074/mcp.M114.046862", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "title": "Protease-activated receptors 1 and 4 mediate activation of human platelets by thrombin.", "journal": "The Journal of clinical investigation", "date": "1999", "authors": "Kahn ML, Nakanishi-Matsui M, Shapiro MJ, Ishihara H, Coughlin SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10079109", "url": "https://glygen.org/publication/PubMed/10079109" } ] }, { "title": "Discovery of a receptor related to the galanin receptors.", "journal": "FEBS letters", "date": "1999", "authors": "Lee DK, Nguyen T, O'Neill GP, Cheng R, Liu Y, Howard AD, Coulombe N, Tan CP, Tang-Nguyen AT, George SR, O'Dowd BF", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10100623", "url": "https://glygen.org/publication/PubMed/10100623" } ] }, { "title": "Cloning and characterization of NEU2, a human gene homologous to rodent soluble sialidases.", "journal": "Genomics", "date": "1999", "authors": "Monti E, Preti A, Rossi E, Ballabio A, Borsani G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "10191093", "url": "https://glygen.org/publication/PubMed/10191093" } ] }, { "title": "An Asn > Lys substitution in saposin B involving a conserved amino acidic residue and leading to the loss of the single N-glycosylation site in a patient with metachromatic leukodystrophy and normal arylsulphatase A activity.", "journal": "European journal of human genetics : EJHG", "date": "1999", "authors": "Regis S, Filocamo M, Corsolini F, Caroli F, Keulemans JL, van Diggelen OP, Gatti R", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" }, { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "10196694", "url": "https://glygen.org/publication/PubMed/10196694" } ] }, { "title": "Receptor for motilin identified in the human gastrointestinal system.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Feighner SD, Tan CP, McKee KK, Palyha OC, Hreniuk DL, Pong SS, Austin CP, Figueroa D, MacNeil D, Cascieri MA, Nargund R, Bakshi R, Abramovitz M, Stocco R, Kargman S, O'Neill G, Van Der Ploeg LH, Evans J, Patchett AA, Smith RG, Howard AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10381885", "url": "https://glygen.org/publication/PubMed/10381885" } ] }, { "title": "Prosaposin: a myelinotrophic protein that promotes expression of myelin constituents and is secreted after nerve injury.", "journal": "Glia", "date": "1999-06", "authors": "Hiraiwa M, Campana W M, Mizisin A P, Mohiuddin L, O'Brien J S", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "10383054", "url": "https://glygen.org/publication/PubMed/10383054" } ] }, { "title": "Structural and membrane-binding properties of saposin D.", "journal": "Eur. J. Biochem.", "date": "1999", "authors": "Tatti M, Salvioli R, Ciaffoni F, Pucci P, Andolfo A, Amoresano A, Vaccaro A M", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" }, { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "10406958", "url": "https://glygen.org/publication/PubMed/10406958" } ] }, { "title": "Melanin-concentrating hormone is the cognate ligand for the orphan G-protein-coupled receptor SLC-1.", "journal": "Nature", "date": "1999", "authors": "Chambers J, Ames RS, Bergsma D, Muir A, Fitzgerald LR, Hervieu G, Dytko GM, Foley JJ, Martin J, Liu WS, Park J, Ellis C, Ganguly S, Konchar S, Cluderay J, Leslie R, Wilson S, Sarau HM", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10421367", "url": "https://glygen.org/publication/PubMed/10421367" } ] }, { "title": "Molecular characterization of the melanin-concentrating-hormone receptor.", "journal": "Nature", "date": "1999", "authors": "Saito Y, Nothacker HP, Wang Z, Lin SH, Leslie F, Civelli O", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10421368", "url": "https://glygen.org/publication/PubMed/10421368" } ] }, { "title": "Proteolytic processing of big endothelin-3 by the kell blood group protein.", "journal": "Blood", "date": "1999", "authors": "Lee S, Lin M, Mele A, Cao Y, Farmar J, Russo D, Redman C", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10438732", "url": "https://glygen.org/publication/PubMed/10438732" } ] }, { "title": "Extensive alternative splicing in the 5'-untranslated region of the rat and human neuropeptide Y Y5 receptor genes regulates receptor expression.", "journal": "Journal of neurochemistry", "date": "1999", "authors": "Parker EM, Xia L", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10461880", "url": "https://glygen.org/publication/PubMed/10461880" } ] }, { "title": "Tissue distribution of prolactin-releasing peptide (PrRP) and its receptor.", "journal": "Regulatory peptides", "date": "1999", "authors": "Fujii R, Fukusumi S, Hosoya M, Kawamata Y, Habata Y, Hinuma S, Sekiguchi M, Kitada C, Kurokawa T, Nishimura O, Onda H, Sumino Y, Fujino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10498338", "url": "https://glygen.org/publication/PubMed/10498338" } ] }, { "title": "Human urotensin-II is a potent vasoconstrictor and agonist for the orphan receptor GPR14.", "journal": "Nature", "date": "1999", "authors": "Ames RS, Sarau HM, Chambers JK, Willette RN, Aiyar NV, Romanic AM, Louden CS, Foley JJ, Sauermelch CF, Coatney RW, Ao Z, Disa J, Holmes SD, Stadel JM, Martin JD, Liu WS, Glover GI, Wilson S, McNulty DE, Ellis CE, Elshourbagy NA, Shabon U, Trill JJ, Hay DW, Ohlstein EH, Bergsma DJ, Douglas SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10499587", "url": "https://glygen.org/publication/PubMed/10499587" } ] }, { "title": "Cerebroside sulfate activator protein (Saposin B): chromatographic and electrospray mass spectrometric properties.", "journal": "J. Mass Spectrom.", "date": "1999", "authors": "Faull K F, Whitelegge J P, Higginson J, To T, Johnson J, Krutchinsky A N, Standing K G, Waring A J, Stevens R L, Fluharty C B, Fluharty A L", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "10510427", "url": "https://glygen.org/publication/PubMed/10510427" } ] }, { "title": "Preparation of the cerebroside sulfate activator (CSAct or saposin B) from human urine.", "journal": "Mol. Genet. Metab.", "date": "1999", "authors": "Fluharty A L, Lombardo C, Louis A, Stevens R L, Whitelegge J, Waring A J, To T, Fluharty C B, Faull K F", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "10562467", "url": "https://glygen.org/publication/PubMed/10562467" } ] }, { "title": "Ghrelin is a growth-hormone-releasing acylated peptide from stomach.", "journal": "Nature", "date": "1999", "authors": "Kojima M, Hosoda H, Date Y, Nakazato M, Matsuo H, Kangawa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10604470", "url": "https://glygen.org/publication/PubMed/10604470" } ] }, { "title": "A non-glycosylated and functionally deficient mutant (N215H) of the sphingolipid activator protein B (SAP-B) in a novel case of metachromatic leukodystrophy (MLD).", "journal": "Journal of inherited metabolic disease", "date": "2000", "authors": "Wrobe D, Henseler M, Huettler S, Pascual Pascual SI, Chabas A, Sandhoff K", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" }, { "database": "dbSNP", "id": "rs121918107", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs121918107" } ], "reference": [ { "type": "PubMed", "id": "10682309", "url": "https://glygen.org/publication/PubMed/10682309" } ] }, { "title": "Further studies on the reconstitution of glucosylceramidase activity by Sap C and anionic phospholipids.", "journal": "FEBS letters", "date": "2000", "authors": "Salvioli R, Tatti M, Ciaffoni F, Vaccaro AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "10781797", "url": "https://glygen.org/publication/PubMed/10781797" } ] }, { "title": "Cloning and characterization of the mammalian brain-specific, Mg2+-dependent neutral sphingomyelinase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Hofmann K, Tomiuk S, Wolff G, Stoffel W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "10823942", "url": "https://glygen.org/publication/PubMed/10823942" } ] }, { "title": "Clinical pharmacokinetics of angiotensin II (AT1) receptor blockers in hypertension.", "journal": "Journal of human hypertension", "date": "2000", "authors": "Israili ZH", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10854085", "url": "https://glygen.org/publication/PubMed/10854085" } ] }, { "title": "Identification and expression of NEU3, a novel human sialidase associated to the plasma membrane.", "journal": "The Biochemical journal", "date": "2000", "authors": "Monti E, Bassi MT, Papini N, Riboni M, Manzoni M, Venerando B, Croci G, Preti A, Ballabio A, Tettamanti G, Borsani G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "10861246", "url": "https://glygen.org/publication/PubMed/10861246" } ] }, { "title": "Identification and characterization of two neuromedin U receptors differentially expressed in peripheral tissues and the central nervous system.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Raddatz R, Wilson AE, Artymyshyn R, Bonini JA, Borowsky B, Boteju LW, Zhou S, Kouranova EV, Nagorny R, Guevarra MS, Dai M, Lerman GS, Vaysse PJ, Branchek TA, Gerald C, Forray C, Adham N", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "10899166", "url": "https://glygen.org/publication/PubMed/10899166" } ] }, { "title": "Degradation of membrane-bound ganglioside GM1. Stimulation by bis(monoacylglycero)phosphate and the activator proteins SAP-B and GM2-AP.", "journal": "The Journal of biological chemistry", "date": "2000-11-17", "authors": "Wilkening G, Linke T, Uhlhorn-Dierks G, Sandhoff K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "10942779", "url": "https://glygen.org/publication/PubMed/10942779" } ] }, { "title": "Human acid ceramidase gene: novel mutations in Farber disease.", "journal": "Molecular genetics and metabolism", "date": "2000", "authors": "Zhang Z, Mandal AK, Mital A, Popescu N, Zimonjic D, Moser A, Moser H, Mukherjee AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "10993717", "url": "https://glygen.org/publication/PubMed/10993717" } ] }, { "title": "Src tyrosine kinase is a novel direct effector of G proteins.", "journal": "Cell", "date": "2000", "authors": "Ma YC, Huang J, Ali S, Lowry W, Huang XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "11007482", "url": "https://glygen.org/publication/PubMed/11007482" } ] }, { "title": "Structure of the asparagine-linked sugar chains of porcine kidney and human urine cerebroside sulfate activator protein.", "journal": "Journal of mass spectrometry : JMS", "date": "2000", "authors": "Faull KF, Johnson J, Kim MJ, To T, Whitelegge JP, Stevens RL, Fluharty CB, Fluharty AL", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602#ptm_processing" }, { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" }, { "database": "UniCarbKB", "id": "P07602", "url": "" }, { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "reference": [ { "type": "PubMed", "id": "11180632", "url": "https://glygen.org/publication/PubMed/11180632" } ] }, { "title": "A novel mutation in the coding region of the prosaposin gene leads to a complete deficiency of prosaposin and saposins, and is associated with a complex sphingolipidosis dominated by lactosylceramide accumulation.", "journal": "Hum. Mol. Genet.", "date": "2001", "authors": "Hulkov\u00e1 H, Cervenkov\u00e1 M, Ledvinov\u00e1 J, Toch\u00e1ckov\u00e1 M, Hreb\u00edcek M, Poupetov\u00e1 H, Befekadu A, Bern\u00e1 L, Paton B C, Harzer K, B\u00f6\u00f6r A, Sm\u00edd F, Elleder M", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "11309366", "url": "https://glygen.org/publication/PubMed/11309366" } ] }, { "title": "Growth hormone secretagogue receptor family members and ligands.", "journal": "Endocrine", "date": "2001", "authors": "Smith RG, Leonard R, Bailey AR, Palyha O, Feighner S, Tan C, Mckee KK, Pong SS, Griffin P, Howard A", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "11322507", "url": "https://glygen.org/publication/PubMed/11322507" } ] }, { "title": "Characterization of urinary sulfatides in metachromatic leukodystrophy using electrospray ionization-tandem mass spectrometry.", "journal": "Molecular genetics and metabolism", "date": "2001-05", "authors": "Whitfield P D, Sharp P C, Johnson D W, Nelson P, Meikle P J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "11350180", "url": "https://glygen.org/publication/PubMed/11350180" } ] }, { "title": "Metastasis suppressor gene KiSS-1 encodes peptide ligand of a G-protein-coupled receptor.", "journal": "Nature", "date": "2001", "authors": "Ohtaki T, Shintani Y, Honda S, Matsumoto H, Hori A, Kanehashi K, Terao Y, Kumano S, Takatsu Y, Masuda Y, Ishibashi Y, Watanabe T, Asada M, Yamada T, Suenaga M, Kitada C, Usuki S, Kurokawa T, Onda H, Nishimura O, Fujino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "11385580", "url": "https://glygen.org/publication/PubMed/11385580" } ] }, { "title": "The metastasis suppressor gene KiSS-1 encodes kisspeptins, the natural ligands of the orphan G protein-coupled receptor GPR54.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Kotani M, Detheux M, Vandenbogaerde A, Communi D, Vanderwinden JM, Le Poul E, Brezillon S, Tyldesley R, Suarez-Huerta N, Vandeput F, Blanpain C, Schiffmann SN, Vassart G, Parmentier M", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "11457843", "url": "https://glygen.org/publication/PubMed/11457843" } ] }, { "title": "Molecular cloning and expression of human bile acid beta-glucosidase.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Matern H, Boermans H, Lottspeich F, Matern S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "11489889", "url": "https://glygen.org/publication/PubMed/11489889" } ] }, { "title": "Cloning and molecular characterization of the novel human melanin-concentrating hormone receptor MCH2.", "journal": "Molecular pharmacology", "date": "2001", "authors": "Rodriguez M, Beauverger P, Naime I, Rique H, Ouvry C, Souchaud S, Dromaint S, Nagel N, Suply T, Audinot V, Boutin JA, Galizzi JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "11562423", "url": "https://glygen.org/publication/PubMed/11562423" } ] }, { "title": "Pharmacology of AT1-receptor blockers.", "journal": "Blood pressure. Supplement", "date": "2001", "authors": "Unger T", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "11683476", "url": "https://glygen.org/publication/PubMed/11683476" } ] }, { "title": "Physiological substrates for human lysosomal beta -hexosaminidase S.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Hepbildikler ST, Sandhoff R, Kolzer M, Proia RL, Sandhoff K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "11707436", "url": "https://glygen.org/publication/PubMed/11707436" } ] }, { "title": "The orphan receptor C5L2 has high affinity binding sites for complement fragments C5a and C5a des-Arg(74).", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Cain SA, Monk PN", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "11773063", "url": "https://glygen.org/publication/PubMed/11773063" } ] }, { "title": "Functional expression of human liver cytosolic beta-glucosidase in Pichia pastoris. Insights into its role in the metabolism of dietary glucosides.", "journal": "European journal of biochemistry", "date": "2002", "authors": "Berrin JG, McLauchlan WR, Needs P, Williamson G, Puigserver A, Kroon PA, Juge N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "11784319", "url": "https://glygen.org/publication/PubMed/11784319" } ] }, { "title": "Regulators of G-protein signalling as new central nervous system drug targets.", "journal": "Nature reviews. Drug discovery", "date": "2002", "authors": "Neubig RR, Siderovski DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "12120503", "url": "https://glygen.org/publication/PubMed/12120503" } ] }, { "title": "Study of interaction of GM2 activator protein with GM2 using circular dichroism and fluorescence spectroscopy.", "journal": "Neurochemical research", "date": "2002-08", "authors": "Ravasi Daniela, Masserini Massimo, Vecchio Giuseppe, Li Yu-Teh, Li Su-Chen", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "12374214", "url": "https://glygen.org/publication/PubMed/12374214" } ] }, { "title": "Molecular cloning and characterization of prokineticin receptors.", "journal": "Biochimica et biophysica acta", "date": "2002", "authors": "Soga T, Matsumoto Si, Oda T, Saito T, Hiyama H, Takasaki J, Kamohara M, Ohishi T, Matsushime H, Furuichi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "12427552", "url": "https://glygen.org/publication/PubMed/12427552" } ] }, { "title": "Expression, purification, crystallization, and preliminary X-ray analysis of recombinant human saposin B.", "journal": "Protein Expr. Purif.", "date": "2003", "authors": "Ahn Victoria E, Faull Kym F, Whitelegge Julian P, Higginson Jason, Fluharty Arvan L, Priv\u00e9 Gilbert G", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" }, { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "12510003", "url": "https://glygen.org/publication/PubMed/12510003" } ] }, { "title": "Crystal structure of saposin B reveals a dimeric shell for lipid binding.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Ahn VE, Faull KF, Whitelegge JP, Fluharty AL, Prive GG", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" }, { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "12518053", "url": "https://glygen.org/publication/PubMed/12518053" } ] }, { "title": "The chemoattractant receptor-like protein C5L2 binds the C3a des-Arg77/acylation-stimulating protein.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Kalant D, Cain SA, Maslowska M, Sniderman AD, Cianflone K, Monk PN", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "12540846", "url": "https://glygen.org/publication/PubMed/12540846" } ] }, { "title": "Biochemical properties of mammalian neutral sphingomyelinase 2 and its role in sphingolipid metabolism.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Marchesini N, Luberto C, Hannun YA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "12566438", "url": "https://glygen.org/publication/PubMed/12566438" } ] }, { "title": "Deglycosylation by small intestinal epithelial cell beta-glucosidases is a critical step in the absorption and metabolism of dietary flavonoid glycosides in humans.", "journal": "European journal of nutrition", "date": "2003", "authors": "Nemeth K, Plumb GW, Berrin JG, Juge N, Jacob R, Naim HY, Williamson G, Swallow DM, Kroon PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "12594539", "url": "https://glygen.org/publication/PubMed/12594539" } ] }, { "title": "Crystal structure of human beta-hexosaminidase B: understanding the molecular basis of Sandhoff and Tay-Sachs disease.", "journal": "Journal of molecular biology", "date": "2003", "authors": "Mark BL, Mahuran DJ, Cherney MM, Zhao D, Knapp S, James MN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "12662933", "url": "https://glygen.org/publication/PubMed/12662933" } ] }, { "title": "Characterization of a family of endogenous neuropeptide ligands for the G protein-coupled receptors GPR7 and GPR8.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Tanaka H, Yoshida T, Miyamoto N, Motoike T, Kurosu H, Shibata K, Yamanaka A, Williams SC, Richardson JA, Tsujino N, Garry MG, Lerner MR, King DS, O'Dowd BF, Sakurai T, Yanagisawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "12719537", "url": "https://glygen.org/publication/PubMed/12719537" } ] }, { "title": "Molecular cloning of the human brain and gastric cholecystokinin receptor: structure, functional expression and chromosomal localization.", "journal": "Biochemical and biophysical research communications", "date": "1992", "authors": "Pisegna JR, de Weerth A, Huppi K, Wank SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1280419", "url": "https://glygen.org/publication/PubMed/1280419" } ] }, { "title": "Identification of human intestinal alkaline sphingomyelinase as a novel ecto-enzyme related to the nucleotide phosphodiesterase family.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Duan RD, Bergman T, Xu N, Wu J, Cheng Y, Duan J, Nelander S, Palmberg C, Nilsson A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "12885774", "url": "https://glygen.org/publication/PubMed/12885774" } ] }, { "title": "Crystal structure of a covalent intermediate of endogenous human arylsulfatase A.", "journal": "Journal of inorganic biochemistry", "date": "2003", "authors": "Chruszcz M, Laidler P, Monkiewicz M, Ortlund E, Lebioda L, Lewinski K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "12888274", "url": "https://glygen.org/publication/PubMed/12888274" } ] }, { "title": "Structural analysis of lipid complexes of GM2-activator protein.", "journal": "Journal of molecular biology", "date": "2003", "authors": "Wright CS, Zhao Q, Rastinejad F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "12909021", "url": "https://glygen.org/publication/PubMed/12909021" } ] }, { "title": "Structure-function analysis of the extracellular domains of the Duffy antigen/receptor for chemokines: characterization of antibody and chemokine binding sites.", "journal": "British journal of haematology", "date": "2003", "authors": "Tournamille C, Filipe A, Wasniowska K, Gane P, Lisowska E, Cartron JP, Colin Y, Le Van Kim C", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "12956774", "url": "https://glygen.org/publication/PubMed/12956774" } ] }, { "title": "Cloning and pharmacological characterization of a human bradykinin (BK-2) receptor.", "journal": "Biochemical and biophysical research communications", "date": "1992", "authors": "Hess JF, Borkowski JA, Young GS, Strader CD, Ransom RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1314587", "url": "https://glygen.org/publication/PubMed/1314587" } ] }, { "title": "Cloning and functional expression of a human neuropeptide Y/peptide YY receptor of the Y1 type.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Larhammar D, Blomqvist AG, Yee F, Jazin E, Yoo H, Wahlested C", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1317848", "url": "https://glygen.org/publication/PubMed/1317848" } ] }, { "title": "The cloning of a family of genes that encode the melanocortin receptors.", "journal": "Science (New York, N.Y.)", "date": "1992", "authors": "Mountjoy KG, Robbins LS, Mortrud MT, Cone RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1325670", "url": "https://glygen.org/publication/PubMed/1325670" } ] }, { "title": "Somatostatin receptors, an expanding gene family: cloning and functional characterization of human SSTR3, a protein coupled to adenylyl cyclase.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1992", "authors": "Yamada Y, Reisine T, Law SF, Ihara Y, Kubota A, Kagimoto S, Seino M, Seino Y, Bell GI, Seino S", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1337145", "url": "https://glygen.org/publication/PubMed/1337145" } ] }, { "title": "Cloning and functional characterization of a family of human and mouse somatostatin receptors expressed in brain, gastrointestinal tract, and kidney.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Yamada Y, Post SR, Wang K, Tager HS, Bell GI, Seino S", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1346068", "url": "https://glygen.org/publication/PubMed/1346068" } ] }, { "title": "In vitro mutagenesis of potential N-glycosylation sites of arylsulfatase A. Effects on glycosylation, phosphorylation, and intracellular sorting.", "journal": "The Journal of biological chemistry", "date": "1992-07-05", "authors": "Gieselmann V, Schmidt B, von Figura K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "1352293", "url": "https://glygen.org/publication/PubMed/1352293" } ] }, { "title": "Proteolytic processing of human lysosomal arylsulfatase A.", "journal": "Biochimica et biophysica acta", "date": "1992", "authors": "Fujii T, Kobayashi T, Honke K, Gasa S, Ishikawa M, Shimizu T, Makita A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "1352993", "url": "https://glygen.org/publication/PubMed/1352993" } ] }, { "title": "Simultaneous deficiency of sphingolipid activator proteins 1 and 2 is caused by a mutation in the initiation codon of their common gene.", "journal": "J. Biol. Chem.", "date": "1992", "authors": "Schnabel D, Schr\u00f6der M, F\u00fcrst W, Klein A, Hurwitz R, Zenk T, Weber J, Harzer K, Paton B C, Poulos A", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "1371116", "url": "https://glygen.org/publication/PubMed/1371116" } ] }, { "title": "Isolation of dense granules from human platelets.", "journal": "Methods in enzymology", "date": "1992", "authors": "Fukami MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "1435334", "url": "https://glygen.org/publication/PubMed/1435334" } ] }, { "title": "On the structure of human corticotropin (adrenocorticotropic hormone).", "journal": "The Journal of biological chemistry", "date": "1961", "authors": "LEE TH, LERNER AB, BUETTNER-JANUSCH V", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "14463577", "url": "https://glygen.org/publication/PubMed/14463577" } ] }, { "title": "Identification of urotensin II-related peptide as the urotensin II-immunoreactive molecule in the rat brain.", "journal": "Biochemical and biophysical research communications", "date": "2003", "authors": "Sugo T, Murakami Y, Shimomura Y, Harada M, Abe M, Ishibashi Y, Kitada C, Miyajima N, Suzuki N, Mori M, Fujino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "14550283", "url": "https://glygen.org/publication/PubMed/14550283" } ] }, { "title": "The GPR54 gene as a regulator of puberty.", "journal": "The New England journal of medicine", "date": "2003", "authors": "Seminara SB, Messager S, Chatzidaki EE, Thresher RR, Acierno JS Jr, Shagoury JK, Bo-Abbas Y, Kuohung W, Schwinof KM, Hendrick AG, Zahn D, Dixon J, Kaiser UB, Slaugenhaupt SA, Gusella JF, O'Rahilly S, Carlton MB, Crowley WF Jr, Aparicio SA, Colledge WH", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "14573733", "url": "https://glygen.org/publication/PubMed/14573733" } ] }, { "title": "Characterization of the proteins released from activated platelets leads to localization of novel platelet proteins in human atherosclerotic lesions.", "journal": "Blood", "date": "2004", "authors": "Coppinger JA, Cagney G, Toomey S, Kislinger T, Belton O, McRedmond JP, Cahill DJ, Emili A, Fitzgerald DJ, Maguire PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "14630798", "url": "https://glygen.org/publication/PubMed/14630798" } ] }, { "title": "The lysosomal trafficking of sphingolipid activator proteins (SAPs) is mediated by sortilin.", "journal": "EMBO J.", "date": "2003", "authors": "Lefrancois Stephane, Zeng Jibin, Hassan A Jacob, Canuel Maryssa, Morales Carlos R", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "14657016", "url": "https://glygen.org/publication/PubMed/14657016" } ] }, { "title": "The molecular defect leading to Fabry disease: structure of human alpha-galactosidase.", "journal": "Journal of molecular biology", "date": "2004", "authors": "Garman SC, Garboczi DN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "15003450", "url": "https://glygen.org/publication/PubMed/15003450" } ] }, { "title": "Novel benzo[1,4]diazepin-2-one derivatives as endothelin receptor antagonists.", "journal": "Journal of medicinal chemistry", "date": "2004", "authors": "Bolli MH, Marfurt J, Grisostomi C, Boss C, Binkert C, Hess P, Treiber A, Thorin E, Morrison K, Buchmann S, Bur D, Ramuz H, Clozel M, Fischli W, Weller T", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "15139756", "url": "https://glygen.org/publication/PubMed/15139756" } ] }, { "title": "Neu4, a novel human lysosomal lumen sialidase, confers normal phenotype to sialidosis and galactosialidosis cells.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Seyrantepe V, Landry K, Trudel S, Hassan JA, Morales CR, Pshezhetsky AV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "15213228", "url": "https://glygen.org/publication/PubMed/15213228" } ] }, { "title": "The nucleotide transporter MRP4 (ABCC4) is highly expressed in human platelets and present in dense granules, indicating a role in mediator storage.", "journal": "Blood", "date": "2004", "authors": "Jedlitschky G, Tirschmann K, Lubenow LE, Nieuwenhuis HK, Akkerman JW, Greinacher A, Kroemer HK", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "15297306", "url": "https://glygen.org/publication/PubMed/15297306" } ] }, { "title": "Functional studies of human intestinal alkaline sphingomyelinase by deglycosylation and mutagenesis.", "journal": "The Biochemical journal", "date": "2005", "authors": "Wu J, Hansen GH, Nilsson A, Duan RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "15458386", "url": "https://glygen.org/publication/PubMed/15458386" } ] }, { "title": "Identity of an estrogen membrane receptor coupled to a G protein in human breast cancer cells.", "journal": "Endocrinology", "date": "2005", "authors": "Thomas P, Pang Y, Filardo EJ, Dong J", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "15539556", "url": "https://glygen.org/publication/PubMed/15539556" } ] }, { "title": "Cloning and characterization of a human angiotensin II type 1 receptor.", "journal": "Biochemical and biophysical research communications", "date": "1992", "authors": "Bergsma DJ, Ellis C, Kumar C, Nuthulaganti P, Kersten H, Elshourbagy N, Griffin E, Stadel JM, Aiyar N", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1567413", "url": "https://glygen.org/publication/PubMed/1567413" } ] }, { "title": "Role of beta-galactosidase and elastin binding protein in lysosomal and nonlysosomal complexes of patients with GM1-gangliosidosis.", "journal": "Human mutation", "date": "2005", "authors": "Caciotti A, Donati MA, Boneh A, d'Azzo A, Federico A, Parini R, Antuzzi D, Bardelli T, Nosi D, Kimonis V, Zammarchi E, Morrone A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "15714521", "url": "https://glygen.org/publication/PubMed/15714521" } ] }, { "title": "A mutation in the saposin A coding region of the prosaposin gene in an infant presenting as Krabbe disease: first report of saposin A deficiency in humans.", "journal": "Molecular genetics and metabolism", "date": "2005", "authors": "Spiegel R, Bach G, Sury V, Mengistu G, Meidan B, Shalev S, Shneor Y, Mandel H, Zeigler M", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" }, { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "15773042", "url": "https://glygen.org/publication/PubMed/15773042" } ] }, { "title": "Subcellular localization of human neutral ceramidase expressed in HEK293 cells.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Hwang YH, Tani M, Nakagawa T, Okino N, Ito M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "15845354", "url": "https://glygen.org/publication/PubMed/15845354" } ] }, { "title": "Characterization of GPRA, a novel G protein-coupled receptor related to asthma.", "journal": "American journal of respiratory cell and molecular biology", "date": "2005", "authors": "Vendelin J, Pulkkinen V, Rehn M, Pirskanen A, Raisanen-Sokolowski A, Laitinen A, Laitinen LA, Kere J, Laitinen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "15947423", "url": "https://glygen.org/publication/PubMed/15947423" } ] }, { "title": "The GAPs, GEFs, and GDIs of heterotrimeric G-protein alpha subunits.", "journal": "International journal of biological sciences", "date": "2005", "authors": "Siderovski DP, Willard FS", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "15951850", "url": "https://glygen.org/publication/PubMed/15951850" } ] }, { "title": "Structure and evolution of the human prosaposin chromosomal gene.", "journal": "Genomics", "date": "1992", "authors": "Rorman E G, Scheinker V, Grabowski G A", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "1612590", "url": "https://glygen.org/publication/PubMed/1612590" } ] }, { "title": "Identification of a novel amidase motif in neutral ceramidase.", "journal": "The Biochemical journal", "date": "2006", "authors": "Galadari S, Wu BX, Mao C, Roddy P, El Bawab S, Hannun YA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "16229686", "url": "https://glygen.org/publication/PubMed/16229686" } ] }, { "title": "Lipid-binding proteins in membrane digestion, antigen presentation, and antimicrobial defense.", "journal": "The Journal of biological chemistry", "date": "2005-12-16", "authors": "Kolter Thomas, Winau Florian, Schaible Ulrich E, Leippe Matthias, Sandhoff Konrad", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "16230343", "url": "https://glygen.org/publication/PubMed/16230343" } ] }, { "title": "Metabolism of GM1 ganglioside in cultured skin fibroblasts: anomalies in gangliosidoses, sialidoses, and sphingolipid activator protein (SAP, saposin) 1 and prosaposin deficient disorders.", "journal": "Human genetics", "date": "1992-07", "authors": "Schmid B, Paton B C, Sandhoff K, Harzer K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "1634229", "url": "https://glygen.org/publication/PubMed/1634229" } ] }, { "title": "The enzyme-binding region of human GM2-activator protein.", "journal": "The FEBS journal", "date": "2006-03", "authors": "Wendeler Michaela, Werth Norbert, Maier Timm, Schwarzmann Guenter, Kolter Thomas, Schoeniger Maike, Hoffmann Daniel, Lemm Thorsten, Saenger Wolfram, Sandhoff Konrad", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "16478472", "url": "https://glygen.org/publication/PubMed/16478472" } ] }, { "title": "Novel tumor necrosis factor-responsive mammalian neutral sphingomyelinase-3 is a C-tail-anchored protein.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Krut O, Wiegmann K, Kashkar H, Yazdanpanah B, Kronke M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "16517606", "url": "https://glygen.org/publication/PubMed/16517606" } ] }, { "title": "Two distinct bombesin receptor subtypes are expressed and functional in human lung carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Corjay MH, Dobrzanski DJ, Way JM, Viallet J, Shapira H, Worland P, Sausville EA, Battey JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1655761", "url": "https://glygen.org/publication/PubMed/1655761" } ] }, { "title": "Fabry disease: identification of 50 novel alpha-galactosidase A mutations causing the classic phenotype and three-dimensional structural analysis of 29 missense mutations.", "journal": "Human genomics", "date": "2006", "authors": "Shabbeer J, Yasuda M, Benson SD, Desnick RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "16595074", "url": "https://glygen.org/publication/PubMed/16595074" } ] }, { "title": "The vertebrate phototransduction cascade: amplification and termination mechanisms.", "journal": "Reviews of physiology, biochemistry and pharmacology", "date": "2005", "authors": "Chen CK", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "16634148", "url": "https://glygen.org/publication/PubMed/16634148" } ] }, { "title": "Crystallographic structure of human beta-hexosaminidase A: interpretation of Tay-Sachs mutations and loss of GM2 ganglioside hydrolysis.", "journal": "Journal of molecular biology", "date": "2006", "authors": "Lemieux MJ, Mark BL, Cherney MM, Withers SG, Mahuran DJ, James MN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "16698036", "url": "https://glygen.org/publication/PubMed/16698036" } ] }, { "title": "Molecular basis of different forms of metachromatic leukodystrophy.", "journal": "The New England journal of medicine", "date": "1991", "authors": "Polten A, Fluharty AL, Fluharty CB, Kappler J, von Figura K, Gieselmann V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "1670590", "url": "https://glygen.org/publication/PubMed/1670590" } ] }, { "title": "Mutations in the arylsulfatase A pseudodeficiency allele causing metachromatic leukodystrophy.", "journal": "American journal of human genetics", "date": "1991", "authors": "Gieselmann V, Fluharty AL, Tonnesen T, Von Figura K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "1678251", "url": "https://glygen.org/publication/PubMed/1678251" } ] }, { "title": "Structural basis of function in heterotrimeric G proteins.", "journal": "Quarterly reviews of biophysics", "date": "2006", "authors": "Oldham WM, Hamm HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "16923326", "url": "https://glygen.org/publication/PubMed/16923326" } ] }, { "title": "Cloning and sequence analysis of a cDNA encoding human non-selective type of endothelin receptor.", "journal": "Biochemical and biophysical research communications", "date": "1991", "authors": "Nakamuta M, Takayanagi R, Sakai Y, Sakamoto S, Hagiwara H, Mizuno T, Saito Y, Hirose S, Yamamoto M, Nawata H", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1710450", "url": "https://glygen.org/publication/PubMed/1710450" } ] }, { "title": "Identification of the non-lysosomal glucosylceramidase as beta-glucosidase 2.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Boot RG, Verhoek M, Donker-Koopman W, Strijland A, van Marle J, Overkleeft HS, Wennekes T, Aerts JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "17105727", "url": "https://glygen.org/publication/PubMed/17105727" } ] }, { "title": "Human galanin: primary structure and identification of two molecular forms.", "journal": "FEBS letters", "date": "1991", "authors": "Bersani M, Johnsen AH, Hojrup P, Dunning BE, Andreasen JJ, Holst JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1710578", "url": "https://glygen.org/publication/PubMed/1710578" } ] }, { "title": "Molecular basis of acid sphingomyelinase deficiency in a patient with Niemann-Pick disease type A.", "journal": "Biochemical and biophysical research communications", "date": "1991", "authors": "Ferlinz K, Hurwitz R, Sandhoff K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "1718266", "url": "https://glygen.org/publication/PubMed/1718266" } ] }, { "title": "Cloning and characterization of cDNA encoding human A-type endothelin receptor.", "journal": "Biochemical and biophysical research communications", "date": "1991", "authors": "Adachi M, Yang YY, Furuichi Y, Miyamoto C", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1719979", "url": "https://glygen.org/publication/PubMed/1719979" } ] }, { "title": "Molecular basis of an adult form of beta-hexosaminidase B deficiency with motor neuron disease.", "journal": "Biochemical and biophysical research communications", "date": "1991", "authors": "Banerjee P, Siciliano L, Oliveri D, McCabe NR, Boyers MJ, Horwitz AL, Li SC, Dawson G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "1720305", "url": "https://glygen.org/publication/PubMed/1720305" } ] }, { "title": "Isolation and primary structure of pituitary human galanin, a 30-residue nonamidated neuropeptide.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Schmidt WE, Kratzin H, Eckart K, Drevs D, Mundkowski G, Clemens A, Katsoulis S, Schafer H, Gallwitz B, Creutzfeldt W", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1722333", "url": "https://glygen.org/publication/PubMed/1722333" } ] }, { "title": "Structural organization and complete nucleotide sequence of the gene encoding human acid sphingomyelinase (SMPD1).", "journal": "Genomics", "date": "1992", "authors": "Schuchman EH, Levran O, Pereira LV, Desnick RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "1740330", "url": "https://glygen.org/publication/PubMed/1740330" } ] }, { "title": "Saposin B mobilizes lipids from cholesterol-poor and bis(monoacylglycero)phosphate-rich membranes at acidic pH. Unglycosylated patient variant saposin B lacks lipid-extraction capacity.", "journal": "The FEBS journal", "date": "2007", "authors": "Remmel N, Locatelli-Hoops S, Breiden B, Schwarzmann G, Sandhoff K", "evidence": [ { "database": "dbSNP", "id": "rs121918107", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs121918107" } ], "reference": [ { "type": "PubMed", "id": "17561962", "url": "https://glygen.org/publication/PubMed/17561962" } ] }, { "title": "A mutation in a mild form of galactosialidosis impairs dimerization of the protective protein and renders it unstable.", "journal": "The EMBO journal", "date": "1991", "authors": "Zhou XY, Galjart NJ, Willemsen R, Gillemans N, Galjaard H, d'Azzo A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "1756715", "url": "https://glygen.org/publication/PubMed/1756715" } ] }, { "title": "Non-neuronopathic Gaucher disease due to saposin C deficiency.", "journal": "Clinical genetics", "date": "2007", "authors": "Tylki-Szymanska A, Czartoryska B, Vanier MT, Poorthuis BJ, Groener JA, Lugowska A, Millat G, Vaccaro AM, Jurkiewicz E", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "17919309", "url": "https://glygen.org/publication/PubMed/17919309" } ] }, { "title": "Bradykinin, a hypotensive and smooth muscle stimulating factor released from plasma globulin by snake venoms and by trypsin.", "journal": "The American journal of physiology", "date": "1949", "authors": "ROCHA E SILVA M, BERALDO WT, ROSENFELD G", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "18127230", "url": "https://glygen.org/publication/PubMed/18127230" } ] }, { "title": "Human acid sphingomyelinase. Isolation, nucleotide sequence and expression of the full-length and alternatively spliced cDNAs.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Schuchman EH, Suchi M, Takahashi T, Sandhoff K, Desnick RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "1840600", "url": "https://glygen.org/publication/PubMed/1840600" } ] }, { "title": "Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Soundararajan M, Willard FS, Kimple AJ, Turnbull AP, Ball LJ, Schoch GA, Gileadi C, Fedorov OY, Dowler EF, Higman VA, Hutsell SQ, Sundstrom M, Doyle DA, Siderovski DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "18434541", "url": "https://glygen.org/publication/PubMed/18434541" } ] }, { "title": "The chemotactic receptor for human C5a anaphylatoxin.", "journal": "Nature", "date": "1991", "authors": "Gerard NP, Gerard C", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "1847994", "url": "https://glygen.org/publication/PubMed/1847994" } ] }, { "title": "GM1 gangliosidosis: review of clinical, molecular, and therapeutic aspects.", "journal": "Molecular genetics and metabolism", "date": "2008-08", "authors": "Brunetti-Pierri Nicola, Scaglia Fernando", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "18524657", "url": "https://glygen.org/publication/PubMed/18524657" } ] }, { "title": "Dissociation of heterotrimeric g proteins in cells.", "journal": "Science signaling", "date": "2008", "authors": "Lambert NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "18577758", "url": "https://glygen.org/publication/PubMed/18577758" } ] }, { "title": "Glycosphingolipid specificity of the human sulfatide activator protein.", "journal": "European journal of biochemistry", "date": "1991-09-01", "authors": "Vogel A, Schwarzmann G, Sandhoff K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "1889421", "url": "https://glygen.org/publication/PubMed/1889421" } ] }, { "title": "Human beta-galactosidase gene mutations in GM1-gangliosidosis: a common mutation among Japanese adult/chronic cases.", "journal": "American journal of human genetics", "date": "1991", "authors": "Yoshida K, Oshima A, Shimmoto M, Fukuhara Y, Sakuraba H, Yanagisawa N, Suzuki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "1907800", "url": "https://glygen.org/publication/PubMed/1907800" } ] }, { "title": "A mutation in the gene of a glycolipid-binding protein (GM2 activator) that causes GM2-gangliosidosis variant AB.", "journal": "FEBS letters", "date": "1991", "authors": "Schroder M, Schnabel D, Suzuki K, Sandhoff K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "1915858", "url": "https://glygen.org/publication/PubMed/1915858" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602#ptm_processing" }, { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "Cotranslational and posttranslational N-glycosylation of polypeptides by distinct mammalian OST isoforms.", "journal": "Cell", "date": "2009", "authors": "Ruiz-Canada C, Kelleher DJ, Gilmore R", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602#ptm_processing" }, { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "19167329", "url": "https://glygen.org/publication/PubMed/19167329" } ] }, { "title": "Identification and characterization of SMPD1 mutations causing Niemann-Pick types A and B in Spanish patients.", "journal": "Human mutation", "date": "2009", "authors": "Rodriguez-Pascau L, Gort L, Schuchman EH, Vilageliu L, Grinberg D, Chabas A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "19405096", "url": "https://glygen.org/publication/PubMed/19405096" } ] }, { "title": "Isolation and characterization of prosaposin from human milk.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1991", "authors": "Kondoh K, Hineno T, Sano A, Kakimoto Y", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "1958198", "url": "https://glygen.org/publication/PubMed/1958198" } ] }, { "title": "Lysosomal degradation of membrane lipids.", "journal": "FEBS letters", "date": "2010-05-03", "authors": "Kolter Thomas, Sandhoff Konrad", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "19836391", "url": "https://glygen.org/publication/PubMed/19836391" } ] }, { "title": "Saposin proteins: structure, function, and role in human lysosomal storage disorders.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "1991-03-01", "authors": "O'Brien J S, Kishimoto Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "2001789", "url": "https://glygen.org/publication/PubMed/2001789" } ] }, { "title": "The organization of the gene for the human cerebroside sulfate activator protein.", "journal": "FEBS Lett.", "date": "1991", "authors": "Holtschmidt H, Sandhoff K, F\u00fcrst W, Kwon H Y, Schnabel D, Suzuki K", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "2013321", "url": "https://glygen.org/publication/PubMed/2013321" } ] }, { "title": "Sulfatide activator protein. Alternative splicing that generates three mRNAs and a newly found mutation responsible for a clinical disease.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Holtschmidt H, Sandhoff K, Kwon HY, Harzer K, Nakano T, Suzuki K", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "2019586", "url": "https://glygen.org/publication/PubMed/2019586" } ] }, { "title": "Mutation in the sphingolipid activator protein 2 in a patient with a variant of Gaucher disease.", "journal": "FEBS letters", "date": "1991", "authors": "Schnabel D, Schroder M, Sandhoff K", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "2060627", "url": "https://glygen.org/publication/PubMed/2060627" } ] }, { "title": "The cytosolic beta-glucosidase GBA3 does not influence type 1 Gaucher disease manifestation.", "journal": "Blood cells, molecules & diseases", "date": "2011", "authors": "Dekker N, Voorn-Brouwer T, Verhoek M, Wennekes T, Narayan RS, Speijer D, Hollak CE, Overkleeft HS, Boot RG, Aerts JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "20728381", "url": "https://glygen.org/publication/PubMed/20728381" } ] }, { "title": "Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver.", "journal": "Biochemistry", "date": "1990", "authors": "Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S", "evidence": [ { "database": "UniCarbKB", "id": "P07602", "url": "" }, { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "reference": [ { "type": "PubMed", "id": "2110822", "url": "https://glygen.org/publication/PubMed/2110822" } ] }, { "title": "Prosaposin sorting is mediated by oligomerization.", "journal": "Exp. Cell Res.", "date": "2011", "authors": "Yuan Libin, Morales Carlos R", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "21835174", "url": "https://glygen.org/publication/PubMed/21835174" } ] }, { "title": "The complete amino-acid sequences of human ganglioside GM2 activator protein and cerebroside sulfate activator protein.", "journal": "Eur. J. Biochem.", "date": "1990", "authors": "F\u00fcrst W, Schubert J, Machleidt W, Meyer H E, Sandhoff K", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "2209618", "url": "https://glygen.org/publication/PubMed/2209618" } ] }, { "title": "The role of ceroid lipofuscinosis neuronal protein 5 (CLN5) in endosomal sorting.", "journal": "Mol. Cell. Biol.", "date": "2012", "authors": "Mamo A, Jules F, Dumaresq-Doiron K, Costantino S, Lefrancois S", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "22431521", "url": "https://glygen.org/publication/PubMed/22431521" } ] }, { "title": "Discovery of O-GlcNAc-modified proteins in published large-scale proteome data.", "journal": "Molecular & cellular proteomics : MCP", "date": "2012", "authors": "Hahne H, Gholami AM, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07602", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07602" } ], "reference": [ { "type": "PubMed", "id": "22661428", "url": "https://glygen.org/publication/PubMed/22661428" } ] }, { "title": "Detection of a point mutation in sphingolipid activator protein-1 mRNA in patients with a variant form of metachromatic leukodystrophy.", "journal": "Biochemical and biophysical research communications", "date": "1990", "authors": "Rafi MA, Zhang XL, DeGala G, Wenger DA", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" }, { "database": "dbSNP", "id": "rs121918103", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs121918103" } ], "reference": [ { "type": "PubMed", "id": "2302219", "url": "https://glygen.org/publication/PubMed/2302219" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "Characterization of a mutation in a family with saposin B deficiency: a glycosylation site defect.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Kretz KA, Carson GS, Morimoto S, Kishimoto Y, Fluharty AL, O'Brien JS", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" }, { "database": "dbSNP", "id": "rs121918103", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs121918103" } ], "reference": [ { "type": "PubMed", "id": "2320574", "url": "https://glygen.org/publication/PubMed/2320574" } ] }, { "title": "Glycoproteomic analysis of the secretome of human endothelial cells.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M", "evidence": [ { "database": "UniCarbKB", "id": "P07602", "url": "" }, { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "reference": [ { "type": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "title": "Comparison of the cerebroside sulphatase and the arylsulphatase activity of human sulphatase A in the absence of activators.", "journal": "Biochimica et biophysica acta", "date": "1975-01-23", "authors": "Stinshoff K, Jatzkewitz H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "235289", "url": "https://glygen.org/publication/PubMed/235289" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology.", "journal": "The EMBO journal", "date": "2013", "authors": "Steentoft C, Vakhrushev SY, Joshi HJ, Kong Y, Vester-Christensen MB, Schjoldager KT, Lavrsen K, Dabelsteen S, Pedersen NB, Marcos-Silva L, Gupta R, Bennett EP, Mandel U, Brunak S, Wandall HH, Levery SB, Clausen H", "evidence": [ { "database": "UniCarbKB", "id": "P07602", "url": "" } ], "reference": [ { "type": "PubMed", "id": "23584533", "url": "https://glygen.org/publication/PubMed/23584533" } ] }, { "title": "High precision platelet releasate definition by quantitative reversed protein profiling--brief report.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2013", "authors": "Wijten P, van Holten T, Woo LL, Bleijerveld OB, Roest M, Heck AJ, Scholten A", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "23640497", "url": "https://glygen.org/publication/PubMed/23640497" } ] }, { "title": "Proteome profiling of human neutrophil granule subsets, secretory vesicles, and cell membrane: correlation with transcriptome profiling of neutrophil precursors.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Rorvig S, Ostergaard O, Heegaard NH, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "23650620", "url": "https://glygen.org/publication/PubMed/23650620" } ] }, { "title": "GPR37 and GPR37L1 are receptors for the neuroprotective and glioprotective factors prosaptide and prosaposin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Meyer RC, Giddens MM, Schaefer SA, Hall RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "23690594", "url": "https://glygen.org/publication/PubMed/23690594" } ] }, { "title": "The activator of cerebroside sulphatase. Purification from human liver and identification as a protein.", "journal": "Hoppe-Seyler's Zeitschrift fur physiologische Chemie", "date": "1975-05", "authors": "Fischer G, Jatzkewitz H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "239890", "url": "https://glygen.org/publication/PubMed/239890" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "Pharmacokinetic-pharmacodynamic relationships of macitentan, a new endothelin receptor antagonist, after multiple dosing in healthy Korean subjects.", "journal": "American journal of cardiovascular drugs : drugs, devices, and other interventions", "date": "2014", "authors": "Ahn LY, Kim SE, Yi S, Dingemanse J, Lim KS, Jang IJ, Yu KS", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "24906252", "url": "https://glygen.org/publication/PubMed/24906252" } ] }, { "title": "Structure of full-length cDNA coding for sulfatide activator, a Co-beta-glucosidase and two other homologous proteins: two alternate forms of the sulfatide activator.", "journal": "J. Biochem.", "date": "1989", "authors": "Nakano T, Sandhoff K, St\u00fcmper J, Christomanou H, Suzuki K", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "2498298", "url": "https://glygen.org/publication/PubMed/2498298" } ] }, { "title": "Molecular cloning of a human co-beta-glucosidase cDNA: evidence that four sphingolipid hydrolase activator proteins are encoded by single genes in humans and rats.", "journal": "Genomics", "date": "1989", "authors": "Rorman E G, Grabowski G A", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "2515150", "url": "https://glygen.org/publication/PubMed/2515150" } ] }, { "title": "Alpha transducin is present in blue-, green-, and red-sensitive cone photoreceptors in the human retina.", "journal": "Neuron", "date": "1989", "authors": "Lerea CL, Bunt-Milam AH, Hurley JB", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "2534964", "url": "https://glygen.org/publication/PubMed/2534964" } ] }, { "title": "Cloning and expression of human arylsulfatase A.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Stein C, Gieselmann V, Kreysing J, Schmidt B, Pohlmann R, Waheed A, Meyer HE, O'Brien JS, von Figura K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "2562955", "url": "https://glygen.org/publication/PubMed/2562955" } ] }, { "title": "Probing the O-glycoproteome of gastric cancer cell lines for biomarker discovery.", "journal": "Molecular & cellular proteomics : MCP", "date": "2015", "authors": "Campos D, Freitas D, Gomes J, Magalhaes A, Steentoft C, Gomes C, Vester-Christensen MB, Ferreira JA, Afonso LP, Santos LL, Pinto de Sousa J, Mandel U, Clausen H, Vakhrushev SY, Reis CA", "evidence": [ { "database": "UniCarbKB", "id": "P07602", "url": "" } ], "reference": [ { "type": "PubMed", "id": "25813380", "url": "https://glygen.org/publication/PubMed/25813380" } ] }, { "title": "Prosaposin facilitates sortilin-independent lysosomal trafficking of progranulin.", "journal": "J. Cell Biol.", "date": "2015", "authors": "Zhou X, Sun L, Bastos de Oliveira F, Qi X, Brown WJ, Smolka MB, Sun Y, Hu F", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "26370502", "url": "https://glygen.org/publication/PubMed/26370502" } ] }, { "title": "The human endothelin family: three structurally and pharmacologically distinct isopeptides predicted by three separate genes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Inoue A, Yanagisawa M, Kimura S, Kasuya Y, Miyauchi T, Goto K, Masaki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "2649896", "url": "https://glygen.org/publication/PubMed/2649896" } ] }, { "title": "N-Glycoproteomics of Human Seminal Plasma Glycoproteins.", "journal": "Journal of proteome research", "date": "2016", "authors": "Saraswat M, Joenvaara S, Tomar AK, Singh S, Yadav S, Renkonen R", "evidence": [ { "database": "UniCarbKB", "id": "P07602", "url": "" } ], "reference": [ { "type": "PubMed", "id": "26791533", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "title": "Saposin A: second cerebrosidase activator protein.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1989", "authors": "Morimoto S, Martin B M, Yamamoto Y, Kretz K A, O'Brien J S, Kishimoto Y", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" }, { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "2717620", "url": "https://glygen.org/publication/PubMed/2717620" } ] }, { "title": "Nucleotide sequence for a cDNA encoding the alpha subunit of retinal transducin (GNAT1) isolated from the human eye.", "journal": "Nucleic acids research", "date": "1989", "authors": "Van Dop C, Medynski DC, Apone LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "2748346", "url": "https://glygen.org/publication/PubMed/2748346" } ] }, { "title": "Preparation and preliminary characterization of recombinant neurolysin for in vivo studies.", "journal": "Journal of biotechnology", "date": "2016", "authors": "Wangler NJ, Jayaraman S, Zhu R, Mechref Y, Abbruscato TJ, Bickel U, Karamyan VT", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "27496565", "url": "https://glygen.org/publication/PubMed/27496565" } ] }, { "title": "Lipids regulate the hydrolysis of membrane bound glucosylceramide by lysosomal \u03b2-glucocerebrosidase.", "journal": "Journal of lipid research", "date": "2017-03", "authors": "Abdul-Hammed Misbaudeen, Breiden Bernadette, Schwarzmann G\u00fcnter, Sandhoff Konrad", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "28126847", "url": "https://glygen.org/publication/PubMed/28126847" } ] }, { "title": "Nucleotide sequence of cloned cDNA for human sphingolipid activator protein 1 precursor.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1987", "authors": "Dewji N N, Wenger D A, O'Brien J S", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "2825202", "url": "https://glygen.org/publication/PubMed/2825202" } ] }, { "title": "Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Itoh H, Toyama R, Kozasa T, Tsukamoto T, Matsuoka M, Kaziro Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "2834384", "url": "https://glygen.org/publication/PubMed/2834384" } ] }, { "title": "A novel strategy for global mapping of O-GlcNAc proteins and peptides using selective enzymatic deglycosylation, HILIC enrichment and mass spectrometry identification.", "journal": "Talanta", "date": "2017", "authors": "Shen B, Zhang W, Shi Z, Tian F, Deng Y, Sun C, Wang G, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07602", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07602" } ], "reference": [ { "type": "PubMed", "id": "28411811", "url": "https://glygen.org/publication/PubMed/28411811" } ] }, { "title": "Coding of two sphingolipid activator proteins (SAP-1 and SAP-2) by same genetic locus.", "journal": "Science (New York, N.Y.)", "date": "1988", "authors": "O'Brien JS, Kretz KA, Dewji N, Wenger DA, Esch F, Fluharty AL", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602#ptm_processing" }, { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "2842863", "url": "https://glygen.org/publication/PubMed/2842863" } ] }, { "title": "Saposin D: a sphingomyelinase activator.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1988", "authors": "Morimoto S, Martin B M, Kishimoto Y, O'Brien J S", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "2845979", "url": "https://glygen.org/publication/PubMed/2845979" } ] }, { "title": "Synthesis of a Highly Azide-Reactive and Thermosensitive Biofunctional Reagent for Efficient Enrichment and Large-Scale Identification of O-GlcNAc Proteins by Mass Spectrometry.", "journal": "Analytical chemistry", "date": "2017", "authors": "Zhang W, Liu T, Dong H, Bai H, Tian F, Shi Z, Chen M, Wang J, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07602", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07602" } ], "reference": [ { "type": "PubMed", "id": "28510447", "url": "https://glygen.org/publication/PubMed/28510447" } ] }, { "title": "Quantitative proteomics identifies altered O-GlcNAcylation of structural, synaptic and memory-associated proteins in Alzheimer's disease.", "journal": "The Journal of pathology", "date": "2017", "authors": "Wang S, Yang F, Petyuk VA, Shukla AK, Monroe ME, Gritsenko MA, Rodland KD, Smith RD, Qian WJ, Gong CX, Liu T", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07602", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07602" }, { "database": "O-GlcNAc Atlas", "id": "P07602", "url": "https://oglcnac.org/atlas/detail/P07602" } ], "reference": [ { "type": "PubMed", "id": "28657654", "url": "https://glygen.org/publication/PubMed/28657654" } ] }, { "title": "Molecular cloning of the sphingolipid activator protein-1 (SAP-1), the sulfatide sulfatase activator.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1986", "authors": "Dewji N, Wenger D, Fujibayashi S, Donoviel M, Esch F, Hill F, O'Brien JS", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "2868718", "url": "https://glygen.org/publication/PubMed/2868718" } ] }, { "title": "BioSITe: A Method for Direct Detection and Quantitation of Site-Specific Biotinylation.", "journal": "Journal of proteome research", "date": "2018", "authors": "Kim DI, Cutler JA, Na CH, Reckel S, Renuse S, Madugundu AK, Tahir R, Goldschmidt HL, Reddy KL, Huganir RL, Wu X, Zachara NE, Hantschel O, Pandey A", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07602", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07602" }, { "database": "O-GlcNAc Atlas", "id": "P07602", "url": "https://oglcnac.org/atlas/detail/P07602" } ], "reference": [ { "type": "PubMed", "id": "29249144", "url": "https://glygen.org/publication/PubMed/29249144" } ] }, { "title": "Large-scale intact glycopeptide identification by Mascot database search.", "journal": "Scientific reports", "date": "2018", "authors": "Bollineni RC, Koehler CJ, Gislefoss RE, Anonsen JH, Thiede B", "evidence": [ { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "reference": [ { "type": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "title": "A Comparative Study of Human Saposins.", "journal": "Molecules (Basel, Switzerland)", "date": "2018-02-14", "authors": "Garrido-Arandia Mar\u00eda, Cuevas-Zuvir\u00eda Bruno, D\u00edaz-Perales Araceli, Pacios Luis F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "29443946", "url": "https://glygen.org/publication/PubMed/29443946" } ] }, { "title": "Mr 46,000 mannose 6-phosphate specific receptor: its role in targeting of lysosomal enzymes.", "journal": "The EMBO journal", "date": "1987-09", "authors": "Stein M, Zijderhand-Bleekemolen J E, Geuze H, Hasilik A, von Figura K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "2960521", "url": "https://glygen.org/publication/PubMed/2960521" } ] }, { "title": "Proteolytic processing of pro-alpha and pro-beta precursors from human beta-hexosaminidase. Generation of the mature alpha and beta a beta b subunits.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Mahuran DJ, Neote K, Klavins MH, Leung A, Gravel RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "2965147", "url": "https://glygen.org/publication/PubMed/2965147" } ] }, { "title": "Structural basis for the activation of acid ceramidase.", "journal": "Nature communications", "date": "2018", "authors": "Gebai A, Gorelik A, Li Z, Illes K, Nagar B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "29692406", "url": "https://glygen.org/publication/PubMed/29692406" } ] }, { "title": "A point mutation in the coding sequence of the beta-hexosaminidase alpha gene results in defective processing of the enzyme protein in an unusual GM2-gangliosidosis variant.", "journal": "Journal of neurochemistry", "date": "1988", "authors": "Nakano T, Muscillo M, Ohno K, Hoffman AJ, Suzuki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "2970528", "url": "https://glygen.org/publication/PubMed/2970528" } ] }, { "title": "Oligosaccharide structure and amino acid sequence of the major glycopeptides of mature human beta-hexosaminidase.", "journal": "Biochemistry", "date": "1988", "authors": "O'Dowd BF, Cumming DA, Gravel RA, Mahuran D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "2971395", "url": "https://glygen.org/publication/PubMed/2971395" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P07602", "url": "" }, { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Ganglioside Metabolism in Health and Disease.", "journal": "Progress in molecular biology and translational science", "date": "2018", "authors": "Sandhoff Roger, Schulze Heike, Sandhoff Konrad", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "29747811", "url": "https://glygen.org/publication/PubMed/29747811" } ] }, { "title": "Purification and characterization of beta-N-acetylhexosaminidase I from human placenta.", "journal": "Journal of biochemistry", "date": "1988-11", "authors": "Kinoshita K, Taniguchi N, Makita A, Narita M, Oikawa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "2976757", "url": "https://glygen.org/publication/PubMed/2976757" } ] }, { "title": "Emerging concepts of ganglioside metabolism.", "journal": "FEBS letters", "date": "2018-12", "authors": "Sandhoff Roger, Sandhoff Konrad", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "29802621", "url": "https://glygen.org/publication/PubMed/29802621" } ] }, { "title": "Quantitative Profiling of Protein O-GlcNAcylation Sites by an Isotope-Tagged Cleavable Linker.", "journal": "ACS chemical biology", "date": "2018", "authors": "Qin K, Zhu Y, Qin W, Gao J, Shao X, Wang YL, Zhou W, Wang C, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07602", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07602" }, { "database": "O-GlcNAc Atlas", "id": "P07602", "url": "https://oglcnac.org/atlas/detail/P07602" } ], "reference": [ { "type": "PubMed", "id": "30059200", "url": "https://glygen.org/publication/PubMed/30059200" } ] }, { "title": "Human alpha-galactosidase A: nucleotide sequence of a cDNA clone encoding the mature enzyme.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1986", "authors": "Bishop DF, Calhoun DH, Bernstein HS, Hantzopoulos P, Quinn M, Desnick RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "3014515", "url": "https://glygen.org/publication/PubMed/3014515" } ] }, { "title": "Distinct urinary glycoprotein signatures in prostate cancer patients.", "journal": "Oncotarget", "date": "2018", "authors": "Kawahara R, Ortega F, Rosa-Fernandes L, Guimaraes V, Quina D, Nahas W, Schwammle V, Srougi M, Leite KRM, Thaysen-Andersen M, Larsen MR, Palmisano G", "evidence": [ { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "reference": [ { "type": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "title": "The precursor of sulfatide activator protein is processed to three different proteins.", "journal": "Biol. Chem. Hoppe-Seyler", "date": "1988", "authors": "F\u00fcrst W, Machleidt W, Sandhoff K", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" }, { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "3048308", "url": "https://glygen.org/publication/PubMed/3048308" } ] }, { "title": "Expression of cDNA encoding the human `protective protein` associated with lysosomal beta-galactosidase and neuraminidase: homology to yeast proteases.", "journal": "Cell", "date": "1988", "authors": "Galjart NJ, Gillemans N, Harris A, van der Horst GT, Verheijen FW, Galjaard H, d'Azzo A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "3136930", "url": "https://glygen.org/publication/PubMed/3136930" } ] }, { "title": "Loss of SMPD4 Causes a Developmental Disorder Characterized by Microcephaly and Congenital Arthrogryposis.", "journal": "American journal of human genetics", "date": "2019", "authors": "Magini P, Smits DJ, Vandervore L, Schot R, Columbaro M, Kasteleijn E, van der Ent M, Palombo F, Lequin MH, Dremmen M, de Wit MCY, Severino M, Divizia MT, Striano P, Ordonez-Herrera N, Alhashem A, Al Fares A, Al Ghamdi M, Rolfs A, Bauer P, Demmers J, Verheijen FW, Wilke M, van Slegtenhorst M, van der Spek PJ, Seri M, Jansen AC, Stottmann RW, Hufnagel RB, Hopkin RJ, Aljeaid D, Wiszniewski W, Gawlinski P, Laure-Kamionowska M, Alkuraya FS, Akleh H, Stanley V, Musaev D, Gleeson JG, Zaki MS, Brunetti-Pierri N, Cappuccio G, Davidov B, Basel-Salmon L, Bazak L, Shahar NR, Bertoli-Avella A, Mirzaa GM, Dobyns WB, Pippucci T, Fornerod M, Mancini GMS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "31495489", "url": "https://glygen.org/publication/PubMed/31495489" } ] }, { "title": "Evidence for two different active sites on human beta-hexosaminidase A. Interaction of GM2 activator protein with beta-hexosaminidase A.", "journal": "The Journal of biological chemistry", "date": "1985-06-25", "authors": "Kytzia H J, Sandhoff K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "3158659", "url": "https://glygen.org/publication/PubMed/3158659" } ] }, { "title": "Global profiling of O-GlcNAcylated and/or phosphorylated proteins in hepatoblastoma.", "journal": "Signal transduction and targeted therapy", "date": "2019", "authors": "Song H, Ma J, Bian Z, Chen S, Zhu J, Wang J, Huang N, Yin M, Sun F, Xu M, Pan Q", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07602", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07602" }, { "database": "O-GlcNAc Atlas", "id": "P07602", "url": "https://oglcnac.org/atlas/detail/P07602" } ], "reference": [ { "type": "PubMed", "id": "31637018", "url": "https://glygen.org/publication/PubMed/31637018" } ] }, { "title": "Isolation and primary structure of human peptide YY.", "journal": "Biochemical and biophysical research communications", "date": "1988", "authors": "Tatemoto K, Nakano I, Makk G, Angwin P, Mann M, Schilling J, Go VL", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "3202875", "url": "https://glygen.org/publication/PubMed/3202875" } ] }, { "title": "Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes.", "journal": "Journal of proteome research", "date": "2020", "authors": "Zhu J, Lin YH, Dingess KA, Mank M, Stahl B, Heck AJR", "evidence": [ { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "reference": [ { "type": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "title": "Variants in saposin D domain of prosaposin gene linked to Parkinson's disease.", "journal": "Brain : a journal of neurology", "date": "2020", "authors": "Oji Y, Hatano T, Ueno SI, Funayama M, Ishikawa KI, Okuzumi A, Noda S, Sato S, Satake W, Toda T, Li Y, Hino-Takai T, Kakuta S, Tsunemi T, Yoshino H, Nishioka K, Hattori T, Mizutani Y, Mutoh T, Yokochi F, Ichinose Y, Koh K, Shindo K, Takiyama Y, Hamaguchi T, Yamada M, Farrer MJ, Uchiyama Y, Akamatsu W, Wu YR, Matsuda J, Hattori N", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "32201884", "url": "https://glygen.org/publication/PubMed/32201884" } ] }, { "title": "Complete amino-acid sequence of the naturally occurring A2 activator protein for enzymic sphingomyelin degradation: identity to the sulfatide activator protein (SAP-1).", "journal": "Biol. Chem. Hoppe-Seyler", "date": "1988", "authors": "Kleinschmidt T, Christomanou H, Braunitzer G", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "3242555", "url": "https://glygen.org/publication/PubMed/3242555" } ] }, { "title": "Isolation and identification of hydroxyproline analogues of bradykinin in human urine.", "journal": "FEBS letters", "date": "1988", "authors": "Kato H, Matsumura Y, Maeda H", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "3366244", "url": "https://glygen.org/publication/PubMed/3366244" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07602", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07602" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Tumor cells express pauci- and oligomannosidic N-glycans in glycoproteins recognized by the mannose receptor (CD206).", "journal": "Cellular and molecular life sciences : CMLS", "date": "2021", "authors": "Stavenhagen K, Laan LC, Gao C, Mehta AY, Heimburg-Molinaro J, Glickman JN, van Die I, Cummings RD", "evidence": [ { "database": "UniCarbKB", "id": "P07602", "url": "" } ], "reference": [ { "type": "PubMed", "id": "34089345", "url": "https://glygen.org/publication/PubMed/34089345" } ] }, { "title": "Loss of Lysosomal Proteins Progranulin and Prosaposin Associated with Increased Neurofibrillary Tangle Development in Alzheimer Disease.", "journal": "Journal of neuropathology and experimental neurology", "date": "2021", "authors": "Mendsaikhan A, Tooyama I, Serrano GE, Beach TG, Walker DG", "evidence": [ { "database": "RefSeq", "id": "NP_001035930", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035930" } ], "reference": [ { "type": "PubMed", "id": "34374777", "url": "https://glygen.org/publication/PubMed/34374777" } ] }, { "title": "Complete amino-acid sequence and carbohydrate content of the naturally occurring glucosylceramide activator protein (A1 activator) absent from a new human Gaucher disease variant.", "journal": "Biol. Chem. Hoppe-Seyler", "date": "1987", "authors": "Kleinschmidt T, Christomanou H, Braunitzer G", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "3442600", "url": "https://glygen.org/publication/PubMed/3442600" } ] }, { "title": "Human acid beta-glucosidase: isolation and amino acid sequence of a peptide containing the catalytic site.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1986", "authors": "Dinur T, Osiecki KM, Legler G, Gatt S, Desnick RJ, Grabowski GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "3456607", "url": "https://glygen.org/publication/PubMed/3456607" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07602", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07602" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "Efficient progranulin exit from the ER requires its interaction with prosaposin, a Surf4 cargo.", "journal": "The Journal of cell biology", "date": "2022", "authors": "Devireddy S, Ferguson SM", "evidence": [ { "database": "RefSeq", "id": "NP_001035930", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035930" } ], "reference": [ { "type": "PubMed", "id": "34919127", "url": "https://glygen.org/publication/PubMed/34919127" } ] }, { "title": "Purification and characterization of a novel neurotensin-degrading peptidase from rat brain synaptic membranes.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Checler F, Vincent JP, Kitabgi P", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "3525564", "url": "https://glygen.org/publication/PubMed/3525564" } ] }, { "title": "Endo-M Mediated Chemoenzymatic Approach Enables Reversible Glycopeptide Labeling for O-GlcNAcylation Analysis.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2022", "authors": "Chen Y, Tang F, Qin H, Yue X, Nie Y, Huang W, Ye M", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07602", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07602" } ], "reference": [ { "type": "PubMed", "id": "35289036", "url": "https://glygen.org/publication/PubMed/35289036" } ] }, { "title": "Prosaposin, tumor-secreted protein, promotes pancreatic cancer progression by decreasing tumor-infiltrating lymphocytes.", "journal": "Cancer science", "date": "2022", "authors": "Miyahara Y, Takano S, Sogawa K, Tomizawa S, Furukawa K, Takayashiki T, Kuboki S, Ohtsuka M", "evidence": [ { "database": "RefSeq", "id": "NP_001035930", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035930" } ], "reference": [ { "type": "PubMed", "id": "35633503", "url": "https://glygen.org/publication/PubMed/35633503" } ] }, { "title": "Design and Preparation of Novel Nitro-Oxide-Grafted Nanospheres with Enhanced Hydrogen Bonding Interaction for O-GlcNAc Analysis.", "journal": "ACS applied materials & interfaces", "date": "2022-10-26", "authors": "Wu Ci, Shi Song, Hou Chunyan, Luo Yang, Byers Stephen, Ma Junfeng", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07602", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07602" } ], "reference": [ { "type": "PubMed", "id": "36240223", "url": "https://glygen.org/publication/PubMed/36240223" } ] }, { "title": "Single-cell RNA-sequencing analysis reveals enhanced non-canonical neurotrophic factor signaling in the subacute phase of traumatic brain injury.", "journal": "CNS neuroscience & therapeutics", "date": "2023-11", "authors": "Qiu Xuecheng, Guo Yaling, Liu Ming-Feng, Zhang Bingge, Li Jingzhen, Wei Jian-Feng, Li Meng", "evidence": [ { "database": "RefSeq", "id": "NP_001035930", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035930" } ], "reference": [ { "type": "PubMed", "id": "37269057", "url": "https://glygen.org/publication/PubMed/37269057" } ] }, { "title": "Molecular cloning of the human cholecystokinin gene by use of a synthetic probe containing deoxyinosine.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1985", "authors": "Takahashi Y, Kato K, Hayashizaki Y, Wakabayashi T, Ohtsuka E, Matsuki S, Ikehara M, Matsubara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "3856870", "url": "https://glygen.org/publication/PubMed/3856870" } ] }, { "title": "Studies on human liver alpha-galactosidases. I. Purification of alpha-galactosidase A and its enzymatic properties with glycolipid and oligosaccharide substrates.", "journal": "The Journal of biological chemistry", "date": "1979-10-25", "authors": "Dean K J, Sweeley C C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "39940", "url": "https://glygen.org/publication/PubMed/39940" } ] }, { "title": "Enzyme alterations and lipid storage in three variants of Tay-Sachs disease.", "journal": "Journal of neurochemistry", "date": "1971-12", "authors": "Sandhoff K, Harzer K, W\u00e4ssle W, Jatzkewitz H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "5135907", "url": "https://glygen.org/publication/PubMed/5135907" } ] }, { "title": "Human urinary sulfatides in patients with sulfatidosis (metachromatic leukodystrophy).", "journal": "Journal of lipid research", "date": "1971-07", "authors": "Philippart M, Sarlieve L, Meurant C, Mechler L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "5164093", "url": "https://glygen.org/publication/PubMed/5164093" } ] }, { "title": "Purification and characterization of an activator protein for the degradation of glycolipids GM2 and GA2 by hexosaminidase A.", "journal": "Hoppe-Seyler's Zeitschrift fur physiologische Chemie", "date": "1979", "authors": "Conzelmann E, Sandhoff K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "527942", "url": "https://glygen.org/publication/PubMed/527942" } ] }, { "title": "Human small-intestinal beta-galactosidases. Separation and characterization of one lactase and one hetero beta-galactosidase.", "journal": "The Biochemical journal", "date": "1969", "authors": "Asp NG, Dahlqvist A, Koldovsky O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "5822067", "url": "https://glygen.org/publication/PubMed/5822067" } ] }, { "title": "Isolation and structural organization of the human corticotropin--beta-lipotropin precursor gene.", "journal": "FEBS letters", "date": "1981", "authors": "Takahashi H, Teranishi Y, Nakanishi S, Numa S", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "6274691", "url": "https://glygen.org/publication/PubMed/6274691" } ] }, { "title": "Isolation and structural organization of the human preproenkephalin gene.", "journal": "Nature", "date": "1982", "authors": "Noda M, Teranishi Y, Takahashi H, Toyosato M, Notake M, Nakanishi S, Numa S", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "6281660", "url": "https://glygen.org/publication/PubMed/6281660" } ] }, { "title": "A cDNA encoding a small common precursor for human pancreatic polypeptide and pancreatic icosapeptide.", "journal": "The EMBO journal", "date": "1984", "authors": "Boel E, Schwartz TW, Norris KE, Fiil NP", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "6373251", "url": "https://glygen.org/publication/PubMed/6373251" } ] }, { "title": "Characterization of the proteins of isolated human platelet alpha-granules. Evidence for a separate alpha-granule-pool of the glycoproteins IIb and IIIa.", "journal": "Biochimica et biophysica acta", "date": "1981", "authors": "Gogstad GO, Hagen I, Korsmo R, Solum NO", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "6457647", "url": "https://glygen.org/publication/PubMed/6457647" } ] }, { "title": "Cloning, characterization, and DNA sequence of a human cDNA encoding neuropeptide tyrosine.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1984", "authors": "Minth CD, Bloom SR, Polak JM, Dixon JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "6589611", "url": "https://glygen.org/publication/PubMed/6589611" } ] }, { "title": "Primary structure of the human Met- and Leu-enkephalin precursor and its mRNA.", "journal": "Nature", "date": "1982", "authors": "Comb M, Seeburg PH, Adelman J, Eiden L, Herbert E", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "7057924", "url": "https://glygen.org/publication/PubMed/7057924" } ] }, { "title": "Nature and frequency of mutations in the alpha-galactosidase A gene that cause Fabry disease.", "journal": "American journal of human genetics", "date": "1993", "authors": "Eng CM, Resnick-Silverman LA, Niehaus DJ, Astrin KH, Desnick RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "7504405", "url": "https://glygen.org/publication/PubMed/7504405" } ] }, { "title": "Molecular cloning of a functional human galanin receptor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Habert-Ortoli E, Amiranoff B, Loquet I, Laburthe M, Mayaux JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "7524088", "url": "https://glygen.org/publication/PubMed/7524088" } ] }, { "title": "The cloning and chromosomal mapping of two novel human opioid-somatostatin-like receptor genes, GPR7 and GPR8, expressed in discrete areas of the brain.", "journal": "Genomics", "date": "1995", "authors": "O'Dowd BF, Scheideler MA, Nguyen T, Cheng R, Rasmussen JS, Marchese A, Zastawny R, Heng HH, Tsui LC, Shi X, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "7590751", "url": "https://glygen.org/publication/PubMed/7590751" } ] }, { "title": "Expression cloning and pharmacological characterization of a human hippocampal neuropeptide Y/peptide YY Y2 receptor subtype.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Gerald C, Walker MW, Vaysse PJ, He C, Branchek TA, Weinshank RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "7592910", "url": "https://glygen.org/publication/PubMed/7592910" } ] }, { "title": "Cloning and functional expression of a human Y4 subtype receptor for pancreatic polypeptide, neuropeptide Y, and peptide YY.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Bard JA, Walker MW, Branchek TA, Weinshank RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "7592911", "url": "https://glygen.org/publication/PubMed/7592911" } ] }, { "title": "kappa-Opioid receptor in humans: cDNA and genomic cloning, chromosomal assignment, functional expression, pharmacology, and expression pattern in the central nervous system.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Simonin F, Gaveriaux-Ruff C, Befort K, Matthes H, Lannes B, Micheletti G, Mattei MG, Charron G, Bloch B, Kieffer B", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "7624359", "url": "https://glygen.org/publication/PubMed/7624359" } ] }, { "title": "A novel amino acid modification in sulfatases that is defective in multiple sulfatase deficiency.", "journal": "Cell", "date": "1995", "authors": "Schmidt B, Selmer T, Ingendoh A, von Figura K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "7628016", "url": "https://glygen.org/publication/PubMed/7628016" } ] }, { "title": "Structural analysis of saposin C and B. Complete localization of disulfide bridges.", "journal": "J. Biol. Chem.", "date": "1995", "authors": "Vaccaro A M, Salvioli R, Barca A, Tatti M, Ciaffoni F, Maras B, Siciliano R, Zappacosta F, Amoresano A, Pucci P", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" }, { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "7730378", "url": "https://glygen.org/publication/PubMed/7730378" } ] }, { "title": "Purification, characterization, and biosynthesis of human acid ceramidase.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Bernardo K, Hurwitz R, Zenk T, Desnick RJ, Ferlinz K, Schuchman EH, Sandhoff K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "7744740", "url": "https://glygen.org/publication/PubMed/7744740" } ] }, { "title": "Endothelin-converting enzyme-2 is a membrane-bound, phosphoramidon-sensitive metalloprotease with acidic pH optimum.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Emoto N, Yanagisawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "7797512", "url": "https://glygen.org/publication/PubMed/7797512" } ] }, { "title": "Purification and characterization of galactocerebrosidase from human lymphocytes.", "journal": "Journal of biochemistry", "date": "1994", "authors": "Sakai N, Inui K, Midorikawa M, Okuno Y, Ueda S, Iwamatsu A, Okada S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "7852280", "url": "https://glygen.org/publication/PubMed/7852280" } ] }, { "title": "Molecular genetics of metachromatic leukodystrophy.", "journal": "Hum. Mutat.", "date": "1994", "authors": "Gieselmann V, Zlotogora J, Harris A, Wenger D A, Morris C P", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "7866401", "url": "https://glygen.org/publication/PubMed/7866401" } ] }, { "title": "Human mu opiate receptor. cDNA and genomic clones, pharmacologic characterization and chromosomal assignment.", "journal": "FEBS letters", "date": "1994", "authors": "Wang JB, Johnson PS, Persico AM, Hawkins AL, Griffin CA, Uhl GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "7905839", "url": "https://glygen.org/publication/PubMed/7905839" } ] }, { "title": "Mechanism of GTP hydrolysis by G-protein alpha subunits.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Kleuss C, Raw AS, Lee E, Sprang SR, Gilman AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "7937899", "url": "https://glygen.org/publication/PubMed/7937899" } ] }, { "title": "Human taste cells express the G protein alpha-gustducin and neuron-specific enolase.", "journal": "Brain research. Molecular brain research", "date": "1994", "authors": "Takami S, Getchell TV, McLaughlin SK, Margolskee RF, Getchell ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "8015379", "url": "https://glygen.org/publication/PubMed/8015379" } ] }, { "title": "Pharmacological characterization of bosentan, a new potent orally active nonpeptide endothelin receptor antagonist.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "1994", "authors": "Clozel M, Breu V, Gray GA, Kalina B, Loffler BM, Burri K, Cassal JM, Hirth G, Muller M, Neidhart W, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8035319", "url": "https://glygen.org/publication/PubMed/8035319" } ] }, { "title": "ECE-1: a membrane-bound metalloprotease that catalyzes the proteolytic activation of big endothelin-1.", "journal": "Cell", "date": "1994", "authors": "Xu D, Emoto N, Giaid A, Slaughter C, Kaw S, deWit D, Yanagisawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8062389", "url": "https://glygen.org/publication/PubMed/8062389" } ] }, { "title": "Expression cloning of a human B1 bradykinin receptor.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Menke JG, Borkowski JA, Bierilo KK, MacNeil T, Derrick AW, Schneck KA, Ransom RW, Strader CD, Linemeyer DL, Hess JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8063797", "url": "https://glygen.org/publication/PubMed/8063797" } ] }, { "title": "Molecular cloning and expression of the gene encoding human angiotensin II type 2 receptor.", "journal": "Biochemical and biophysical research communications", "date": "1994", "authors": "Tsuzuki S, Ichiki T, Nakakubo H, Kitami Y, Guo DF, Shirai H, Inagami T", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8185599", "url": "https://glygen.org/publication/PubMed/8185599" } ] }, { "title": "Identification of a human delta opioid receptor: cloning and expression.", "journal": "Life sciences", "date": "1994", "authors": "Knapp RJ, Malatynska E, Fang L, Li X, Babin E, Nguyen M, Santoro G, Varga EV, Hruby VJ, Roeske WR, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8201839", "url": "https://glygen.org/publication/PubMed/8201839" } ] }, { "title": "Cloning of glycoprotein D cDNA, which encodes the major subunit of the Duffy blood group system and the receptor for the Plasmodium vivax malaria parasite.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Chaudhuri A, Polyakova J, Zbrzezna V, Williams K, Gulati S, Pogo AO", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8248172", "url": "https://glygen.org/publication/PubMed/8248172" } ] }, { "title": "Cloning and expression of cDNA encoding human galactocerebrosidase, the enzyme deficient in globoid cell leukodystrophy.", "journal": "Human molecular genetics", "date": "1993-11", "authors": "Chen Y Q, Rafi M A, de Gala G, Wenger D A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "8281145", "url": "https://glygen.org/publication/PubMed/8281145" } ] }, { "title": "A human gene that shows identity with the gene encoding the angiotensin receptor is located on chromosome 11.", "journal": "Gene", "date": "1993", "authors": "O'Dowd BF, Heiber M, Chan A, Heng HH, Tsui LC, Kennedy JL, Shi X, Petronis A, George SR, Nguyen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8294032", "url": "https://glygen.org/publication/PubMed/8294032" } ] }, { "title": "Isolation, characterization, and proteolysis of human prosaposin, the precursor of saposins (sphingolipid activator proteins).", "journal": "Arch. Biochem. Biophys.", "date": "1993", "authors": "Hiraiwa M, O'Brien J S, Kishimoto Y, Galdzicka M, Fluharty A L, Ginns E I, Martin B M", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "8323276", "url": "https://glygen.org/publication/PubMed/8323276" } ] }, { "title": "Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient.", "journal": "European journal of biochemistry", "date": "1993", "authors": "Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien JS, Kishimoto Y", "evidence": [ { "database": "UniCarbKB", "id": "P07602", "url": "" }, { "database": "GlyConnect", "id": "1645", "url": "https://glyconnect.expasy.org/browser/proteins/1645" } ], "reference": [ { "type": "PubMed", "id": "8344278", "url": "https://glygen.org/publication/PubMed/8344278" } ] }, { "title": "Storage of saposins A and D in infantile neuronal ceroid-lipofuscinosis.", "journal": "FEBS Lett.", "date": "1993", "authors": "Tyynel\u00e4 J, Palmer D N, Baumann M, Haltia M", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "reference": [ { "type": "PubMed", "id": "8370464", "url": "https://glygen.org/publication/PubMed/8370464" } ] }, { "title": "Prosaposin deficiency: further characterization of the sphingolipid activator protein-deficient sibs. Multiple glycolipid elevations (including lactosylceramidosis), partial enzyme deficiencies and ultrastructure of the skin in this generalized sphingolipid storage disease.", "journal": "Human genetics", "date": "1993-09", "authors": "Bradov\u00e1 V, Sm\u00edd F, Ulrich-Bott B, Roggendorf W, Paton B C, Harzer K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "8370580", "url": "https://glygen.org/publication/PubMed/8370580" } ] }, { "title": "Cloning, functional expression and pharmacological characterization of a fourth (hSSTR4) and a fifth (hSSTR5) human somatostatin receptor subtype.", "journal": "Biochemical and biophysical research communications", "date": "1993", "authors": "Yamada Y, Kagimoto S, Kubota A, Yasuda K, Masuda K, Someya Y, Ihara Y, Li Q, Imura H, Seino S, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8373420", "url": "https://glygen.org/publication/PubMed/8373420" } ] }, { "title": "Cloning and expression of a complementary DNA encoding a high affinity human neurotensin receptor.", "journal": "FEBS letters", "date": "1993", "authors": "Vita N, Laurent P, Lefort S, Chalon P, Dumont X, Kaghad M, Gully D, Le Fur G, Ferrara P, Caput D", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8381365", "url": "https://glygen.org/publication/PubMed/8381365" } ] }, { "title": "BRS-3: a novel bombesin receptor subtype selectively expressed in testis and lung carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Fathi Z, Corjay MH, Shapira H, Wada E, Benya R, Jensen R, Viallet J, Sausville EA, Battey JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8383682", "url": "https://glygen.org/publication/PubMed/8383682" } ] }, { "title": "Molecular cloning of a functional human thyrotropin-releasing hormone receptor.", "journal": "Biochemical and biophysical research communications", "date": "1993", "authors": "Matre V, Karlsen HE, Wright MS, Lundell I, Fjeldheim AK, Gabrielsen OS, Larhammar D, Gautvik KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8395824", "url": "https://glygen.org/publication/PubMed/8395824" } ] }, { "title": "Galactocerebrosidase from human urine: purification and partial characterization.", "journal": "Biochimica et biophysica acta", "date": "1993-09-29", "authors": "Chen Y Q, Wenger D A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "8399327", "url": "https://glygen.org/publication/PubMed/8399327" } ] }, { "title": "Characterization of the gene encoding human cone transducin alpha-subunit (GNAT2).", "journal": "Genomics", "date": "1993", "authors": "Morris TA, Fong SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "8406495", "url": "https://glygen.org/publication/PubMed/8406495" } ] }, { "title": "Molecular characterization and regulation of the human endothelin receptors.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Elshourbagy NA, Korman DR, Wu HL, Sylvester DR, Lee JA, Nuthalaganti P, Bergsma DJ, Kumar CS, Nambi P", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8440682", "url": "https://glygen.org/publication/PubMed/8440682" } ] }, { "title": "Molecular cloning of a novel melanocortin receptor.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Gantz I, Konda Y, Tashiro T, Shimoto Y, Miwa H, Munzert G, Watson SJ, DelValle J, Yamada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8463333", "url": "https://glygen.org/publication/PubMed/8463333" } ] }, { "title": "Platelet alpha-granules.", "journal": "Blood reviews", "date": "1993", "authors": "Harrison P, Cramer EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "8467233", "url": "https://glygen.org/publication/PubMed/8467233" } ] }, { "title": "Molecular cloning and functional expression of the human gallbladder cholecystokinin A receptor.", "journal": "Biochemical and biophysical research communications", "date": "1993", "authors": "Ulrich CD, Ferber I, Holicky E, Hadac E, Buell G, Miller LJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8503909", "url": "https://glygen.org/publication/PubMed/8503909" } ] }, { "title": "Molecular role of sulfated glycoprotein-1 (SGP-1/prosaposin) in Sertoli cells.", "journal": "Histology and histopathology", "date": "1995-10", "authors": "Morales C R, el-Alfy M, Zhao Q, Igdoura S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "8573994", "url": "https://glygen.org/publication/PubMed/8573994" } ] }, { "title": "Three-dimensional structure of the human 'protective protein': structure of the precursor form suggests a complex activation mechanism.", "journal": "Structure (London, England : 1993)", "date": "1995", "authors": "Rudenko G, Bonten E, d'Azzo A, Hol WG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "8591035", "url": "https://glygen.org/publication/PubMed/8591035" } ] }, { "title": "Molecular cloning, expression and potential functions of the human proteinase-activated receptor-2.", "journal": "The Biochemical journal", "date": "1996", "authors": "Bohm SK, Kong W, Bromme D, Smeekens SP, Anderson DC, Connolly A, Kahn M, Nelken NA, Coughlin SR, Payan DG, Bunnett NW", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8615752", "url": "https://glygen.org/publication/PubMed/8615752" } ] }, { "title": "Proteolytic processing patterns of prosaposin in insect and mammalian cells.", "journal": "The Journal of biological chemistry", "date": "1996-07-19", "authors": "Leonova T, Qi X, Bencosme A, Ponce E, Sun Y, Grabowski G A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "8663398", "url": "https://glygen.org/publication/PubMed/8663398" } ] }, { "title": "Cloning and chromosomal mapping of three novel genes, GPR9, GPR10, and GPR14, encoding receptors related to interleukin 8, neuropeptide Y, and somatostatin receptors.", "journal": "Genomics", "date": "1995", "authors": "Marchese A, Heiber M, Nguyen T, Heng HH, Saldivia VR, Cheng R, Murphy PM, Tsui LC, Shi X, Gregor P, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8666380", "url": "https://glygen.org/publication/PubMed/8666380" } ] }, { "title": "Targeting of proteins to granule subsets is determined by timing and not by sorting: The specific granule protein NGAL is localized to azurophil granules when expressed in HL-60 cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Le Cabec V, Cowland JB, Calafat J, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "8692836", "url": "https://glygen.org/publication/PubMed/8692836" } ] }, { "title": "Molecular cloning and characterization of the human anaphylatoxin C3a receptor.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Ames RS, Li Y, Sarau HM, Nuthulaganti P, Foley JJ, Ellis C, Zeng Z, Su K, Jurewicz AJ, Hertzberg RP, Bergsma DJ, Kumar C", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8702752", "url": "https://glygen.org/publication/PubMed/8702752" } ] }, { "title": "Primary structure of human prethrombin 2 and alpha-thrombin.", "journal": "The Journal of biological chemistry", "date": "1977", "authors": "Butkowski RJ, Elion J, Downing MR, Mann KG", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "873923", "url": "https://glygen.org/publication/PubMed/873923" } ] }, { "title": "Only sphingolipid activator protein B (SAP-B or saposin B) stimulates the degradation of globotriaosylceramide by recombinant human lysosomal alpha-galactosidase in a detergent-free liposomal system.", "journal": "FEBS letters", "date": "1996-09-09", "authors": "Kase R, Bierfreund U, Klein A, Kolter T, Itoh K, Suzuki M, Hashimoto Y, Sandhoff K, Sakuraba H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "8804427", "url": "https://glygen.org/publication/PubMed/8804427" } ] }, { "title": "Pharmacokinetics and pharmacodynamics of the endothelin-receptor antagonist bosentan in healthy human subjects.", "journal": "Clinical pharmacology and therapeutics", "date": "1996", "authors": "Weber C, Schmitt R, Birnboeck H, Hopfgartner G, van Marle SP, Peeters PA, Jonkman JH, Jones CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "8823230", "url": "https://glygen.org/publication/PubMed/8823230" } ] }, { "title": "Glucocerebrosidase (Gaucher disease).", "journal": "Human mutation", "date": "1996", "authors": "Beutler E, Gelbart T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "8889578", "url": "https://glygen.org/publication/PubMed/8889578" } ] }, { "title": "Molecular cloning and characterization of a full-length complementary DNA encoding human acid ceramidase. Identification Of the first molecular lesion causing Farber disease.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Koch J, Gartner S, Li CM, Quintern LE, Bernardo K, Levran O, Schnabel D, Desnick RJ, Schuchman EH, Sandhoff K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "8955159", "url": "https://glygen.org/publication/PubMed/8955159" } ] }, { "title": "Characterization of human lysosomal neuraminidase defines the molecular basis of the metabolic storage disorder sialidosis.", "journal": "Genes & development", "date": "1996", "authors": "Bonten E, van der Spoel A, Fornerod M, Grosveld G, d'Azzo A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "8985184", "url": "https://glygen.org/publication/PubMed/8985184" } ] }, { "title": "Discovery of TBC11251, a potent, long acting, orally active endothelin receptor-A selective antagonist.", "journal": "Journal of medicinal chemistry", "date": "1997", "authors": "Wu C, Chan MF, Stavros F, Raju B, Okun I, Mong S, Keller KM, Brock T, Kogan TP, Dixon RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9171878", "url": "https://glygen.org/publication/PubMed/9171878" } ] }, { "title": "Formation of a ternary complex between GM2 activator protein, GM2 ganglioside and hexosaminidase A.", "journal": "Biochimica et biophysica acta", "date": "1997-06-20", "authors": "Yadao F, Hechtman P, Kaplan F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "9217013", "url": "https://glygen.org/publication/PubMed/9217013" } ] }, { "title": "Molecular genetics of Krabbe disease (globoid cell leukodystrophy): diagnostic and clinical implications.", "journal": "Human mutation", "date": "1997", "authors": "Wenger DA, Rafi MA, Luzi P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "9338580", "url": "https://glygen.org/publication/PubMed/9338580" } ] }, { "title": "Cloned mammalian neutral sphingomyelinase: functions in sphingolipid signaling?", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Tomiuk S, Hofmann K, Nix M, Zumbansen M, Stoffel W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "9520418", "url": "https://glygen.org/publication/PubMed/9520418" } ] }, { "title": "Nocistatin, a peptide that blocks nociceptin action in pain transmission.", "journal": "Nature", "date": "1998", "authors": "Okuda-Ashitaka E, Minami T, Tachibana S, Yoshihara Y, Nishiuchi Y, Kimura T, Ito S", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9521323", "url": "https://glygen.org/publication/PubMed/9521323" } ] }, { "title": "Crystal structure of human arylsulfatase A: the aldehyde function and the metal ion at the active site suggest a novel mechanism for sulfate ester hydrolysis.", "journal": "Biochemistry", "date": "1998", "authors": "Lukatela G, Krauss N, Theis K, Selmer T, Gieselmann V, von Figura K, Saenger W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310" } ], "reference": [ { "type": "PubMed", "id": "9521684", "url": "https://glygen.org/publication/PubMed/9521684" } ] }, { "title": "DNA methylation contributes to expression of the human neurotensin/neuromedin N gene.", "journal": "The American journal of physiology", "date": "1998", "authors": "Dong Z, Wang X, Zhao Q, Townsend CM Jr, Evers BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9530155", "url": "https://glygen.org/publication/PubMed/9530155" } ] }, { "title": "Association of XK and Kell blood group proteins.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Russo D, Redman C, Lee S", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9593744", "url": "https://glygen.org/publication/PubMed/9593744" } ] }, { "title": "A prolactin-releasing peptide in the brain.", "journal": "Nature", "date": "1998", "authors": "Hinuma S, Habata Y, Fujii R, Kawamata Y, Hosoya M, Fukusumi S, Kitada C, Masuo Y, Asano T, Matsumoto H, Sekiguchi M, Kurokawa T, Nishimura O, Onda H, Fujino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9607765", "url": "https://glygen.org/publication/PubMed/9607765" } ] }, { "title": "Molecular characterization, pharmacological properties and chromosomal localization of the human GALR2 galanin receptor.", "journal": "Brain research. Molecular brain research", "date": "1998", "authors": "Fathi Z, Battaglino PM, Iben LG, Li H, Baker E, Zhang D, McGovern R, Mahle CD, Sutherland GR, Iismaa TP, Dickinson KE, Zimanyi IA", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9685625", "url": "https://glygen.org/publication/PubMed/9685625" } ] }, { "title": "Cloned human and rat galanin GALR3 receptors. Pharmacology and activation of G-protein inwardly rectifying K+ channels.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Smith KE, Walker MW, Artymyshyn R, Bard J, Borowsky B, Tamm JA, Yao WJ, Vaysse PJ, Branchek TA, Gerald C, Jones KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9722565", "url": "https://glygen.org/publication/PubMed/9722565" } ] }, { "title": "Isolation and characterization of a novel endogenous peptide ligand for the human APJ receptor.", "journal": "Biochemical and biophysical research communications", "date": "1998", "authors": "Tatemoto K, Hosoya M, Habata Y, Fujii R, Kakegawa T, Zou MX, Kawamata Y, Fukusumi S, Hinuma S, Kitada C, Kurokawa T, Onda H, Fujino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9792798", "url": "https://glygen.org/publication/PubMed/9792798" } ] }, { "title": "Molecular characterization and expression of cloned human galanin receptors GALR2 and GALR3.", "journal": "Journal of neurochemistry", "date": "1998", "authors": "Kolakowski LF Jr, O'Neill GP, Howard AD, Broussard SR, Sullivan KA, Feighner SD, Sawzdargo M, Nguyen T, Kargman S, Shiao LL, Hreniuk DL, Tan CP, Evans J, Abramovitz M, Chateauneuf A, Coulombe N, Ng G, Johnson MP, Tharian A, Khoshbouei H, George SR, Smith RG, O'Dowd BF", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9832121", "url": "https://glygen.org/publication/PubMed/9832121" } ] }, { "title": "Neurotensin is an antagonist of the human neurotensin NT2 receptor expressed in Chinese hamster ovary cells.", "journal": "European journal of pharmacology", "date": "1998", "authors": "Vita N, Oury-Donat F, Chalon P, Guillemot M, Kaghad M, Bachy A, Thurneyssen O, Garcia S, Poinot-Chazel C, Casellas P, Keane P, Le Fur G, Maffrand JP, Soubrie P, Caput D, Ferrara P", "evidence": [ { "database": "Reactome", "id": "R-HSA-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276" } ], "reference": [ { "type": "PubMed", "id": "9851594", "url": "https://glygen.org/publication/PubMed/9851594" } ] } ], "pathway": [ { "id": "hsa:5660", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5660", "resource": "KEGG Pathway" }, { "id": "R-HSA-114608", "name": "Platelet degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608", "resource": "Reactome", "description": "Platelet degranulation" }, { "id": "R-HSA-375276", "name": "Peptide ligand-binding receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375276", "resource": "Reactome", "description": "Peptide ligand-binding receptors" }, { "id": "R-HSA-418594", "name": "G alpha (i) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594", "resource": "Reactome", "description": "G alpha (i) signalling events" }, { "id": "R-HSA-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-HSA-9840310", "name": "Glycosphingolipid catabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9840310", "resource": "Reactome", "description": "Glycosphingolipid catabolism" } ], "orthologs": [ { "uniprot_canonical_ac": "P10960-1", "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MYALALLASLLVTALTSPVQDPKICSGGSAVVCRDVKTAVDCRAVKHCQQMVWSKPTAKSLPCDICKTVVTEAGNLLKDNATEEEILHYLEKTCAWIHDSSLSASCKEVVDSYLPVILDMIKGEMSNPGEVCSALNLCQSLQEYLAEQNQRQLESNKIPEVDLARVVAPFMSNIPLLLYPQDRPRSQPQPKANEDVCQDCMKLVTDIQTAVRTNSSFVQGLVDHVKEDCDRLGPGVSDICKNYVDQYSEVAVQMMMHMQPKEICVMVGFCDEVKRVPMRTLVPATEAIKNILPALELTDPYEQDVIQAQNVIFCQVCQLVMRKLSELIINNATEELLIKGLSKACSLLPAPASTKCQEVLVTFGPSLLDVLMHEVNPNFLCGVISLCSANPNLVGTLEQPAAAIVSALPKEPAPPKQPEEPKQSALRAHVPPQKNGGFCEVCKKLVIYLEHNLEKNSTKEEILAALEKGCSFLPDPYQKQCDEFVAEYEPLLLEILVEVMDPSFVCSKIGVCPSAYKLLLGTEKCVWGPGYWCQNSETAARCNAVDHCKRHVWN", "length": 554 }, "evidence": [ { "id": "45917610", "url": "http://www.informatics.jax.org/homology/45917610", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q61207-1", "protein_name": "Prosaposin", "gene_name": "Psap", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MYALALFASLLATALTSPVQDPKTCSGGSAVLCRDVKTAVDCGAVKHCQQMVWSKPTAKSLPCDICKTVVTEAGNLLKDNATQEEILHYLEKTCEWIHDSSLSASCKEVVDSYLPVILDMIKGEMSNPGEVCSALNLCQSLQEYLAEQNQKQLESNKIPEVDMARVVAPFMSNIPLLLYPQDHPRSQPQPKANEDVCQDCMKLVSDVQTAVKTNSSFIQGFVDHVKEDCDRLGPGVSDICKNYVDQYSEVCVQMLMHMQDQQPKEICVLAGFCNEVKRVPMKTLVPATETIKNILPALEMMDPYEQNLVQAHNVILCQTCQFVMNKFSELIVNNATEELLVKGLSNACALLPDPARTKCQEVVGTFGPSLLDIFIHEVNPSSLCGVIGLCAARPELVEALEQPAPAIVSALLKEPTPPKQPAQPKQSALPAHVPPQKNGGFCEVCKKLVLYLEHNLEKNSTKEEILAALEKGCSFLPDPYQKQCDDFVAEYEPLLLEILVEVMDPGFVCSKIGVCPSAYKLLLGTEKCVWGPSYWCQNMETAARCNAVDHCKRHVWN", "length": 557 }, "evidence": [ { "id": "45917610", "url": "http://www.informatics.jax.org/homology/45917610", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 11, "go_terms": [ { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" }, { "name": "lysosome", "id": "GO:0005764", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005764", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" }, { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" }, { "name": "lysosomal membrane", "id": "GO:0005765", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005765", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" }, { "name": "late endosome", "id": "GO:0005770", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005770", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" }, { "name": "azurophil granule membrane", "id": "GO:0035577", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035577", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" }, { "name": "lysosomal lumen", "id": "GO:0043202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043202", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" }, { "name": "collagen-containing extracellular matrix", "id": "GO:0062023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062023", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 9, "go_terms": [ { "name": "sphingolipid metabolic process", "id": "GO:0006665", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006665", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" }, { "name": "adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway", "id": "GO:0007193", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007193", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" }, { "name": "regulation of autophagy", "id": "GO:0010506", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010506", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" }, { "name": "regulation of lipid metabolic process", "id": "GO:0019216", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019216", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" }, { "name": "prostate gland growth", "id": "GO:0060736", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060736", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" }, { "name": "epithelial cell differentiation involved in prostate gland development", "id": "GO:0060742", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060742", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" }, { "name": "lysosomal transport", "id": "GO:0007041", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007041", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" }, { "name": "ganglioside GM1 transport to membrane", "id": "GO:1905572", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905572", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" }, { "name": "positive regulation of beta-galactosidase activity", "id": "GO:1903771", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903771", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 11, "go_terms": [ { "name": "ganglioside GM1 binding", "id": "GO:1905573", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905573", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" }, { "name": "protease binding", "id": "GO:0002020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002020", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" }, { "name": "phospholipid binding", "id": "GO:0005543", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005543", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" }, { "name": "enzyme activator activity", "id": "GO:0008047", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008047", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" }, { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" }, { "name": "scaffold protein binding", "id": "GO:0097110", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097110", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" }, { "name": "ganglioside GM2 binding", "id": "GO:1905574", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905574", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" }, { "name": "ganglioside GM3 binding", "id": "GO:1905575", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905575", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" }, { "name": "ganglioside GP1c binding", "id": "GO:1905577", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905577", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" }, { "name": "ganglioside GT1b binding", "id": "GO:1905576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905576", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "prosaposin N-glycosylated 1 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-101 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan composition is represented by GlyTouCan:G03930BU. Example: UniProtKB:P07602-1, Asn-101, MOD:00160~GNO:G03930BU. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000053864", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053864" } ] }, { "name": "prosaposin N-glycosylated 2 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-101 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan composition is represented by GlyTouCan:G08293MJ. Example: UniProtKB:P07602-1, Asn-101, MOD:00160~GNO:G08293MJ. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000053865", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053865" } ] }, { "name": "prosaposin N-glycosylated 3 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-101 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G09724ZC. Example: UniProtKB:P07602-1, Asn-101, MOD:00160~GNO:G09724ZC. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053866", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053866" } ] }, { "name": "prosaposin N-glycosylated 4 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-101 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G12398HZ. Example: UniProtKB:P07602-1, Asn-101, MOD:00160~GNO:G12398HZ. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053867", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053867" } ] }, { "name": "prosaposin N-glycosylated 5 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-101 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G20030CU. Example: UniProtKB:P07602-1, Asn-101, MOD:00160~GNO:G20030CU. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053868", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053868" } ] }, { "name": "prosaposin N-glycosylated 6 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-101 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan composition is represented by GlyTouCan:G27622TD. Example: UniProtKB:P07602-1, Asn-101, MOD:00160~GNO:G27622TD. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000053869", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053869" } ] }, { "name": "prosaposin N-glycosylated 7 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-101 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G43299SD. Example: UniProtKB:P07602-1, Asn-101, MOD:00160~GNO:G43299SD. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053870", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053870" } ] }, { "name": "prosaposin N-glycosylated 8 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-101 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G45359RY. Example: UniProtKB:P07602-1, Asn-101, MOD:00160~GNO:G45359RY. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053871", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053871" } ] }, { "name": "prosaposin N-glycosylated 9 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-101 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G61207RZ. Example: UniProtKB:P07602-1, Asn-101, MOD:00160~GNO:G61207RZ. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053872", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053872" } ] }, { "name": "prosaposin N-glycosylated 10 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-101 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G63889NK. Example: UniProtKB:P07602-1, Asn-101, MOD:00160~GNO:G63889NK. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053873", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053873" } ] }, { "name": "prosaposin N-glycosylated 11 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-101 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G78059CC. Example: UniProtKB:P07602-1, Asn-101, MOD:00160~GNO:G78059CC. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053874", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053874" } ] }, { "name": "prosaposin N-glycosylated 12 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-101 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G79809MM. Example: UniProtKB:P07602-1, Asn-101, MOD:00160~GNO:G79809MM. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053875", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053875" } ] }, { "name": "prosaposin N-glycosylated 13 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-101 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G80858MF. Example: UniProtKB:P07602-1, Asn-101, MOD:00160~GNO:G80858MF. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053876", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053876" } ] }, { "name": "prosaposin N-glycosylated 14 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-101 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G80966KZ. Example: UniProtKB:P07602-1, Asn-101, MOD:00160~GNO:G80966KZ. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053877", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053877" } ] }, { "name": "prosaposin N-glycosylated 15 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-101 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G82348BZ. Example: UniProtKB:P07602-1, Asn-101, MOD:00160~GNO:G82348BZ. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053878", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053878" } ] }, { "name": "prosaposin N-glycosylated 16 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-101 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G86357DX. Example: UniProtKB:P07602-1, Asn-101, MOD:00160~GNO:G86357DX. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053879", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053879" } ] }, { "name": "prosaposin N-glycosylated 17 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-101 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G89993FE. Example: UniProtKB:P07602-1, Asn-101, MOD:00160~GNO:G89993FE. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053880", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053880" } ] }, { "name": "prosaposin N-glycosylated 18 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G00986YT. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G00986YT. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053881", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053881" } ] }, { "name": "prosaposin N-glycosylated 19 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G03216SJ. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G03216SJ. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053882", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053882" } ] }, { "name": "prosaposin N-glycosylated 20 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G04483SK. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G04483SK. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053883", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053883" } ] }, { "name": "prosaposin N-glycosylated 21 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G04744XB. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G04744XB. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053884", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053884" } ] }, { "name": "prosaposin N-glycosylated 22 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G07695ZT. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G07695ZT. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053885", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053885" } ] }, { "name": "prosaposin N-glycosylated 23 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G11994QC. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G11994QC. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053886", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053886" } ] }, { "name": "prosaposin N-glycosylated 24 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G12398HZ. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G12398HZ. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053887", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053887" } ] }, { "name": "prosaposin N-glycosylated 25 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G18938DW. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G18938DW. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053888", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053888" } ] }, { "name": "prosaposin N-glycosylated 26 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan composition is represented by GlyTouCan:G20956ZV. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G20956ZV. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000053889", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053889" } ] }, { "name": "prosaposin N-glycosylated 27 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan composition is represented by GlyTouCan:G25079LO. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G25079LO. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000053890", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053890" } ] }, { "name": "prosaposin N-glycosylated 28 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G28347RJ. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G28347RJ. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053891", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053891" } ] }, { "name": "prosaposin N-glycosylated 29 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G28663KH. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G28663KH. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053892", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053892" } ] }, { "name": "prosaposin N-glycosylated 30 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G29857RC. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G29857RC. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053893", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053893" } ] }, { "name": "prosaposin N-glycosylated 31 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G29905OR. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G29905OR. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053894", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053894" } ] }, { "name": "prosaposin N-glycosylated 32 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G30633FJ. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G30633FJ. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053895", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053895" } ] }, { "name": "prosaposin N-glycosylated 33 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G33734YD. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G33734YD. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053896", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053896" } ] }, { "name": "prosaposin N-glycosylated 34 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G36191CD. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G36191CD. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053897", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053897" } ] }, { "name": "prosaposin N-glycosylated 35 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G39213VZ. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G39213VZ. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053898", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053898" } ] }, { "name": "prosaposin N-glycosylated 36 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G39602UU. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G39602UU. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053899", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053899" } ] }, { "name": "prosaposin N-glycosylated 37 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G42264OV. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G42264OV. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053900", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053900" } ] }, { "name": "prosaposin N-glycosylated 38 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G42679AH. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G42679AH. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053901", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053901" } ] }, { "name": "prosaposin N-glycosylated 39 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G43664YB. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G43664YB. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053902", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053902" } ] }, { "name": "prosaposin N-glycosylated 40 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G45036WQ. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G45036WQ. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053903", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053903" } ] }, { "name": "prosaposin N-glycosylated 41 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G45187EI. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G45187EI. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053904", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053904" } ] }, { "name": "prosaposin N-glycosylated 42 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G45359RY. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G45359RY. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053905", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053905" } ] }, { "name": "prosaposin N-glycosylated 43 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G52428MJ. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G52428MJ. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053906", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053906" } ] }, { "name": "prosaposin N-glycosylated 44 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G56269EA. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G56269EA. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053907", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053907" } ] }, { "name": "prosaposin N-glycosylated 45 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G61334IA. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G61334IA. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053908", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053908" } ] }, { "name": "prosaposin N-glycosylated 46 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G61792ET. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G61792ET. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053909", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053909" } ] }, { "name": "prosaposin N-glycosylated 47 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G63889NK. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G63889NK. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053910", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053910" } ] }, { "name": "prosaposin N-glycosylated 48 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G66937TJ. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G66937TJ. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053911", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053911" } ] }, { "name": "prosaposin N-glycosylated 49 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G69411IG. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G69411IG. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053912", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053912" } ] }, { "name": "prosaposin N-glycosylated 50 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G78059CC. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G78059CC. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053913", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053913" } ] }, { "name": "prosaposin N-glycosylated 51 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G79809MM. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G79809MM. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053914", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053914" } ] }, { "name": "prosaposin N-glycosylated 52 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G81397LO. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G81397LO. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053915", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053915" } ] }, { "name": "prosaposin N-glycosylated 53 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G82348BZ. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G82348BZ. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053916", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053916" } ] }, { "name": "prosaposin N-glycosylated 54 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G83006TR. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G83006TR. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053917", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053917" } ] }, { "name": "prosaposin N-glycosylated 55 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G85041WE. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G85041WE. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053918", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053918" } ] }, { "name": "prosaposin N-glycosylated 56 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G86357DX. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G86357DX. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053919", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053919" } ] }, { "name": "prosaposin N-glycosylated 57 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan composition is represented by GlyTouCan:G87051GH. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G87051GH. [PRO:DNx, PMID:26791533, PMID:29741879]", "evidence": [ { "id": "PR:000053920", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053920" } ] }, { "name": "prosaposin N-glycosylated 58 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan composition is represented by GlyTouCan:G88374WZ. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G88374WZ. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000053921", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053921" } ] }, { "name": "prosaposin N-glycosylated 59 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-215 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G89993FE. Example: UniProtKB:P07602-1, Asn-215, MOD:00160~GNO:G89993FE. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053922", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053922" } ] }, { "name": "prosaposin N-glycosylated 60 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-332 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan composition is represented by GlyTouCan:G02815KT. Example: UniProtKB:P07602-1, Asn-332, MOD:00160~GNO:G02815KT. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000053923", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053923" } ] }, { "name": "prosaposin N-glycosylated 61 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-332 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G09724ZC. Example: UniProtKB:P07602-1, Asn-332, MOD:00160~GNO:G09724ZC. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053924", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053924" } ] }, { "name": "prosaposin N-glycosylated 62 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-332 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G12398HZ. Example: UniProtKB:P07602-1, Asn-332, MOD:00160~GNO:G12398HZ. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053925", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053925" } ] }, { "name": "prosaposin N-glycosylated 63 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-332 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G20030CU. Example: UniProtKB:P07602-1, Asn-332, MOD:00160~GNO:G20030CU. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053926", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053926" } ] }, { "name": "prosaposin N-glycosylated 64 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-332 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G28663KH. Example: UniProtKB:P07602-1, Asn-332, MOD:00160~GNO:G28663KH. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053927", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053927" } ] }, { "name": "prosaposin N-glycosylated 65 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-332 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G29905OR. Example: UniProtKB:P07602-1, Asn-332, MOD:00160~GNO:G29905OR. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053928", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053928" } ] }, { "name": "prosaposin N-glycosylated 66 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-332 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G34527RW. Example: UniProtKB:P07602-1, Asn-332, MOD:00160~GNO:G34527RW. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053929", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053929" } ] }, { "name": "prosaposin N-glycosylated 67 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-332 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G36191CD. Example: UniProtKB:P07602-1, Asn-332, MOD:00160~GNO:G36191CD. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053930", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053930" } ] }, { "name": "prosaposin N-glycosylated 68 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-332 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan composition is represented by GlyTouCan:G41247ZX. Example: UniProtKB:P07602-1, Asn-332, MOD:00160~GNO:G41247ZX. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000053931", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053931" } ] }, { "name": "prosaposin N-glycosylated 69 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-332 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G45359RY. Example: UniProtKB:P07602-1, Asn-332, MOD:00160~GNO:G45359RY. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053932", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053932" } ] }, { "name": "prosaposin N-glycosylated 70 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-332 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G59471TH. Example: UniProtKB:P07602-1, Asn-332, MOD:00160~GNO:G59471TH. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053933", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053933" } ] }, { "name": "prosaposin N-glycosylated 71 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-332 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G63889NK. Example: UniProtKB:P07602-1, Asn-332, MOD:00160~GNO:G63889NK. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053934", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053934" } ] }, { "name": "prosaposin N-glycosylated 72 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-332 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G64481DJ. Example: UniProtKB:P07602-1, Asn-332, MOD:00160~GNO:G64481DJ. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053935", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053935" } ] }, { "name": "prosaposin N-glycosylated 73 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-332 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan composition is represented by GlyTouCan:G72791KH. Example: UniProtKB:P07602-1, Asn-332, MOD:00160~GNO:G72791KH. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000053936", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053936" } ] }, { "name": "prosaposin N-glycosylated 74 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-332 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G78059CC. Example: UniProtKB:P07602-1, Asn-332, MOD:00160~GNO:G78059CC. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053937", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053937" } ] }, { "name": "prosaposin N-glycosylated 75 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-332 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G80966KZ. Example: UniProtKB:P07602-1, Asn-332, MOD:00160~GNO:G80966KZ. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053938", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053938" } ] }, { "name": "prosaposin N-glycosylated 76 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-332 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G93500PH. Example: UniProtKB:P07602-1, Asn-332, MOD:00160~GNO:G93500PH. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053939", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053939" } ] }, { "name": "prosaposin N-glycosylated 77 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-332 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G98140IX. Example: UniProtKB:P07602-1, Asn-332, MOD:00160~GNO:G98140IX. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053940", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053940" } ] }, { "name": "prosaposin N-glycosylated 78 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-426 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G36191CD. Example: UniProtKB:P07602-1, Asn-426, MOD:00160~GNO:G36191CD. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053941", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053941" } ] }, { "name": "prosaposin N-glycosylated 79 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-426 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan composition is represented by GlyTouCan:G37412TK. Example: UniProtKB:P07602-1, Asn-426, MOD:00160~GNO:G37412TK. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000053942", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053942" } ] }, { "name": "prosaposin N-glycosylated 80 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-426 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan composition is represented by GlyTouCan:G41247ZX. Example: UniProtKB:P07602-1, Asn-426, MOD:00160~GNO:G41247ZX. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000053943", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053943" } ] }, { "name": "prosaposin N-glycosylated 81 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-426 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G80966KZ. Example: UniProtKB:P07602-1, Asn-426, MOD:00160~GNO:G80966KZ. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053944", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053944" } ] }, { "name": "prosaposin N-glycosylated 82 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-426 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G82348BZ. Example: UniProtKB:P07602-1, Asn-426, MOD:00160~GNO:G82348BZ. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053945", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053945" } ] }, { "name": "prosaposin N-glycosylated 83 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G09724ZC. Example: UniProtKB:P07602-1, Asn-80, MOD:00160~GNO:G09724ZC. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053946", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053946" } ] }, { "name": "prosaposin N-glycosylated 84 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G12398HZ. Example: UniProtKB:P07602-1, Asn-80, MOD:00160~GNO:G12398HZ. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053947", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053947" } ] }, { "name": "prosaposin N-glycosylated 85 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G20030CU. Example: UniProtKB:P07602-1, Asn-80, MOD:00160~GNO:G20030CU. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053948", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053948" } ] }, { "name": "prosaposin N-glycosylated 86 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G43299SD. Example: UniProtKB:P07602-1, Asn-80, MOD:00160~GNO:G43299SD. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053949", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053949" } ] }, { "name": "prosaposin N-glycosylated 87 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G45359RY. Example: UniProtKB:P07602-1, Asn-80, MOD:00160~GNO:G45359RY. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053950", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053950" } ] }, { "name": "prosaposin N-glycosylated 88 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G61207RZ. Example: UniProtKB:P07602-1, Asn-80, MOD:00160~GNO:G61207RZ. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053951", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053951" } ] }, { "name": "prosaposin N-glycosylated 89 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G63889NK. Example: UniProtKB:P07602-1, Asn-80, MOD:00160~GNO:G63889NK. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053952", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053952" } ] }, { "name": "prosaposin N-glycosylated 90 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G78059CC. Example: UniProtKB:P07602-1, Asn-80, MOD:00160~GNO:G78059CC. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053953", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053953" } ] }, { "name": "prosaposin N-glycosylated 91 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G79809MM. Example: UniProtKB:P07602-1, Asn-80, MOD:00160~GNO:G79809MM. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053954", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053954" } ] }, { "name": "prosaposin N-glycosylated 92 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G80858MF. Example: UniProtKB:P07602-1, Asn-80, MOD:00160~GNO:G80858MF. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053955", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053955" } ] }, { "name": "prosaposin N-glycosylated 93 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G80966KZ. Example: UniProtKB:P07602-1, Asn-80, MOD:00160~GNO:G80966KZ. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053956", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053956" } ] }, { "name": "prosaposin N-glycosylated 94 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G82348BZ. Example: UniProtKB:P07602-1, Asn-80, MOD:00160~GNO:G82348BZ. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053957", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053957" } ] }, { "name": "prosaposin N-glycosylated 95 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G86357DX. Example: UniProtKB:P07602-1, Asn-80, MOD:00160~GNO:G86357DX. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053958", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053958" } ] }, { "name": "prosaposin N-glycosylated 96 (human)", "definition": "A prosaposin (human) that has been N-glycosylated at the residue equivalent to Asn-80 of the amino acid sequence represented by UniProtKB:P07602-1, in which the glycan structure is represented by GlyTouCan:G89993FE. Example: UniProtKB:P07602-1, Asn-80, MOD:00160~GNO:G89993FE. [PRO:DNx, PMID:11180632, PMID:2110822, PMID:8344278]", "evidence": [ { "id": "PR:000053959", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053959" } ] } ], "site_annotation": [ { "start_pos": 101, "end_pos": 103, "annotation": "n_glycosylation_sequon" }, { "start_pos": 215, "end_pos": 217, "annotation": "n_glycosylation_sequon" }, { "start_pos": 332, "end_pos": 334, "annotation": "n_glycosylation_sequon" }, { "start_pos": 426, "end_pos": 428, "annotation": "n_glycosylation_sequon" }, { "start_pos": 80, "end_pos": 82, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "N-linked glycans show a high degree of microheterogeneity.", "evidence": [ { "database": "UniProtKB", "id": "P07602", "url": "https://www.uniprot.org/uniprot/P07602" }, { "database": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" }, { "database": "PubMed", "id": "19167329", "url": "https://glygen.org/publication/PubMed/19167329" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 80, 101, 136, 215, 331, 332, 426 ], "o_linked_sites": [ 82, 93, 103, 105, 214, 216, 217, 281, 289, 334, 391, 393, 397, 401, 427 ], "snv_sites": [ 56, 60, 80, 93, 103, 215, 217, 245, 289, 332, 391, 397, 401, 427, 428 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 101, "end_pos": 103 }, { "start_pos": 215, "end_pos": 217 }, { "start_pos": 332, "end_pos": 334 }, { "start_pos": 426, "end_pos": 428 }, { "start_pos": 80, "end_pos": 82 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 366 }, { "field": "total_sites", "count": 22 }, { "field": "n_linked_glycans", "count": 167 }, { "field": "n_linked_glycan_sites", "count": 12 }, { "field": "o_linked_glycans", "count": 4 }, { "field": "o_linked_glycan_sites", "count": 15 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 6 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 360 }, { "field": "total_sites", "count": 21 }, { "field": "n_linked_glycans", "count": 167 }, { "field": "n_linked_glycan_sites", "count": 6 }, { "field": "o_linked_glycans", "count": 4 }, { "field": "o_linked_glycan_sites", "count": 15 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 18 }, { "field": "total_sites", "count": 15 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 274 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }