{ "uniprot_canonical_ac": "P07498-1", "uniprot_ac": "P07498", "uniprot_id": "CASK_HUMAN", "mass": { "chemical_mass": 20305.0, "monoisotopic_mass": 20305.0 }, "refseq": { "ac": "NP_005203", "name": "kappa-casein precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005203" }, "gene_names": [ { "name": "CSN3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P07498", "id": "P07498" }, { "name": "CASK", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P07498", "id": "P07498" }, { "name": "CNS10; CSN10; CSNK; KCA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005203", "id": "NP_005203" }, { "name": "CSN10", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P07498", "id": "P07498" }, { "name": "CSN3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005203", "id": "NP_005203" }, { "name": "CSNK", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P07498", "id": "P07498" } ], "protein_names": [ { "name": "Kappa-casein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P07498" }, { "name": "kappa-casein precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005203", "id": "NP_005203" }, { "name": "kappa-casein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005203", "id": "NP_005203" } ], "function": [ { "annotation": "CSN3 was found to contain an interesting coding polymorphism as well as containing excess rare variation as compared with the other genes evaluated in cerebral ischemia patients.", "evidence": [ { "database": "RefSeq", "id": "NP_005203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005203" }, { "database": "PubMed", "id": "22536414", "url": "https://glygen.org/publication/PubMed/22536414" } ] }, { "annotation": "Human milk plasma protein exterts an apoptotic effect on MCF-7 adenocarcinoma cells.", "evidence": [ { "database": "RefSeq", "id": "NP_005203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005203" }, { "database": "PubMed", "id": "18505157", "url": "https://glygen.org/publication/PubMed/18505157" } ] }, { "annotation": "Kappa-casein stabilizes micelle formation, preventing casein precipitation in milk.", "evidence": [ { "database": "UniProtKB", "id": "P07498", "url": "https://www.uniprot.org/uniprot/P07498#function" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs757968238", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757968238" }, { "id": "rs757968238", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757968238" }, { "id": "rs757968238", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs757968238#frequency_tab" }, { "id": "rs757968238", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757968238" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 134, "end_pos": 134, "sequence_org": "I", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (INT->NNT).", "chr_id": "4", "chr_pos": "70249311", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I134", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1403306682", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1403306682" }, { "id": "rs1403306682", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1403306682" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 137, "end_pos": 137, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NTI->NTT).", "chr_id": "4", "chr_pos": "70249320", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I137", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1226859746", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1226859746" }, { "id": "rs1226859746", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1226859746" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 143, "end_pos": 143, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "4", "chr_pos": "70249337", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T143", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs753256991", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753256991" }, { "id": "rs753256991", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753256991" }, { "id": "rs753256991", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs753256991#frequency_tab" }, { "id": "rs753256991", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs753256991" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 151, "end_pos": 151, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "4", "chr_pos": "70249361", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T151", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs758916271", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758916271" }, { "id": "rs758916271", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758916271" }, { "id": "rs758916271", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs758916271#frequency_tab" }, { "id": "rs758916271", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758916271" }, { "id": "22895193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22895193" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 151, "end_pos": 151, "sequence_org": "T", "sequence_mut": "M", "comment": "Somatic mutation passed 1 out of 1 filters: o-glyco-site-loss (T->M).", "chr_id": "4", "chr_pos": "70249362", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T151", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs1335410588", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1335410588" }, { "id": "rs1335410588", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1335410588#frequency_tab" }, { "id": "rs1335410588", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1335410588" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 157, "end_pos": 157, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "4", "chr_pos": "70249380", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T157", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1369127939", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1369127939" }, { "id": "rs1369127939", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1369127939#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 162, "end_pos": 162, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "4", "chr_pos": "70249394", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S162", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs777759332", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777759332" }, { "id": "rs777759332", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777759332" }, { "id": "rs777759332", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs777759332#frequency_tab" }, { "id": "rs777759332", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs777759332" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 167, "end_pos": 167, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->K).", "chr_id": "4", "chr_pos": "70249410", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T167", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs777759332", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777759332" }, { "id": "rs777759332", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777759332" }, { "id": "rs777759332", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs777759332#frequency_tab" }, { "id": "rs777759332", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs777759332" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 167, "end_pos": 167, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->M).", "chr_id": "4", "chr_pos": "70249410", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T167", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs777759332", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777759332" }, { "id": "rs777759332", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777759332" }, { "id": "rs777759332", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs777759332#frequency_tab" }, { "id": "rs777759332", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs777759332" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 167, "end_pos": 167, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->R).", "chr_id": "4", "chr_pos": "70249410", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T167", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs144706700", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs144706700" }, { "id": "rs144706700", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs144706700" }, { "id": "rs144706700", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs144706700" }, { "id": "rs144706700", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs144706700#frequency_tab" }, { "id": "rs144706700", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs144706700" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 178, "end_pos": 178, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "4", "chr_pos": "70249442", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "0.000998", "site_lbl": "T178", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1446413275", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1446413275" }, { "id": "rs1446413275", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1446413275" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 181, "end_pos": 181, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "4", "chr_pos": "70249451", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T181", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P07498", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07498" }, { "id": "rs765381118", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765381118" }, { "id": "rs765381118", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765381118" }, { "id": "rs765381118", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765381118" }, { "id": "rs765381118", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs765381118#frequency_tab" }, { "id": "rs765381118", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765381118" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 181, "end_pos": 181, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "M", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->M).", "chr_id": "4", "chr_pos": "70249452", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "T181", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:1319", "recommended_name": { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." }, "synonyms": [ { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "tumor of the Brain", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ] }, { "evidence": [ { "id": "P07498", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07498" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 181, "end_pos": 181, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "R", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->R).", "chr_id": "4", "chr_pos": "70249452", "ref_nt": "C", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "T181", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1175287921", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1175287921" }, { "id": "rs1175287921", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1175287921#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 55, "end_pos": 55, "sequence_org": "Y", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSY->NSS).", "chr_id": "4", "chr_pos": "70249074", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "Y55", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P07498", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07498" }, { "id": "rs746268983", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746268983" }, { "id": "rs746268983", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746268983" }, { "id": "rs746268983", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746268983" }, { "id": "rs746268983", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746268983" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 74, "end_pos": 74, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "P", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NNP->NNS).", "chr_id": "4", "chr_pos": "70249130", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "P74", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "37.56", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000171209", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000171209" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "42.8", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000171209", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000171209" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "27.66", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000171209", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000171209" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000171209", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000171209" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "17.43", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000171209", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000171209" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "24.31", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000171209", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000171209" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000171209", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000171209" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "42.23", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000171209", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000171209" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "23.38", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000171209", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000171209" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000171209", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000171209" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "24.08", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000171209", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000171209" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "17.63", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000171209", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000171209" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "49.14", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000171209", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000171209" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P07498", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07498" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P07498", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07498" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P07498", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07498" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P07498", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07498" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P07498", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07498" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P07498", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07498" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P07498", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07498" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P07498", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07498" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P07498", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07498" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P07498", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07498" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07498", "url": "https://www.uniprot.org/uniprot/P07498" } ], "common_name": "Human" } ], "gene": [ { "name": "CSN3", "url": "https://www.uniprot.org/uniprot/P07498", "locus": { "chromosome": "4", "start_pos": 70251474, "end_pos": 70238382, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000171209", "url": "https://www.ensembl.org/id/ENSG00000171209" } ] } } ], "crossref": [ { "id": "ENSG00000171209", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000171209", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P07498", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07498", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "CHEMBL3621024", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3621024", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "CSN3", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CSN3", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "1448", "url": "https://www.ncbi.nlm.nih.gov/gene/1448", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "308", "url": "https://glyconnect.expasy.org/browser/proteins/308", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "2446", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=2446", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P07498", "url": "https://www.ebi.ac.uk/intact/interactors/id:P07498*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000117", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000117", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:1448", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1448", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "601695", "url": "http://www.omim.org/entry/601695", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P07498", "url": "https://www.nextprot.org/entry/NX_P07498", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "HPSFIAI", "url": "https://omabrowser.org/oma/group/HPSFIAI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5265313at2759", "url": "http://www.orthodb.org/?query=5265313at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11470", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11470", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11470:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11470:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00997", "url": "http://pfam.xfam.org/family/PF00997", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P07498", "url": "https://pharos.nih.gov/targets/P07498", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000053754", "url": "https://proconsortium.org/app/entry/PR:000053754", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053755", "url": "https://proconsortium.org/app/entry/PR:000053755", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053756", "url": "https://proconsortium.org/app/entry/PR:000053756", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053757", "url": "https://proconsortium.org/app/entry/PR:000053757", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053758", "url": "https://proconsortium.org/app/entry/PR:000053758", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053759", "url": "https://proconsortium.org/app/entry/PR:000053759", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053760", "url": "https://proconsortium.org/app/entry/PR:000053760", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053761", "url": "https://proconsortium.org/app/entry/PR:000053761", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053762", "url": "https://proconsortium.org/app/entry/PR:000053762", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053763", "url": "https://proconsortium.org/app/entry/PR:000053763", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053764", "url": "https://proconsortium.org/app/entry/PR:000053764", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053765", "url": "https://proconsortium.org/app/entry/PR:000053765", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053766", "url": "https://proconsortium.org/app/entry/PR:000053766", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053767", "url": "https://proconsortium.org/app/entry/PR:000053767", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053768", "url": "https://proconsortium.org/app/entry/PR:000053768", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053769", "url": "https://proconsortium.org/app/entry/PR:000053769", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053770", "url": "https://proconsortium.org/app/entry/PR:000053770", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053771", "url": "https://proconsortium.org/app/entry/PR:000053771", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053772", "url": "https://proconsortium.org/app/entry/PR:000053772", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053773", "url": "https://proconsortium.org/app/entry/PR:000053773", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053774", "url": "https://proconsortium.org/app/entry/PR:000053774", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053775", "url": "https://proconsortium.org/app/entry/PR:000053775", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053776", "url": "https://proconsortium.org/app/entry/PR:000053776", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053777", "url": "https://proconsortium.org/app/entry/PR:000053777", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053778", "url": "https://proconsortium.org/app/entry/PR:000053778", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053779", "url": "https://proconsortium.org/app/entry/PR:000053779", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053780", "url": "https://proconsortium.org/app/entry/PR:000053780", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053781", "url": "https://proconsortium.org/app/entry/PR:000053781", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053782", "url": "https://proconsortium.org/app/entry/PR:000053782", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053783", "url": "https://proconsortium.org/app/entry/PR:000053783", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053784", "url": "https://proconsortium.org/app/entry/PR:000053784", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053785", "url": "https://proconsortium.org/app/entry/PR:000053785", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053786", "url": "https://proconsortium.org/app/entry/PR:000053786", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053787", "url": "https://proconsortium.org/app/entry/PR:000053787", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053788", "url": "https://proconsortium.org/app/entry/PR:000053788", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053789", "url": "https://proconsortium.org/app/entry/PR:000053789", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053790", "url": "https://proconsortium.org/app/entry/PR:000053790", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053791", "url": "https://proconsortium.org/app/entry/PR:000053791", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053792", "url": "https://proconsortium.org/app/entry/PR:000053792", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053793", "url": "https://proconsortium.org/app/entry/PR:000053793", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053794", "url": "https://proconsortium.org/app/entry/PR:000053794", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053795", "url": "https://proconsortium.org/app/entry/PR:000053795", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053796", "url": "https://proconsortium.org/app/entry/PR:000053796", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053797", "url": "https://proconsortium.org/app/entry/PR:000053797", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053798", "url": "https://proconsortium.org/app/entry/PR:000053798", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053799", "url": "https://proconsortium.org/app/entry/PR:000053799", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053800", "url": "https://proconsortium.org/app/entry/PR:000053800", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053801", "url": "https://proconsortium.org/app/entry/PR:000053801", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053802", "url": "https://proconsortium.org/app/entry/PR:000053802", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053803", "url": "https://proconsortium.org/app/entry/PR:000053803", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053804", "url": "https://proconsortium.org/app/entry/PR:000053804", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053805", "url": "https://proconsortium.org/app/entry/PR:000053805", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053806", "url": "https://proconsortium.org/app/entry/PR:000053806", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053807", "url": "https://proconsortium.org/app/entry/PR:000053807", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053808", "url": "https://proconsortium.org/app/entry/PR:000053808", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053809", "url": "https://proconsortium.org/app/entry/PR:000053809", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053810", "url": "https://proconsortium.org/app/entry/PR:000053810", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053811", "url": "https://proconsortium.org/app/entry/PR:000053811", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053812", "url": "https://proconsortium.org/app/entry/PR:000053812", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053813", "url": "https://proconsortium.org/app/entry/PR:000053813", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053814", "url": "https://proconsortium.org/app/entry/PR:000053814", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053815", "url": "https://proconsortium.org/app/entry/PR:000053815", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053816", "url": "https://proconsortium.org/app/entry/PR:000053816", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053817", "url": "https://proconsortium.org/app/entry/PR:000053817", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053818", "url": "https://proconsortium.org/app/entry/PR:000053818", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053819", "url": "https://proconsortium.org/app/entry/PR:000053819", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053820", "url": "https://proconsortium.org/app/entry/PR:000053820", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053821", "url": "https://proconsortium.org/app/entry/PR:000053821", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053822", "url": "https://proconsortium.org/app/entry/PR:000053822", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053823", "url": "https://proconsortium.org/app/entry/PR:000053823", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053824", "url": "https://proconsortium.org/app/entry/PR:000053824", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053825", "url": "https://proconsortium.org/app/entry/PR:000053825", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053826", "url": "https://proconsortium.org/app/entry/PR:000053826", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053827", "url": "https://proconsortium.org/app/entry/PR:000053827", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053828", "url": "https://proconsortium.org/app/entry/PR:000053828", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053829", "url": "https://proconsortium.org/app/entry/PR:000053829", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053830", "url": "https://proconsortium.org/app/entry/PR:000053830", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053831", "url": "https://proconsortium.org/app/entry/PR:000053831", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053832", "url": "https://proconsortium.org/app/entry/PR:000053832", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053833", "url": "https://proconsortium.org/app/entry/PR:000053833", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053834", "url": "https://proconsortium.org/app/entry/PR:000053834", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053835", "url": "https://proconsortium.org/app/entry/PR:000053835", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053836", "url": "https://proconsortium.org/app/entry/PR:000053836", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053837", "url": "https://proconsortium.org/app/entry/PR:000053837", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053838", "url": "https://proconsortium.org/app/entry/PR:000053838", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053839", "url": "https://proconsortium.org/app/entry/PR:000053839", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053840", "url": "https://proconsortium.org/app/entry/PR:000053840", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053841", "url": "https://proconsortium.org/app/entry/PR:000053841", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053842", "url": "https://proconsortium.org/app/entry/PR:000053842", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053843", "url": "https://proconsortium.org/app/entry/PR:000053843", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053844", "url": "https://proconsortium.org/app/entry/PR:000053844", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053845", "url": "https://proconsortium.org/app/entry/PR:000053845", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053846", "url": "https://proconsortium.org/app/entry/PR:000053846", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053847", "url": "https://proconsortium.org/app/entry/PR:000053847", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053848", "url": "https://proconsortium.org/app/entry/PR:000053848", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053849", "url": "https://proconsortium.org/app/entry/PR:000053849", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053850", "url": "https://proconsortium.org/app/entry/PR:000053850", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053851", "url": "https://proconsortium.org/app/entry/PR:000053851", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053852", "url": "https://proconsortium.org/app/entry/PR:000053852", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053853", "url": "https://proconsortium.org/app/entry/PR:000053853", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053854", "url": "https://proconsortium.org/app/entry/PR:000053854", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053855", "url": "https://proconsortium.org/app/entry/PR:000053855", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053856", "url": "https://proconsortium.org/app/entry/PR:000053856", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053857", "url": "https://proconsortium.org/app/entry/PR:000053857", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053858", "url": "https://proconsortium.org/app/entry/PR:000053858", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053859", "url": "https://proconsortium.org/app/entry/PR:000053859", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053860", "url": "https://proconsortium.org/app/entry/PR:000053860", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053861", "url": "https://proconsortium.org/app/entry/PR:000053861", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053862", "url": "https://proconsortium.org/app/entry/PR:000053862", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053863", "url": "https://proconsortium.org/app/entry/PR:000053863", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P07498", "url": "http://purl.obolibrary.org/obo/PR_P07498", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_005203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005203", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P07498", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "P07498", "url": "https://www.uniprot.org/uniprot/P07498", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07498-1", "url": "https://www.uniprot.org/uniprot/P07498-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKSFLLVVNALALTLPFLAVEVQNQKQPACHENDERPFYQKTAPYVPMYYVPNSYPYYGTNLYQRRPAIAINNPYVPRTYYANPAVVRPHAQIPQRQYLPNSHPPTVVRRPNLHPSFIAIPPKKIQDKIIIPTINTIATVEPTPAPATEPTVDSVVTPEAFSESIITSTPETTTVAVTPPTA", "length": 182, "header": "sp|P07498-1|CASK_HUMAN Isoform 1 of Kappa-casein OS=Homo sapiens OX=9606 GN=CSN3 PE=1 SV=3 CANONICAL=P07498-1" }, "isoforms": [ { "isoform_ac": "P07498-1", "url": "", "sequence": { "sequence": "MKSFLLVVNALALTLPFLAVEVQNQKQPACHENDERPFYQKTAPYVPMYYVPNSYPYYGTNLYQRRPAIAINNPYVPRTYYANPAVVRPHAQIPQRQYLPNSHPPTVVRRPNLHPSFIAIPPKKIQDKIIIPTINTIATVEPTPAPATEPTVDSVVTPEAFSESIITSTPETTTVAVTPPTA", "length": 182, "header": "sp|P07498-1|CASK_HUMAN Isoform 1 of Kappa-casein OS=Homo sapiens OX=9606 GN=CSN3 PE=1 SV=3 CANONICAL=P07498-1" }, "locus": { "chromosome": "4", "start_pos": 70249456, "end_pos": 70244820, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000304954.4", "url": "https://www.ensembl.org/id/ENST00000304954.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000304822.3", "url": "https://www.ensembl.org/id/ENSP00000304822.3" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 133, "start_aa": "Thr", "end_pos": 133, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr133", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G05848DX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 133, "start_aa": "Thr", "end_pos": 133, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr133", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G29231AT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 133, "start_aa": "Thr", "end_pos": 133, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr133", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G30871VQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 133, "start_aa": "Thr", "end_pos": 133, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr133", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G37653KL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 133, "start_aa": "Thr", "end_pos": 133, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr133", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G41424HD", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 133, "start_aa": "Thr", "end_pos": 133, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr133", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 133, "start_aa": "Thr", "end_pos": 133, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr133", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G69500TM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 133, "start_aa": "Thr", "end_pos": 133, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr133", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G70125XL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 133, "start_aa": "Thr", "end_pos": 133, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr133", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G86186US", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 133, "start_aa": "Thr", "end_pos": 133, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr133", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G91875JA", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 133, "start_aa": "Thr", "end_pos": 133, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr133", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 133, "start_aa": "Thr", "end_pos": 133, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr133", "evidence": [ { "id": "P07498", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07498#ptm_processing" }, { "id": "7460900", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7460900" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 143, "start_aa": "Thr", "end_pos": 143, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr143", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G05848DX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 143, "start_aa": "Thr", "end_pos": 143, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr143", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G29231AT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 143, "start_aa": "Thr", "end_pos": 143, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr143", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G30871VQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 143, "start_aa": "Thr", "end_pos": 143, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr143", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G37653KL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 143, "start_aa": "Thr", "end_pos": 143, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr143", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G41424HD", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 143, "start_aa": "Thr", "end_pos": 143, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr143", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 143, "start_aa": "Thr", "end_pos": 143, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr143", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G69500TM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 143, "start_aa": "Thr", "end_pos": 143, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr143", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G70125XL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 143, "start_aa": "Thr", "end_pos": 143, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr143", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G86186US", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 143, "start_aa": "Thr", "end_pos": 143, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr143", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G91875JA", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 143, "start_aa": "Thr", "end_pos": 143, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr143", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 143, "start_aa": "Thr", "end_pos": 143, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr143", "evidence": [ { "id": "P07498", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07498#ptm_processing" }, { "id": "7460900", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7460900" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 148, "start_aa": "Thr", "end_pos": 148, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr148", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G05848DX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 148, "start_aa": "Thr", "end_pos": 148, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr148", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G29231AT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 148, "start_aa": "Thr", "end_pos": 148, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr148", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G30871VQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 148, "start_aa": "Thr", "end_pos": 148, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr148", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G37653KL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 148, "start_aa": "Thr", "end_pos": 148, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr148", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G41424HD", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 148, "start_aa": "Thr", "end_pos": 148, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr148", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 148, "start_aa": "Thr", "end_pos": 148, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr148", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G69500TM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 148, "start_aa": "Thr", "end_pos": 148, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr148", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G70125XL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 148, "start_aa": "Thr", "end_pos": 148, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr148", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G86186US", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 148, "start_aa": "Thr", "end_pos": 148, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr148", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G91875JA", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 148, "start_aa": "Thr", "end_pos": 148, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr148", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 148, "start_aa": "Thr", "end_pos": 148, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr148", "evidence": [ { "id": "P07498", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07498#ptm_processing" }, { "id": "7460900", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7460900" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 151, "start_aa": "Thr", "end_pos": 151, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr151", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G05848DX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 151, "start_aa": "Thr", "end_pos": 151, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr151", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G29231AT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 151, "start_aa": "Thr", "end_pos": 151, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr151", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G30871VQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 151, "start_aa": "Thr", "end_pos": 151, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr151", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G37653KL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 151, "start_aa": "Thr", "end_pos": 151, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr151", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G41424HD", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 151, "start_aa": "Thr", "end_pos": 151, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr151", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 151, "start_aa": "Thr", "end_pos": 151, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr151", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G69500TM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 151, "start_aa": "Thr", "end_pos": 151, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr151", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G70125XL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 151, "start_aa": "Thr", "end_pos": 151, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr151", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G86186US", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 151, "start_aa": "Thr", "end_pos": 151, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr151", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G91875JA", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 151, "start_aa": "Thr", "end_pos": 151, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr151", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 151, "start_aa": "Thr", "end_pos": 151, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr151", "evidence": [ { "id": "P07498", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07498#ptm_processing" }, { "id": "7460900", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7460900" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 157, "start_aa": "Thr", "end_pos": 157, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr157", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G05848DX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 157, "start_aa": "Thr", "end_pos": 157, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr157", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G29231AT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 157, "start_aa": "Thr", "end_pos": 157, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr157", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G30871VQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 157, "start_aa": "Thr", "end_pos": 157, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr157", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G37653KL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 157, "start_aa": "Thr", "end_pos": 157, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr157", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G41424HD", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 157, "start_aa": "Thr", "end_pos": 157, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr157", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 157, "start_aa": "Thr", "end_pos": 157, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr157", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G69500TM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 157, "start_aa": "Thr", "end_pos": 157, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr157", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G70125XL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 157, "start_aa": "Thr", "end_pos": 157, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr157", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G86186US", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 157, "start_aa": "Thr", "end_pos": 157, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr157", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G91875JA", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 157, "start_aa": "Thr", "end_pos": 157, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr157", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine; alternate O-GalNAcylation", "start_pos": 157, "start_aa": "Thr", "end_pos": 157, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr157", "evidence": [ { "id": "P07498", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07498#ptm_processing" }, { "id": "7460900", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7460900" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 162, "start_aa": "Ser", "end_pos": 162, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser162", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G05848DX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 162, "start_aa": "Ser", "end_pos": 162, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser162", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G29231AT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 162, "start_aa": "Ser", "end_pos": 162, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser162", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G30871VQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 162, "start_aa": "Ser", "end_pos": 162, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser162", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G37653KL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 162, "start_aa": "Ser", "end_pos": 162, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser162", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G41424HD", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 162, "start_aa": "Ser", "end_pos": 162, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser162", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 162, "start_aa": "Ser", "end_pos": 162, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser162", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G69500TM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 162, "start_aa": "Ser", "end_pos": 162, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser162", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G70125XL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 162, "start_aa": "Ser", "end_pos": 162, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser162", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G86186US", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 162, "start_aa": "Ser", "end_pos": 162, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser162", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G91875JA", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 162, "start_aa": "Ser", "end_pos": 162, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser162", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 167, "start_aa": "Thr", "end_pos": 167, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr167", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G05848DX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 167, "start_aa": "Thr", "end_pos": 167, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr167", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G29231AT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 167, "start_aa": "Thr", "end_pos": 167, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr167", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G30871VQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 167, "start_aa": "Thr", "end_pos": 167, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr167", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G37653KL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 167, "start_aa": "Thr", "end_pos": 167, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr167", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G41424HD", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 167, "start_aa": "Thr", "end_pos": 167, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr167", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 167, "start_aa": "Thr", "end_pos": 167, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr167", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G69500TM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 167, "start_aa": "Thr", "end_pos": 167, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr167", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G70125XL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 167, "start_aa": "Thr", "end_pos": 167, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr167", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G86186US", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 167, "start_aa": "Thr", "end_pos": 167, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr167", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G91875JA", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 167, "start_aa": "Thr", "end_pos": 167, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr167", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 167, "start_aa": "Thr", "end_pos": 167, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr167", "evidence": [ { "id": "P07498", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07498#ptm_processing" }, { "id": "7460900", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7460900" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 169, "start_aa": "Thr", "end_pos": 169, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr169", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G05848DX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 169, "start_aa": "Thr", "end_pos": 169, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr169", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G29231AT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 169, "start_aa": "Thr", "end_pos": 169, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr169", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G30871VQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 169, "start_aa": "Thr", "end_pos": 169, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr169", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G37653KL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 169, "start_aa": "Thr", "end_pos": 169, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr169", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G41424HD", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 169, "start_aa": "Thr", "end_pos": 169, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr169", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 169, "start_aa": "Thr", "end_pos": 169, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr169", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G69500TM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 169, "start_aa": "Thr", "end_pos": 169, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr169", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G70125XL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 169, "start_aa": "Thr", "end_pos": 169, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr169", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G86186US", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 169, "start_aa": "Thr", "end_pos": 169, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr169", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G91875JA", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 169, "start_aa": "Thr", "end_pos": 169, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr169", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 169, "start_aa": "Thr", "end_pos": 169, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr169", "evidence": [ { "id": "P07498", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07498#ptm_processing" }, { "id": "7460900", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7460900" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 178, "start_aa": "Thr", "end_pos": 178, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr178", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G05848DX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 178, "start_aa": "Thr", "end_pos": 178, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr178", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G29231AT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 178, "start_aa": "Thr", "end_pos": 178, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr178", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G30871VQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 178, "start_aa": "Thr", "end_pos": 178, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr178", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G37653KL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 178, "start_aa": "Thr", "end_pos": 178, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr178", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G41424HD", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 178, "start_aa": "Thr", "end_pos": 178, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr178", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 178, "start_aa": "Thr", "end_pos": 178, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr178", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G69500TM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 178, "start_aa": "Thr", "end_pos": 178, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr178", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G70125XL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 178, "start_aa": "Thr", "end_pos": 178, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr178", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G86186US", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 178, "start_aa": "Thr", "end_pos": 178, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr178", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G91875JA", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 178, "start_aa": "Thr", "end_pos": 178, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr178", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 178, "start_aa": "Thr", "end_pos": 178, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr178", "evidence": [ { "id": "P07498", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07498#ptm_processing" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 181, "start_aa": "Thr", "end_pos": 181, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr181", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G05848DX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 181, "start_aa": "Thr", "end_pos": 181, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr181", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G29231AT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 181, "start_aa": "Thr", "end_pos": 181, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr181", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G30871VQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 181, "start_aa": "Thr", "end_pos": 181, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr181", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G37653KL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 181, "start_aa": "Thr", "end_pos": 181, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr181", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G41424HD", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 181, "start_aa": "Thr", "end_pos": 181, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr181", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 181, "start_aa": "Thr", "end_pos": 181, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr181", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G69500TM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 181, "start_aa": "Thr", "end_pos": 181, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr181", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G70125XL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 181, "start_aa": "Thr", "end_pos": 181, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr181", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G86186US", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 181, "start_aa": "Thr", "end_pos": 181, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr181", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G91875JA", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-133, T-143, T-148, T-151, T-157, S-162, T-167, T-169, T-178, T-181", "start_pos": 181, "start_aa": "Thr", "end_pos": 181, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr181", "evidence": [ { "id": "P07498", "database": "UniCarbKB", "url": "" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "308", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/308" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G05848DX", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "308", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/308" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G22355FZ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "308", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/308" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G29231AT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "308", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/308" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "308", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/308" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G30871VQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "308", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/308" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G37653KL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "308", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/308" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G41424HD", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "308", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/308" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G63628AV", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "308", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/308" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "308", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/308" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G69500TM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "308", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/308" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G70125XL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "308", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/308" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G86186US", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "308", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/308" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "glytoucan_ac": "G91875JA", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "308", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/308" }, { "id": "3342257", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3342257" } ] } ], "phosphorylation": [ { "start_pos": 157, "end_pos": 157, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; alternate", "evidence": [ { "database": "UniProtKB", "id": "P07498", "url": "https://www.uniprot.org/uniprot/P07498" } ], "site_lbl": "Thr157" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Structural features of a peptide corresponding to human kappa-casein residues 84-101 by 1H-nuclear magnetic resonance spectroscopy.", "journal": "J. Dairy Res.", "date": "1999", "authors": "Plowman J E, Creamer L K, Liddell M J, Cross J J", "evidence": [ { "database": "UniProtKB", "id": "P07498", "url": "https://www.uniprot.org/uniprot/P07498" } ], "reference": [ { "type": "PubMed", "id": "10191473", "url": "https://glygen.org/publication/PubMed/10191473" } ] }, { "title": "Heterozygous mutations in ANKH, the human ortholog of the mouse progressive ankylosis gene, result in craniometaphyseal dysplasia.", "journal": "Nature genetics", "date": "2001", "authors": "Nurnberg P, Thiele H, Chandler D, Hohne W, Cunningham ML, Ritter H, Leschik G, Uhlmann K, Mischung C, Harrop K, Goldblatt J, Borochowitz ZU, Kotzot D, Westermann F, Mundlos S, Braun HS, Laing N, Tinschert S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345" } ], "reference": [ { "type": "PubMed", "id": "11326272", "url": "https://glygen.org/publication/PubMed/11326272" } ] }, { "title": "Autosomal dominant craniometaphyseal dysplasia is caused by mutations in the transmembrane protein ANK.", "journal": "American journal of human genetics", "date": "2001", "authors": "Reichenberger E, Tiziani V, Watanabe S, Park L, Ueki Y, Santanna C, Baur ST, Shiang R, Grange DK, Beighton P, Gardner J, Hamersma H, Sellars S, Ramesar R, Lidral AC, Sommer A, Raposo do Amaral CM, Gorlin RJ, Mulliken JB, Olsen BR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345" } ], "reference": [ { "type": "PubMed", "id": "11326338", "url": "https://glygen.org/publication/PubMed/11326338" } ] }, { "title": "The human mitochondrial Mrs2 protein functionally substitutes for its yeast homologue, a candidate magnesium transporter.", "journal": "Genomics", "date": "2001", "authors": "Zsurka G, Gregan J, Schweyen RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345" } ], "reference": [ { "type": "PubMed", "id": "11401429", "url": "https://glygen.org/publication/PubMed/11401429" } ] }, { "title": "Mutations in ANKH cause chondrocalcinosis.", "journal": "American journal of human genetics", "date": "2002", "authors": "Pendleton A, Johnson MD, Hughes A, Gurley KA, Ho AM, Doherty M, Dixey J, Gillet P, Loeuille D, McGrath R, Reginato A, Shiang R, Wright G, Netter P, Williams C, Kingsley DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345" } ], "reference": [ { "type": "PubMed", "id": "12297987", "url": "https://glygen.org/publication/PubMed/12297987" } ] }, { "title": "Autosomal dominant familial calcium pyrophosphate dihydrate deposition disease is caused by mutation in the transmembrane protein ANKH.", "journal": "American journal of human genetics", "date": "2002", "authors": "Williams CJ, Zhang Y, Timms A, Bonavita G, Caeiro F, Broxholme J, Cuthbertson J, Jones Y, Marchegiani R, Reginato A, Russell RG, Wordsworth BP, Carr AJ, Brown MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345" } ], "reference": [ { "type": "PubMed", "id": "12297989", "url": "https://glygen.org/publication/PubMed/12297989" } ] }, { "title": "Expression analysis of the human adducin gene family and evidence of ADD2 beta4 multiple splicing variants.", "journal": "Biochemical and biophysical research communications", "date": "2003", "authors": "Citterio L, Tizzoni L, Catalano M, Zerbini G, Bianchi G, Barlassina C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345" } ], "reference": [ { "type": "PubMed", "id": "12951058", "url": "https://glygen.org/publication/PubMed/12951058" } ] }, { "title": "Cloning and sequencing of human kappa-casein cDNA.", "journal": "DNA Seq.", "date": "1992", "authors": "Bergstrom S, Hansson L, Hernell O, Lonnerdal B, Nilsson AK, Stromqvist M", "evidence": [ { "database": "UniProtKB", "id": "P07498", "url": "https://www.uniprot.org/uniprot/P07498" } ], "reference": [ { "type": "PubMed", "id": "1296818", "url": "https://glygen.org/publication/PubMed/1296818" } ] }, { "title": "Mutations in the amino terminus of ANKH in two US families with calcium pyrophosphate dihydrate crystal deposition disease.", "journal": "Arthritis and rheumatism", "date": "2003", "authors": "Williams CJ, Pendleton A, Bonavita G, Reginato AJ, Hughes AE, Peariso S, Doherty M, McCarty DJ, Ryan LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345" } ], "reference": [ { "type": "PubMed", "id": "13130483", "url": "https://glygen.org/publication/PubMed/13130483" } ] }, { "title": "Induction of lipolysis in vitro and loss of body fat in vivo by zinc-alpha2-glycoprotein.", "journal": "Biochimica et biophysica acta", "date": "2004", "authors": "Russell ST, Zimmerman TP, Domin BA, Tisdale MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345" } ], "reference": [ { "type": "PubMed", "id": "14984739", "url": "https://glygen.org/publication/PubMed/14984739" } ] }, { "title": "Identification and characterization of a novel mammalian Mg2+ transporter with channel-like properties.", "journal": "BMC genomics", "date": "2005", "authors": "Goytain A, Quamme GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345" } ], "reference": [ { "type": "PubMed", "id": "15804357", "url": "https://glygen.org/publication/PubMed/15804357" } ] }, { "title": "NIPA1(SPG6), the basis for autosomal dominant form of hereditary spastic paraplegia, encodes a functional Mg2+ transporter.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Goytain A, Hines RM, El-Husseini A, Quamme GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345" } ], "reference": [ { "type": "PubMed", "id": "17166836", "url": "https://glygen.org/publication/PubMed/17166836" } ] }, { "title": "Identification and characterization of a novel family of membrane magnesium transporters, MMgT1 and MMgT2.", "journal": "American journal of physiology. Cell physiology", "date": "2008", "authors": "Goytain A, Quamme GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345" } ], "reference": [ { "type": "PubMed", "id": "18057121", "url": "https://glygen.org/publication/PubMed/18057121" } ] }, { "title": "Dematin and adducin provide a novel link between the spectrin cytoskeleton and human erythrocyte membrane by directly interacting with glucose transporter-1.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Khan AA, Hanada T, Mohseni M, Jeong JJ, Zeng L, Gaetani M, Li D, Reed BC, Speicher DW, Chishti AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345" } ], "reference": [ { "type": "PubMed", "id": "18347014", "url": "https://glygen.org/publication/PubMed/18347014" } ] }, { "title": "Primary structure and domain organization of human alpha and beta adducin.", "journal": "The Journal of cell biology", "date": "1991", "authors": "Joshi R, Gilligan DM, Otto E, McLaughlin T, Bennett V", "evidence": [ { "database": "Reactome", "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345" } ], "reference": [ { "type": "PubMed", "id": "1840603", "url": "https://glygen.org/publication/PubMed/1840603" } ] }, { "title": "Lactaptin is a human milk protein inducing apoptosis of MCF-7 adenocarcinoma cells.", "journal": "Doklady. Biochemistry and biophysics", "date": "2008", "authors": "Nekipelaya VV, Semenov DV, Potapenko MO, Kuligina EV, Kit Yu, Romanova IV, Richter VA", "evidence": [ { "database": "RefSeq", "id": "NP_005203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005203" } ], "reference": [ { "type": "PubMed", "id": "18505157", "url": "https://glygen.org/publication/PubMed/18505157" } ] }, { "title": "Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma.", "journal": "Journal of molecular biology", "date": "2008", "authors": "Hassan MI, Bilgrami S, Kumar V, Singh N, Yadav S, Kaur P, Singh TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345" } ], "reference": [ { "type": "PubMed", "id": "18930737", "url": "https://glygen.org/publication/PubMed/18930737" } ] }, { "title": "A functional and regulatory network associated with PIP expression in human breast cancer.", "journal": "PloS one", "date": "2009", "authors": "Debily MA, Marhomy SE, Boulanger V, Eveno E, Mariage-Samson R, Camarca A, Auffray C, Piatier-Tonneau D, Imbeaud S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345" } ], "reference": [ { "type": "PubMed", "id": "19262752", "url": "https://glygen.org/publication/PubMed/19262752" } ] }, { "title": "The prolactin-inducible protein (PIP/GCDFP-15) gene: cloning, structure and regulation.", "journal": "Molecular and cellular endocrinology", "date": "1991", "authors": "Myal Y, Robinson DB, Iwasiow B, Tsuyuki D, Wong P, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345" } ], "reference": [ { "type": "PubMed", "id": "1955075", "url": "https://glygen.org/publication/PubMed/1955075" } ] }, { "title": "Mammalian MagT1 and TUSC3 are required for cellular magnesium uptake and vertebrate embryonic development.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Zhou H, Clapham DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345" } ], "reference": [ { "type": "PubMed", "id": "19717468", "url": "https://glygen.org/publication/PubMed/19717468" } ] }, { "title": "Defining human ERAD networks through an integrative mapping strategy.", "journal": "Nature cell biology", "date": "2011", "authors": "Christianson JC, Olzmann JA, Shaler TA, Sowa ME, Bennett EJ, Richter CM, Tyler RE, Greenblatt EJ, Harper JW, Kopito RR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345" } ], "reference": [ { "type": "PubMed", "id": "22119785", "url": "https://glygen.org/publication/PubMed/22119785" } ] }, { "title": "Rare variants in ischemic stroke: an exome pilot study.", "journal": "PloS one", "date": "2012", "authors": "Cole JW, Stine OC, Liu X, Pratap A, Cheng Y, Tallon LJ, Sadzewicz LK, Dueker N, Wozniak MA, Stern BJ, Meschia JF, Mitchell BD, Kittner SJ, O'Connell JR", "evidence": [ { "database": "RefSeq", "id": "NP_005203", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005203" } ], "reference": [ { "type": "PubMed", "id": "22536414", "url": "https://glygen.org/publication/PubMed/22536414" } ] }, { "title": "Recurrent R-spondin fusions in colon cancer.", "journal": "Nature", "date": "2012", "authors": "Seshagiri S, Stawiski EW, Durinck S, Modrusan Z, Storm EE, Conboy CB, Chaudhuri S, Guan Y, Janakiraman V, Jaiswal BS, Guillory J, Ha C, Dijkgraaf GJ, Stinson J, Gnad F, Huntley MA, Degenhardt JD, Haverty PM, Bourgon R, Wang W, Koeppen H, Gentleman R, Starr TK, Zhang Z, Largaespada DA, Wu TD, de Sauvage FJ", "evidence": [ { "database": "dbSNP", "id": "rs758916271", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758916271" } ], "reference": [ { "type": "PubMed", "id": "22895193", "url": "https://glygen.org/publication/PubMed/22895193" } ] }, { "title": "Heptahelical protein PQLC2 is a lysosomal cationic amino acid exporter underlying the action of cysteamine in cystinosis therapy.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Jezegou A, Llinares E, Anne C, Kieffer-Jaquinod S, O'Regan S, Aupetit J, Chabli A, Sagne C, Debacker C, Chadefaux-Vekemans B, Journet A, Andre B, Gasnier B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345" } ], "reference": [ { "type": "PubMed", "id": "23169667", "url": "https://glygen.org/publication/PubMed/23169667" } ] }, { "title": "SWELL1, a plasma membrane protein, is an essential component of volume-regulated anion channel.", "journal": "Cell", "date": "2014", "authors": "Qiu Z, Dubin AE, Mathur J, Tu B, Reddy K, Miraglia LJ, Reinhardt J, Orth AP, Patapoutian A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345" } ], "reference": [ { "type": "PubMed", "id": "24725410", "url": "https://glygen.org/publication/PubMed/24725410" } ] }, { "title": "Identification of LRRC8 heteromers as an essential component of the volume-regulated anion channel VRAC.", "journal": "Science (New York, N.Y.)", "date": "2014", "authors": "Voss FK, Ullrich F, Munch J, Lazarow K, Lutter D, Mah N, Andrade-Navarro MA, von Kries JP, Stauber T, Jentsch TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345" } ], "reference": [ { "type": "PubMed", "id": "24790029", "url": "https://glygen.org/publication/PubMed/24790029" } ] }, { "title": "Volume-regulated anion channel--a frenemy within the brain.", "journal": "Pflugers Archiv : European journal of physiology", "date": "2016", "authors": "Mongin AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345" } ], "reference": [ { "type": "PubMed", "id": "26620797", "url": "https://glygen.org/publication/PubMed/26620797" } ] }, { "title": "VRAC: molecular identification as LRRC8 heteromers with differential functions.", "journal": "Pflugers Archiv : European journal of physiology", "date": "2016", "authors": "Jentsch TJ, Lutter D, Planells-Cases R, Ullrich F, Voss FK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345" } ], "reference": [ { "type": "PubMed", "id": "26635246", "url": "https://glygen.org/publication/PubMed/26635246" } ] }, { "title": "LRRC8 Proteins Form Volume-Regulated Anion Channels that Sense Ionic Strength.", "journal": "Cell", "date": "2016", "authors": "Syeda R, Qiu Z, Dubin AE, Murthy SE, Florendo MN, Mason DE, Mathur J, Cahalan SM, Peters EC, Montal M, Patapoutian A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345" } ], "reference": [ { "type": "PubMed", "id": "26824658", "url": "https://glygen.org/publication/PubMed/26824658" } ] }, { "title": "Chemical structure of neutral sugar chains isolated from human mature milk kappa-casein.", "journal": "Biochimica et biophysica acta", "date": "1988", "authors": "Saito T, Itoh T, Adachi S", "evidence": [ { "database": "UniCarbKB", "id": "P07498", "url": "" }, { "database": "GlyConnect", "id": "308", "url": "https://glyconnect.expasy.org/browser/proteins/308" } ], "reference": [ { "type": "PubMed", "id": "3342257", "url": "https://glygen.org/publication/PubMed/3342257" } ] }, { "title": "Preparation and amino acid sequence of human kappa-casein.", "journal": "FEBS Lett.", "date": "1985", "authors": "Brignon G, Chtourou A, Ribadeau-Dumas B", "evidence": [ { "database": "UniProtKB", "id": "P07498", "url": "https://www.uniprot.org/uniprot/P07498" }, { "database": "Reactome", "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345" } ], "reference": [ { "type": "PubMed", "id": "4018271", "url": "https://glygen.org/publication/PubMed/4018271" } ] }, { "title": "Localisation and importance of the sugar part of human casein.", "journal": "European journal of biochemistry", "date": "1980", "authors": "Fiat AM, Jolles J, Aubert JP, Loucheux-Lefebvre MH, Jolles P", "evidence": [ { "database": "UniProtKB", "id": "P07498", "url": "https://www.uniprot.org/uniprot/P07498#ptm_processing" }, { "database": "UniProtKB", "id": "P07498", "url": "https://www.uniprot.org/uniprot/P07498" } ], "reference": [ { "type": "PubMed", "id": "7460900", "url": "https://glygen.org/publication/PubMed/7460900" } ] }, { "title": "Isoform cloning, actin binding, and chromosomal localization of human erythroid dematin, a member of the villin superfamily.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Azim AC, Knoll JH, Beggs AH, Chishti AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345" } ], "reference": [ { "type": "PubMed", "id": "7615546", "url": "https://glygen.org/publication/PubMed/7615546" } ] }, { "title": "Characterization of three types of human alpha s1-casein mRNA transcripts.", "journal": "The Biochemical journal", "date": "1995", "authors": "Johnsen LB, Rasmussen LK, Petersen TE, Berglund L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345" } ], "reference": [ { "type": "PubMed", "id": "7619062", "url": "https://glygen.org/publication/PubMed/7619062" } ] }, { "title": "Human alpha s1-casein: purification and characterization.", "journal": "Comparative biochemistry and physiology. Part B, Biochemistry & molecular biology", "date": "1995", "authors": "Rasmussen LK, Due HA, Petersen TE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345" } ], "reference": [ { "type": "PubMed", "id": "7749638", "url": "https://glygen.org/publication/PubMed/7749638" } ] }, { "title": "Structure of the human kappa-casein gene.", "journal": "Gene", "date": "1996", "authors": "Edlund A, Johansson T, Leidvik B, Hansson L", "evidence": [ { "database": "UniProtKB", "id": "P07498", "url": "https://www.uniprot.org/uniprot/P07498" } ], "reference": [ { "type": "PubMed", "id": "8863730", "url": "https://glygen.org/publication/PubMed/8863730" } ] }, { "title": "Biochemical characterization and crystalization of human Zn-alpha2-glycoprotein, a soluble class I major histocompatibility complex homolog.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Sanchez LM, Lopez-Otin C, Bjorkman PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5223345", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345" } ], "reference": [ { "type": "PubMed", "id": "9114041", "url": "https://glygen.org/publication/PubMed/9114041" } ] } ], "pathway": [ { "id": "hsa:1448", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1448", "resource": "KEGG Pathway" }, { "id": "R-HSA-5223345", "name": "Miscellaneous transport and binding events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5223345", "resource": "Reactome", "description": "Miscellaneous transport and binding events" } ], "orthologs": [ { "uniprot_canonical_ac": "F1RVB2-1", "protein_name": "Kappa-casein", "gene_name": "CSN3", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MMKSSFLIVPILALTLPFLGAEEQNQEKLTRCESDKRLFNEEKVKYIPIYYMLNRFPSYGFFYQHRSAVSPNRQFIPYPYYARPVVAGPHAQKPQWQDQPNVYPPTVARRPPHASFIAIPPKKNQDKTAIPAINSIATVEPTIVPATEPIVNAEPIVNAVVTPEASSEFLITSAPETTTVQVTSPVV", "length": 187 }, "evidence": [ { "id": "P07498", "url": "https://omabrowser.org/oma/group/P07498/", "database": "OMA" } ], "common_name": "Pig" }, { "uniprot_canonical_ac": "P04468-1", "protein_name": "Kappa-casein", "gene_name": "Csn3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MMRNFIVVMNILALTLPFLAAEVQNPDSNCREKNEVVYDVQRVLYTPVSSVLNRNHYEPIYYHYRTSVPVSPYAYFPVGLKLLLLRSPAQILKWQPMPNFPQPVGVPHPIPNPSFLAIPTNEKHDNTAIPASNTIAPIVSTPVSTTESVVNTVANTEASTVPISTPETATVPVTSPAA", "length": 178 }, "evidence": [ { "id": "45933436", "url": "http://www.informatics.jax.org/homology/45933436", "database": "MGI" }, { "id": "P07498", "url": "https://omabrowser.org/oma/group/P07498/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P06796-1", "protein_name": "Kappa-casein", "gene_name": "Csn3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MMRNFIVVVNILALTLPFLAAEIQNPDSNCRGEKNDIVYDEQRVLYTPVRSVLNFNQYEPNYYHYRPSLPATASPYMYYPLVVRLLLLRSPAPISKWQSMPNFPQSAGVPYAIPNPSFLAMPTNENQDNTAIPTIDPITPIVSTPVPTMESIVNTVANPEASTVSINTPETTTVPVSSTAA", "length": 181 }, "evidence": [ { "id": "45933436", "url": "http://www.informatics.jax.org/homology/45933436", "database": "MGI" }, { "id": "P07498", "url": "https://omabrowser.org/oma/group/P07498/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P07498", "url": "https://www.uniprot.org/uniprot/P07498" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P07498", "url": "https://www.uniprot.org/uniprot/P07498" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "protein stabilization", "id": "GO:0050821", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050821", "evidence": [ { "database": "UniProtKB", "id": "P07498", "url": "https://www.uniprot.org/uniprot/P07498" } ], "pmid": "" }, { "name": "lactation", "id": "GO:0007595", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007595", "evidence": [ { "database": "UniProtKB", "id": "P07498", "url": "https://www.uniprot.org/uniprot/P07498" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "kappa-casein O-glycosylated 1 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Ser-162 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P07498-1, Ser-162, MOD:00002~GNO:G00031MO. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053754", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053754" } ] }, { "name": "kappa-casein O-glycosylated 2 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Ser-162 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G05848DX. Example: UniProtKB:P07498-1, Ser-162, MOD:00002~GNO:G05848DX. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053755", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053755" } ] }, { "name": "kappa-casein O-glycosylated 3 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Ser-162 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G29231AT. Example: UniProtKB:P07498-1, Ser-162, MOD:00002~GNO:G29231AT. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053756", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053756" } ] }, { "name": "kappa-casein O-glycosylated 4 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Ser-162 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G30871VQ. Example: UniProtKB:P07498-1, Ser-162, MOD:00002~GNO:G30871VQ. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053757", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053757" } ] }, { "name": "kappa-casein O-glycosylated 5 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Ser-162 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G37653KL. Example: UniProtKB:P07498-1, Ser-162, MOD:00002~GNO:G37653KL. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053758", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053758" } ] }, { "name": "kappa-casein O-glycosylated 6 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Ser-162 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G41424HD. Example: UniProtKB:P07498-1, Ser-162, MOD:00002~GNO:G41424HD. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053759", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053759" } ] }, { "name": "kappa-casein O-glycosylated 7 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Ser-162 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G64973KT. Example: UniProtKB:P07498-1, Ser-162, MOD:00002~GNO:G64973KT. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053760", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053760" } ] }, { "name": "kappa-casein O-glycosylated 8 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Ser-162 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G69500TM. Example: UniProtKB:P07498-1, Ser-162, MOD:00002~GNO:G69500TM. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053761", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053761" } ] }, { "name": "kappa-casein O-glycosylated 9 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Ser-162 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G70125XL. Example: UniProtKB:P07498-1, Ser-162, MOD:00002~GNO:G70125XL. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053762", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053762" } ] }, { "name": "kappa-casein O-glycosylated 10 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Ser-162 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G86186US. Example: UniProtKB:P07498-1, Ser-162, MOD:00002~GNO:G86186US. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053763", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053763" } ] }, { "name": "kappa-casein O-glycosylated 11 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Ser-162 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G91875JA. Example: UniProtKB:P07498-1, Ser-162, MOD:00002~GNO:G91875JA. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053764", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053764" } ] }, { "name": "kappa-casein O-glycosylated 12 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-133 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P07498-1, Thr-133, MOD:00005~GNO:G00031MO. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053765", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053765" } ] }, { "name": "kappa-casein O-glycosylated 13 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-133 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G05848DX. Example: UniProtKB:P07498-1, Thr-133, MOD:00005~GNO:G05848DX. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053766", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053766" } ] }, { "name": "kappa-casein O-glycosylated 14 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-133 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G29231AT. Example: UniProtKB:P07498-1, Thr-133, MOD:00005~GNO:G29231AT. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053767", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053767" } ] }, { "name": "kappa-casein O-glycosylated 15 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-133 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G30871VQ. Example: UniProtKB:P07498-1, Thr-133, MOD:00005~GNO:G30871VQ. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053768", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053768" } ] }, { "name": "kappa-casein O-glycosylated 16 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-133 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G37653KL. Example: UniProtKB:P07498-1, Thr-133, MOD:00005~GNO:G37653KL. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053769", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053769" } ] }, { "name": "kappa-casein O-glycosylated 17 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-133 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G41424HD. Example: UniProtKB:P07498-1, Thr-133, MOD:00005~GNO:G41424HD. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053770", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053770" } ] }, { "name": "kappa-casein O-glycosylated 18 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-133 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G64973KT. Example: UniProtKB:P07498-1, Thr-133, MOD:00005~GNO:G64973KT. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053771", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053771" } ] }, { "name": "kappa-casein O-glycosylated 19 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-133 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G69500TM. Example: UniProtKB:P07498-1, Thr-133, MOD:00005~GNO:G69500TM. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053772", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053772" } ] }, { "name": "kappa-casein O-glycosylated 20 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-133 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G70125XL. Example: UniProtKB:P07498-1, Thr-133, MOD:00005~GNO:G70125XL. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053773", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053773" } ] }, { "name": "kappa-casein O-glycosylated 21 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-133 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G86186US. Example: UniProtKB:P07498-1, Thr-133, MOD:00005~GNO:G86186US. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053774", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053774" } ] }, { "name": "kappa-casein O-glycosylated 22 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-133 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G91875JA. Example: UniProtKB:P07498-1, Thr-133, MOD:00005~GNO:G91875JA. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053775", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053775" } ] }, { "name": "kappa-casein O-glycosylated 23 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-143 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P07498-1, Thr-143, MOD:00005~GNO:G00031MO. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053776", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053776" } ] }, { "name": "kappa-casein O-glycosylated 24 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-143 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G05848DX. Example: UniProtKB:P07498-1, Thr-143, MOD:00005~GNO:G05848DX. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053777", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053777" } ] }, { "name": "kappa-casein O-glycosylated 25 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-143 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G29231AT. Example: UniProtKB:P07498-1, Thr-143, MOD:00005~GNO:G29231AT. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053778", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053778" } ] }, { "name": "kappa-casein O-glycosylated 26 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-143 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G30871VQ. Example: UniProtKB:P07498-1, Thr-143, MOD:00005~GNO:G30871VQ. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053779", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053779" } ] }, { "name": "kappa-casein O-glycosylated 27 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-143 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G37653KL. Example: UniProtKB:P07498-1, Thr-143, MOD:00005~GNO:G37653KL. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053780", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053780" } ] }, { "name": "kappa-casein O-glycosylated 28 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-143 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G41424HD. Example: UniProtKB:P07498-1, Thr-143, MOD:00005~GNO:G41424HD. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053781", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053781" } ] }, { "name": "kappa-casein O-glycosylated 29 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-143 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G64973KT. Example: UniProtKB:P07498-1, Thr-143, MOD:00005~GNO:G64973KT. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053782", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053782" } ] }, { "name": "kappa-casein O-glycosylated 30 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-143 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G69500TM. Example: UniProtKB:P07498-1, Thr-143, MOD:00005~GNO:G69500TM. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053783", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053783" } ] }, { "name": "kappa-casein O-glycosylated 31 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-143 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G70125XL. Example: UniProtKB:P07498-1, Thr-143, MOD:00005~GNO:G70125XL. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053784", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053784" } ] }, { "name": "kappa-casein O-glycosylated 32 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-143 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G86186US. Example: UniProtKB:P07498-1, Thr-143, MOD:00005~GNO:G86186US. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053785", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053785" } ] }, { "name": "kappa-casein O-glycosylated 33 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-143 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G91875JA. Example: UniProtKB:P07498-1, Thr-143, MOD:00005~GNO:G91875JA. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053786", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053786" } ] }, { "name": "kappa-casein O-glycosylated 34 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-148 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P07498-1, Thr-148, MOD:00005~GNO:G00031MO. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053787", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053787" } ] }, { "name": "kappa-casein O-glycosylated 35 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-148 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G05848DX. Example: UniProtKB:P07498-1, Thr-148, MOD:00005~GNO:G05848DX. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053788", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053788" } ] }, { "name": "kappa-casein O-glycosylated 36 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-148 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G29231AT. Example: UniProtKB:P07498-1, Thr-148, MOD:00005~GNO:G29231AT. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053789", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053789" } ] }, { "name": "kappa-casein O-glycosylated 37 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-148 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G30871VQ. Example: UniProtKB:P07498-1, Thr-148, MOD:00005~GNO:G30871VQ. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053790", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053790" } ] }, { "name": "kappa-casein O-glycosylated 38 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-148 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G37653KL. Example: UniProtKB:P07498-1, Thr-148, MOD:00005~GNO:G37653KL. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053791", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053791" } ] }, { "name": "kappa-casein O-glycosylated 39 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-148 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G41424HD. Example: UniProtKB:P07498-1, Thr-148, MOD:00005~GNO:G41424HD. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053792", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053792" } ] }, { "name": "kappa-casein O-glycosylated 40 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-148 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G64973KT. Example: UniProtKB:P07498-1, Thr-148, MOD:00005~GNO:G64973KT. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053793", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053793" } ] }, { "name": "kappa-casein O-glycosylated 41 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-148 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G69500TM. Example: UniProtKB:P07498-1, Thr-148, MOD:00005~GNO:G69500TM. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053794", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053794" } ] }, { "name": "kappa-casein O-glycosylated 42 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-148 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G70125XL. Example: UniProtKB:P07498-1, Thr-148, MOD:00005~GNO:G70125XL. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053795", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053795" } ] }, { "name": "kappa-casein O-glycosylated 43 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-148 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G86186US. Example: UniProtKB:P07498-1, Thr-148, MOD:00005~GNO:G86186US. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053796", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053796" } ] }, { "name": "kappa-casein O-glycosylated 44 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-148 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G91875JA. Example: UniProtKB:P07498-1, Thr-148, MOD:00005~GNO:G91875JA. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053797", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053797" } ] }, { "name": "kappa-casein O-glycosylated 45 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-151 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P07498-1, Thr-151, MOD:00005~GNO:G00031MO. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053798", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053798" } ] }, { "name": "kappa-casein O-glycosylated 46 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-151 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G05848DX. Example: UniProtKB:P07498-1, Thr-151, MOD:00005~GNO:G05848DX. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053799", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053799" } ] }, { "name": "kappa-casein O-glycosylated 47 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-151 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G29231AT. Example: UniProtKB:P07498-1, Thr-151, MOD:00005~GNO:G29231AT. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053800", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053800" } ] }, { "name": "kappa-casein O-glycosylated 48 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-151 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G30871VQ. Example: UniProtKB:P07498-1, Thr-151, MOD:00005~GNO:G30871VQ. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053801", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053801" } ] }, { "name": "kappa-casein O-glycosylated 49 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-151 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G37653KL. Example: UniProtKB:P07498-1, Thr-151, MOD:00005~GNO:G37653KL. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053802", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053802" } ] }, { "name": "kappa-casein O-glycosylated 50 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-151 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G41424HD. Example: UniProtKB:P07498-1, Thr-151, MOD:00005~GNO:G41424HD. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053803", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053803" } ] }, { "name": "kappa-casein O-glycosylated 51 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-151 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G64973KT. Example: UniProtKB:P07498-1, Thr-151, MOD:00005~GNO:G64973KT. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053804", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053804" } ] }, { "name": "kappa-casein O-glycosylated 52 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-151 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G69500TM. Example: UniProtKB:P07498-1, Thr-151, MOD:00005~GNO:G69500TM. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053805", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053805" } ] }, { "name": "kappa-casein O-glycosylated 53 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-151 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G70125XL. Example: UniProtKB:P07498-1, Thr-151, MOD:00005~GNO:G70125XL. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053806", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053806" } ] }, { "name": "kappa-casein O-glycosylated 54 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-151 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G86186US. Example: UniProtKB:P07498-1, Thr-151, MOD:00005~GNO:G86186US. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053807", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053807" } ] }, { "name": "kappa-casein O-glycosylated 55 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-151 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G91875JA. Example: UniProtKB:P07498-1, Thr-151, MOD:00005~GNO:G91875JA. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053808", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053808" } ] }, { "name": "kappa-casein O-glycosylated 56 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-157 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P07498-1, Thr-157, MOD:00005~GNO:G00031MO. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053809", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053809" } ] }, { "name": "kappa-casein O-glycosylated 57 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-157 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G05848DX. Example: UniProtKB:P07498-1, Thr-157, MOD:00005~GNO:G05848DX. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053810", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053810" } ] }, { "name": "kappa-casein O-glycosylated 58 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-157 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G29231AT. Example: UniProtKB:P07498-1, Thr-157, MOD:00005~GNO:G29231AT. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053811", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053811" } ] }, { "name": "kappa-casein O-glycosylated 59 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-157 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G30871VQ. Example: UniProtKB:P07498-1, Thr-157, MOD:00005~GNO:G30871VQ. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053812", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053812" } ] }, { "name": "kappa-casein O-glycosylated 60 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-157 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G37653KL. Example: UniProtKB:P07498-1, Thr-157, MOD:00005~GNO:G37653KL. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053813", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053813" } ] }, { "name": "kappa-casein O-glycosylated 61 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-157 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G41424HD. Example: UniProtKB:P07498-1, Thr-157, MOD:00005~GNO:G41424HD. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053814", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053814" } ] }, { "name": "kappa-casein O-glycosylated 62 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-157 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G64973KT. Example: UniProtKB:P07498-1, Thr-157, MOD:00005~GNO:G64973KT. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053815", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053815" } ] }, { "name": "kappa-casein O-glycosylated 63 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-157 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G69500TM. Example: UniProtKB:P07498-1, Thr-157, MOD:00005~GNO:G69500TM. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053816", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053816" } ] }, { "name": "kappa-casein O-glycosylated 64 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-157 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G70125XL. Example: UniProtKB:P07498-1, Thr-157, MOD:00005~GNO:G70125XL. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053817", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053817" } ] }, { "name": "kappa-casein O-glycosylated 65 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-157 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G86186US. Example: UniProtKB:P07498-1, Thr-157, MOD:00005~GNO:G86186US. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053818", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053818" } ] }, { "name": "kappa-casein O-glycosylated 66 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-157 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G91875JA. Example: UniProtKB:P07498-1, Thr-157, MOD:00005~GNO:G91875JA. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053819", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053819" } ] }, { "name": "kappa-casein O-glycosylated 67 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-167 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P07498-1, Thr-167, MOD:00005~GNO:G00031MO. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053820", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053820" } ] }, { "name": "kappa-casein O-glycosylated 68 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-167 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G05848DX. Example: UniProtKB:P07498-1, Thr-167, MOD:00005~GNO:G05848DX. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053821", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053821" } ] }, { "name": "kappa-casein O-glycosylated 69 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-167 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G29231AT. Example: UniProtKB:P07498-1, Thr-167, MOD:00005~GNO:G29231AT. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053822", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053822" } ] }, { "name": "kappa-casein O-glycosylated 70 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-167 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G30871VQ. Example: UniProtKB:P07498-1, Thr-167, MOD:00005~GNO:G30871VQ. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053823", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053823" } ] }, { "name": "kappa-casein O-glycosylated 71 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-167 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G37653KL. Example: UniProtKB:P07498-1, Thr-167, MOD:00005~GNO:G37653KL. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053824", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053824" } ] }, { "name": "kappa-casein O-glycosylated 72 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-167 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G41424HD. Example: UniProtKB:P07498-1, Thr-167, MOD:00005~GNO:G41424HD. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053825", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053825" } ] }, { "name": "kappa-casein O-glycosylated 73 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-167 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G64973KT. Example: UniProtKB:P07498-1, Thr-167, MOD:00005~GNO:G64973KT. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053826", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053826" } ] }, { "name": "kappa-casein O-glycosylated 74 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-167 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G69500TM. Example: UniProtKB:P07498-1, Thr-167, MOD:00005~GNO:G69500TM. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053827", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053827" } ] }, { "name": "kappa-casein O-glycosylated 75 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-167 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G70125XL. Example: UniProtKB:P07498-1, Thr-167, MOD:00005~GNO:G70125XL. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053828", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053828" } ] }, { "name": "kappa-casein O-glycosylated 76 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-167 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G86186US. Example: UniProtKB:P07498-1, Thr-167, MOD:00005~GNO:G86186US. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053829", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053829" } ] }, { "name": "kappa-casein O-glycosylated 77 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-167 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G91875JA. Example: UniProtKB:P07498-1, Thr-167, MOD:00005~GNO:G91875JA. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053830", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053830" } ] }, { "name": "kappa-casein O-glycosylated 78 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-169 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P07498-1, Thr-169, MOD:00005~GNO:G00031MO. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053831", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053831" } ] }, { "name": "kappa-casein O-glycosylated 79 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-169 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G05848DX. Example: UniProtKB:P07498-1, Thr-169, MOD:00005~GNO:G05848DX. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053832", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053832" } ] }, { "name": "kappa-casein O-glycosylated 80 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-169 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G29231AT. Example: UniProtKB:P07498-1, Thr-169, MOD:00005~GNO:G29231AT. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053833", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053833" } ] }, { "name": "kappa-casein O-glycosylated 81 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-169 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G30871VQ. Example: UniProtKB:P07498-1, Thr-169, MOD:00005~GNO:G30871VQ. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053834", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053834" } ] }, { "name": "kappa-casein O-glycosylated 82 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-169 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G37653KL. Example: UniProtKB:P07498-1, Thr-169, MOD:00005~GNO:G37653KL. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053835", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053835" } ] }, { "name": "kappa-casein O-glycosylated 83 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-169 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G41424HD. Example: UniProtKB:P07498-1, Thr-169, MOD:00005~GNO:G41424HD. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053836", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053836" } ] }, { "name": "kappa-casein O-glycosylated 84 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-169 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G64973KT. Example: UniProtKB:P07498-1, Thr-169, MOD:00005~GNO:G64973KT. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053837", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053837" } ] }, { "name": "kappa-casein O-glycosylated 85 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-169 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G69500TM. Example: UniProtKB:P07498-1, Thr-169, MOD:00005~GNO:G69500TM. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053838", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053838" } ] }, { "name": "kappa-casein O-glycosylated 86 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-169 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G70125XL. Example: UniProtKB:P07498-1, Thr-169, MOD:00005~GNO:G70125XL. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053839", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053839" } ] }, { "name": "kappa-casein O-glycosylated 87 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-169 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G86186US. Example: UniProtKB:P07498-1, Thr-169, MOD:00005~GNO:G86186US. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053840", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053840" } ] }, { "name": "kappa-casein O-glycosylated 88 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-169 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G91875JA. Example: UniProtKB:P07498-1, Thr-169, MOD:00005~GNO:G91875JA. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053841", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053841" } ] }, { "name": "kappa-casein O-glycosylated 89 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-178 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P07498-1, Thr-178, MOD:00005~GNO:G00031MO. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053842", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053842" } ] }, { "name": "kappa-casein O-glycosylated 90 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-178 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G05848DX. Example: UniProtKB:P07498-1, Thr-178, MOD:00005~GNO:G05848DX. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053843", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053843" } ] }, { "name": "kappa-casein O-glycosylated 91 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-178 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G29231AT. Example: UniProtKB:P07498-1, Thr-178, MOD:00005~GNO:G29231AT. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053844", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053844" } ] }, { "name": "kappa-casein O-glycosylated 92 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-178 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G30871VQ. Example: UniProtKB:P07498-1, Thr-178, MOD:00005~GNO:G30871VQ. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053845", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053845" } ] }, { "name": "kappa-casein O-glycosylated 93 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-178 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G37653KL. Example: UniProtKB:P07498-1, Thr-178, MOD:00005~GNO:G37653KL. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053846", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053846" } ] }, { "name": "kappa-casein O-glycosylated 94 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-178 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G41424HD. Example: UniProtKB:P07498-1, Thr-178, MOD:00005~GNO:G41424HD. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053847", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053847" } ] }, { "name": "kappa-casein O-glycosylated 95 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-178 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G64973KT. Example: UniProtKB:P07498-1, Thr-178, MOD:00005~GNO:G64973KT. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053848", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053848" } ] }, { "name": "kappa-casein O-glycosylated 96 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-178 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G69500TM. Example: UniProtKB:P07498-1, Thr-178, MOD:00005~GNO:G69500TM. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053849", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053849" } ] }, { "name": "kappa-casein O-glycosylated 97 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-178 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G70125XL. Example: UniProtKB:P07498-1, Thr-178, MOD:00005~GNO:G70125XL. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053850", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053850" } ] }, { "name": "kappa-casein O-glycosylated 98 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-178 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G86186US. Example: UniProtKB:P07498-1, Thr-178, MOD:00005~GNO:G86186US. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053851", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053851" } ] }, { "name": "kappa-casein O-glycosylated 99 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-178 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G91875JA. Example: UniProtKB:P07498-1, Thr-178, MOD:00005~GNO:G91875JA. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053852", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053852" } ] }, { "name": "kappa-casein O-glycosylated 100 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-181 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P07498-1, Thr-181, MOD:00005~GNO:G00031MO. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053853", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053853" } ] }, { "name": "kappa-casein O-glycosylated 101 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-181 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G05848DX. Example: UniProtKB:P07498-1, Thr-181, MOD:00005~GNO:G05848DX. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053854", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053854" } ] }, { "name": "kappa-casein O-glycosylated 102 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-181 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G29231AT. Example: UniProtKB:P07498-1, Thr-181, MOD:00005~GNO:G29231AT. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053855", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053855" } ] }, { "name": "kappa-casein O-glycosylated 103 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-181 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G30871VQ. Example: UniProtKB:P07498-1, Thr-181, MOD:00005~GNO:G30871VQ. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053856", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053856" } ] }, { "name": "kappa-casein O-glycosylated 104 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-181 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G37653KL. Example: UniProtKB:P07498-1, Thr-181, MOD:00005~GNO:G37653KL. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053857", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053857" } ] }, { "name": "kappa-casein O-glycosylated 105 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-181 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G41424HD. Example: UniProtKB:P07498-1, Thr-181, MOD:00005~GNO:G41424HD. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053858", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053858" } ] }, { "name": "kappa-casein O-glycosylated 106 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-181 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G64973KT. Example: UniProtKB:P07498-1, Thr-181, MOD:00005~GNO:G64973KT. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053859", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053859" } ] }, { "name": "kappa-casein O-glycosylated 107 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-181 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G69500TM. Example: UniProtKB:P07498-1, Thr-181, MOD:00005~GNO:G69500TM. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053860", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053860" } ] }, { "name": "kappa-casein O-glycosylated 108 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-181 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G70125XL. Example: UniProtKB:P07498-1, Thr-181, MOD:00005~GNO:G70125XL. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053861", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053861" } ] }, { "name": "kappa-casein O-glycosylated 109 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-181 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G86186US. Example: UniProtKB:P07498-1, Thr-181, MOD:00005~GNO:G86186US. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053862", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053862" } ] }, { "name": "kappa-casein O-glycosylated 110 (human)", "definition": "A kappa-casein (human) that has been O-glycosylated at the residue equivalent to Thr-181 of the amino acid sequence represented by UniProtKB:P07498-1, in which the glycan structure is represented by GlyTouCan:G91875JA. Example: UniProtKB:P07498-1, Thr-181, MOD:00005~GNO:G91875JA. [PRO:DNx, PMID:3342257]", "evidence": [ { "id": "PR:000053863", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053863" } ] } ], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 133, 143, 148, 151, 157, 162, 167, 169, 178, 181 ], "snv_sites": [ 55, 74, 134, 137, 143, 151, 157, 162, 167, 178, 181 ], "glycation_sites": [], "phosphorylation_sites": [ 157 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 132 }, { "field": "total_sites", "count": 11 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 14 }, { "field": "o_linked_glycan_sites", "count": 19 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 8 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 124 }, { "field": "total_sites", "count": 11 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 14 }, { "field": "o_linked_glycan_sites", "count": 11 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 16 }, { "field": "total_sites", "count": 11 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 13 }, { "field": "total_sites", "count": 10 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 37 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }