{ "uniprot_canonical_ac": "P07355-1", "uniprot_ac": "P07355", "uniprot_id": "ANXA2_HUMAN", "mass": { "chemical_mass": 38604.0, "monoisotopic_mass": 38604.0 }, "refseq": { "ac": "NP_001002857", "name": "annexin A2 isoform 2", "summary": "This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. This gene has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. Annexin A2 expression has been found to correlate with resistance to treatment against various cancer forms. [provided by RefSeq, Dec 2019].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002857" }, "gene_names": [ { "name": "ANXA2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P07355", "id": "P07355" }, { "name": "ANX2; ANX2L4; CAL1H; HEL-S-270; LIP2; LPC2; LPC2D; P36; PAP-IV", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002857", "id": "NP_001002857" }, { "name": "ANX2L4", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P07355", "id": "P07355" }, { "name": "ANX2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P07355", "id": "P07355" }, { "name": "ANXA2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002857", "id": "NP_001002857" }, { "name": "CAL1H", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P07355", "id": "P07355" }, { "name": "LPC2D", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P07355", "id": "P07355" } ], "protein_names": [ { "name": "Annexin A2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P07355" }, { "name": "Annexin II", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07355" }, { "name": "Annexin-2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07355" }, { "name": "Calpactin I heavy chain", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07355" }, { "name": "Calpactin-1 heavy chain", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07355" }, { "name": "Chromobindin-8", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07355" }, { "name": "Lipocortin II", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07355" }, { "name": "PAP-IV", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07355" }, { "name": "Placental anticoagulant protein IV", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07355" }, { "name": "Protein I", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07355" }, { "name": "annexin A2 isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002857", "id": "NP_001002857" }, { "name": "lipocortin II; placental anticoagulant protein IV; chromobindin 8; annexin II; calpactin I heavy polypeptide; annexin-2; calpactin I heavy chain; calpactin-1 heavy chain; epididymis secretory protein Li 270; epididymis secretory sperm binding protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002857", "id": "NP_001002857" }, { "name": "p36", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07355" } ], "function": [ { "annotation": "(Microbial infection) Binds M.pneumoniae CARDS toxin, probably serves as one receptor for this pathogen. When ANXA2 is down-regulated by siRNA, less toxin binds to human cells and less vacuolization (a symptom of M.pneumoniae infection) is seen.", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355#function" }, { "database": "PubMed", "id": "25139904", "url": "https://glygen.org/publication/PubMed/25139904" } ] }, { "annotation": "Annexin A2 Stabilizes Oncogenic JAG1 Intracellular Domain by Inhibiting Proteasomal Degradation in Glioblastoma Cells. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001002857", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002857" }, { "database": "PubMed", "id": "37834227", "url": "https://glygen.org/publication/PubMed/37834227" } ] }, { "annotation": "Association of pro-fibrinolytic receptor AnnexinA2 with tissue plasminogen activator/Inhibitor-1 in pre-eclampsia.", "evidence": [ { "database": "RefSeq", "id": "NP_001002857", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002857" }, { "database": "PubMed", "id": "37545924", "url": "https://glygen.org/publication/PubMed/37545924" } ] }, { "annotation": "Calcium-regulated membrane-binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity. May be involved in heat-stress response. Inhibits PCSK9-enhanced LDLR degradation, probably reduces PCSK9 protein levels via a translational mechanism but also competes with LDLR for binding with PCSK9 (PubMed:18799458, PubMed:24808179, PubMed:22848640).", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355#function" }, { "database": "PubMed", "id": "22848640", "url": "https://glygen.org/publication/PubMed/22848640" }, { "database": "PubMed", "id": "18799458", "url": "https://glygen.org/publication/PubMed/18799458" }, { "database": "PubMed", "id": "24808179", "url": "https://glygen.org/publication/PubMed/24808179" } ] }, { "annotation": "Long non-coding RNA LINC00460 contributes as a potential prognostic biomarker through its oncogenic role with ANXA2 in colorectal polyps.", "evidence": [ { "database": "RefSeq", "id": "NP_001002857", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002857" }, { "database": "PubMed", "id": "37024747", "url": "https://glygen.org/publication/PubMed/37024747" } ] }, { "annotation": "METTL3-mediated ANXA2 inhibition confers neuroprotection in ischemic stroke: Evidence from in vivo and in vitro studies.", "evidence": [ { "database": "RefSeq", "id": "NP_001002857", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002857" }, { "database": "PubMed", "id": "37249328", "url": "https://glygen.org/publication/PubMed/37249328" } ] }, { "annotation": "This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. This gene has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. Annexin A2 expression has been found to correlate with resistance to treatment against various cancer forms. [provided by RefSeq, Dec 2019].", "evidence": [ { "database": "RefSeq", "id": "NP_001002857", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002857" } ] }, { "annotation": "Tissue plasminogen activator receptor ANXA2 and its complementary regulator anti-inflammatory ANXA1 as prognostic indicators of inflammatory response in COVID-19 pathogenesis.", "evidence": [ { "database": "RefSeq", "id": "NP_001002857", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002857" }, { "database": "PubMed", "id": "37579635", "url": "https://glygen.org/publication/PubMed/37579635" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs775231291", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775231291" }, { "id": "rs775231291", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775231291" }, { "id": "rs775231291", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs775231291#frequency_tab" }, { "id": "rs775231291", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775231291" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 153, "end_pos": 153, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->N).", "chr_id": "15", "chr_pos": "60352412", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T153", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 24, "end_pos": 24, "sequence_org": "Y", "sequence_mut": "A", "comment": "Abolishes heat stress-induced cell surface localization.", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" }, { "database": "PubMed", "id": "15302870", "url": "https://glygen.org/publication/PubMed/15302870" } ] }, { "start_pos": 26, "end_pos": 26, "sequence_org": "S", "sequence_mut": "E", "comment": "Stronger interaction with S100A4.", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" }, { "database": "PubMed", "id": "28669632", "url": "https://glygen.org/publication/PubMed/28669632" } ] }, { "start_pos": 28, "end_pos": 36, "sequence_org": "KAYTNFDAE", "sequence_mut": "SAYTNFNAS", "comment": "No effect on interaction with PCSK9.", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" }, { "database": "PubMed", "id": "22848640", "url": "https://glygen.org/publication/PubMed/22848640" } ] }, { "start_pos": 37, "end_pos": 47, "sequence_org": "RDALNIETAIK", "sequence_mut": "SDALNIHTAIM", "comment": "Slightly decreases interaction with PCSK9.", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" }, { "database": "PubMed", "id": "22848640", "url": "https://glygen.org/publication/PubMed/22848640" } ] }, { "start_pos": 77, "end_pos": 80, "sequence_org": "RRTK", "sequence_mut": "AATA", "comment": "Decreases interaction with PCSK9. Strongly decreases interaction with PCSK9; when associated with K-88.", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" }, { "database": "PubMed", "id": "18799458", "url": "https://glygen.org/publication/PubMed/18799458" } ] }, { "start_pos": 77, "end_pos": 81, "sequence_org": "RRTKK", "sequence_mut": "AATAA", "comment": "Strongly decreases interaction with PCSK9.", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" }, { "database": "PubMed", "id": "22848640", "url": "https://glygen.org/publication/PubMed/22848640" }, { "database": "PubMed", "id": "18799458", "url": "https://glygen.org/publication/PubMed/18799458" } ] }, { "start_pos": 80, "end_pos": 84, "sequence_org": "KKELA", "sequence_mut": "GKPLD", "comment": "No effect on interaction with PCSK9.", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" }, { "database": "PubMed", "id": "18799458", "url": "https://glygen.org/publication/PubMed/18799458" } ] }, { "start_pos": 88, "end_pos": 88, "sequence_org": "K", "sequence_mut": "A", "comment": "Strongly decreases interaction with PCSK9; when associated with 77-A--A-80.", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" }, { "database": "PubMed", "id": "18799458", "url": "https://glygen.org/publication/PubMed/18799458" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "98.66", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000182718", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182718" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "99.84", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000182718", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182718" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "99.35", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000182718", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182718" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "99.13", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000182718", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182718" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.61", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000182718", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182718" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "99.68", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000182718", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182718" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "99.76", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000182718", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182718" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "99.55", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000182718", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182718" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "99.47", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000182718", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182718" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "99.88", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000182718", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182718" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "97.35", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000182718", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182718" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "99.51", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000182718", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182718" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "99.62", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000182718", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182718" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P07355", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07355" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P07355", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07355" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P07355", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07355" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P07355", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07355" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P07355", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07355" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P07355", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07355" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P07355", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07355" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P07355", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07355" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P07355", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07355" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P07355", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07355" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P07355", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07355" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P07355", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07355" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "common_name": "Human" } ], "gene": [ { "name": "ANXA2", "url": "https://www.uniprot.org/uniprot/P07355", "locus": { "chromosome": "15", "start_pos": 60347134, "end_pos": 60402883, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000182718", "url": "https://www.ensembl.org/id/ENSG00000182718" } ] } } ], "crossref": [ { "id": "ENSG00000182718", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182718", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "CHEMBL1764938", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1764938", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "ANXA2", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ANXA2", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "302", "url": "https://www.ncbi.nlm.nih.gov/gene/302", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "537", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=537", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P07355", "url": "https://www.ebi.ac.uk/intact/interactors/id:P07355*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001464", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001464", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002389", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002389", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018252", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018252", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018502", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018502", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037104", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037104", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:302", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:302", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "151740", "url": "http://www.omim.org/entry/151740", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P07355", "url": "https://www.nextprot.org/entry/NX_P07355", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P07355", "url": "https://oglcnac.org/atlas/detail/P07355", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P07355", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07355", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "DLMRIRT", "url": "https://omabrowser.org/oma/group/DLMRIRT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1500773at2759", "url": "http://www.orthodb.org/?query=1500773at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10502", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10502", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10502:SF18", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10502:SF18", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1W7B", "url": "https://www.rcsb.org/structure/1W7B", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1XJL", "url": "https://www.rcsb.org/structure/1XJL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2HYU", "url": "https://www.rcsb.org/structure/2HYU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2HYV", "url": "https://www.rcsb.org/structure/2HYV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2HYW", "url": "https://www.rcsb.org/structure/2HYW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4DRW", "url": "https://www.rcsb.org/structure/4DRW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4FTG", "url": "https://www.rcsb.org/structure/4FTG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4HRH", "url": "https://www.rcsb.org/structure/4HRH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LPU", "url": "https://www.rcsb.org/structure/5LPU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LPX", "url": "https://www.rcsb.org/structure/5LPX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LQ0", "url": "https://www.rcsb.org/structure/5LQ0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LQ2", "url": "https://www.rcsb.org/structure/5LQ2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5N7D", "url": "https://www.rcsb.org/structure/5N7D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5N7F", "url": "https://www.rcsb.org/structure/5N7F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5N7G", "url": "https://www.rcsb.org/structure/5N7G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6TWQ", "url": "https://www.rcsb.org/structure/6TWQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6TWU", "url": "https://www.rcsb.org/structure/6TWU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6TWX", "url": "https://www.rcsb.org/structure/6TWX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6TWY", "url": "https://www.rcsb.org/structure/6TWY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7DTO", "url": "https://www.rcsb.org/structure/7DTO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7EQ7", "url": "https://www.rcsb.org/structure/7EQ7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7NMI", "url": "https://www.rcsb.org/structure/7NMI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7P70", "url": "https://www.rcsb.org/structure/7P70", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7P71", "url": "https://www.rcsb.org/structure/7P71", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7P72", "url": "https://www.rcsb.org/structure/7P72", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7P73", "url": "https://www.rcsb.org/structure/7P73", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7P74", "url": "https://www.rcsb.org/structure/7P74", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PC3", "url": "https://www.rcsb.org/structure/7PC3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PC4", "url": "https://www.rcsb.org/structure/7PC4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PC5", "url": "https://www.rcsb.org/structure/7PC5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PC7", "url": "https://www.rcsb.org/structure/7PC7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PC8", "url": "https://www.rcsb.org/structure/7PC8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PC9", "url": "https://www.rcsb.org/structure/7PC9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PCB", "url": "https://www.rcsb.org/structure/7PCB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7QQL", "url": "https://www.rcsb.org/structure/7QQL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7QQM", "url": "https://www.rcsb.org/structure/7QQM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7QQN", "url": "https://www.rcsb.org/structure/7QQN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7ZVN", "url": "https://www.rcsb.org/structure/7ZVN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7ZVX", "url": "https://www.rcsb.org/structure/7ZVX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8AEL", "url": "https://www.rcsb.org/structure/8AEL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00191", "url": "http://pfam.xfam.org/family/PF00191", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P07355", "url": "https://pharos.nih.gov/targets/P07355", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P07355", "url": "http://purl.obolibrary.org/obo/PR_P07355", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8950505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8950505", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001002857", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002857", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A7I2V4P4", "url": "https://www.uniprot.org/uniprot/A0A7I2V4P4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V4P4-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V4P4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YKL9", "url": "https://www.uniprot.org/uniprot/H0YKL9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YKL9-1", "url": "https://www.uniprot.org/uniprot/H0YKL9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YKN4", "url": "https://www.uniprot.org/uniprot/H0YKN4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YKN4-1", "url": "https://www.uniprot.org/uniprot/H0YKN4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YKS4", "url": "https://www.uniprot.org/uniprot/H0YKS4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YKS4-1", "url": "https://www.uniprot.org/uniprot/H0YKS4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YKV8", "url": "https://www.uniprot.org/uniprot/H0YKV8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YKV8-1", "url": "https://www.uniprot.org/uniprot/H0YKV8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YKX9", "url": "https://www.uniprot.org/uniprot/H0YKX9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YKX9-1", "url": "https://www.uniprot.org/uniprot/H0YKX9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YKZ7", "url": "https://www.uniprot.org/uniprot/H0YKZ7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YKZ7-1", "url": "https://www.uniprot.org/uniprot/H0YKZ7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YL33", "url": "https://www.uniprot.org/uniprot/H0YL33", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YL33-1", "url": "https://www.uniprot.org/uniprot/H0YL33-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YLE2", "url": "https://www.uniprot.org/uniprot/H0YLE2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YLE2-1", "url": "https://www.uniprot.org/uniprot/H0YLE2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YLV6", "url": "https://www.uniprot.org/uniprot/H0YLV6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YLV6-1", "url": "https://www.uniprot.org/uniprot/H0YLV6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YM50", "url": "https://www.uniprot.org/uniprot/H0YM50", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YM50-1", "url": "https://www.uniprot.org/uniprot/H0YM50-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YMD0", "url": "https://www.uniprot.org/uniprot/H0YMD0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YMD0-1", "url": "https://www.uniprot.org/uniprot/H0YMD0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YMD9", "url": "https://www.uniprot.org/uniprot/H0YMD9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YMD9-1", "url": "https://www.uniprot.org/uniprot/H0YMD9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YMM1", "url": "https://www.uniprot.org/uniprot/H0YMM1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YMM1-1", "url": "https://www.uniprot.org/uniprot/H0YMM1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YMT9", "url": "https://www.uniprot.org/uniprot/H0YMT9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YMT9-1", "url": "https://www.uniprot.org/uniprot/H0YMT9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YMU9", "url": "https://www.uniprot.org/uniprot/H0YMU9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YMU9-1", "url": "https://www.uniprot.org/uniprot/H0YMU9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YMW4", "url": "https://www.uniprot.org/uniprot/H0YMW4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YMW4-1", "url": "https://www.uniprot.org/uniprot/H0YMW4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YN28", "url": "https://www.uniprot.org/uniprot/H0YN28", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YN28-1", "url": "https://www.uniprot.org/uniprot/H0YN28-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YN42", "url": "https://www.uniprot.org/uniprot/H0YN42", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YN42-1", "url": "https://www.uniprot.org/uniprot/H0YN42-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YNA0", "url": "https://www.uniprot.org/uniprot/H0YNA0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YNA0-1", "url": "https://www.uniprot.org/uniprot/H0YNA0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YNB8", "url": "https://www.uniprot.org/uniprot/H0YNB8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YNB8-1", "url": "https://www.uniprot.org/uniprot/H0YNB8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YNP5", "url": "https://www.uniprot.org/uniprot/H0YNP5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YNP5-1", "url": "https://www.uniprot.org/uniprot/H0YNP5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07355-1", "url": "https://www.uniprot.org/uniprot/P07355-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07355-2", "url": "https://www.uniprot.org/uniprot/P07355-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD", "length": 339, "header": "sp|P07355-1|ANXA2_HUMAN Isoform 1 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2 CANONICAL=P07355-1" }, "isoforms": [ { "isoform_ac": "A0A7I2V4P4-1", "url": "", "sequence": { "sequence": "MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKESEYVQD", "length": 155, "header": "tr|A0A7I2V4P4-1|ANXA2_HUMAN Computationally mapped isoform of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=1 CANONICAL=P07355-1" }, "locus": { "chromosome": "15", "start_pos": 60386075, "end_pos": 60355989, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676687.1", "url": "https://www.ensembl.org/id/ENST00000676687.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503850.1", "url": "https://www.ensembl.org/id/ENSP00000503850.1" } ] } }, { "isoform_ac": "H0YKL9-1", "url": "", "sequence": { "sequence": "MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYD", "length": 110, "header": "tr|H0YKL9-1|H0YKL9_HUMAN Computationally mapped isoform of Annexin OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=1 CANONICAL=P07355-1" }, "locus": { "chromosome": "15", "start_pos": 60386075, "end_pos": 60347633, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000560468", "url": "https://www.ensembl.org/id/ENST00000560468" }, { "database": "Ensembl Peptide", "id": "ENSP00000452858", "url": "https://www.ensembl.org/id/ENSP00000452858" } ] } }, { "isoform_ac": "H0YKN4-1", "url": "", "sequence": { "sequence": "MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGARPEPRSYQTLEKESLVPF", "length": 69, "header": "tr|H0YKN4-1|H0YKN4_HUMAN Computationally mapped isoform of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=4 SV=1 CANONICAL=P07355-1" }, "locus": { "chromosome": "15", "start_pos": 60386075, "end_pos": 60374624, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000561022.5", "url": "https://www.ensembl.org/id/ENST00000561022.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000452876.1", "url": "https://www.ensembl.org/id/ENSP00000452876.1" } ] } }, { "isoform_ac": "H0YKS4-1", "url": "", "sequence": { "sequence": "MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAK", "length": 176, "header": "tr|H0YKS4-1|H0YKS4_HUMAN Computationally mapped isoform of Annexin OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=1 CANONICAL=P07355-1" }, "locus": { "chromosome": "15", "start_pos": 60386075, "end_pos": 60347633, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000557906", "url": "https://www.ensembl.org/id/ENST00000557906" }, { "database": "Ensembl Peptide", "id": "ENSP00000452895", "url": "https://www.ensembl.org/id/ENSP00000452895" } ] } }, { "isoform_ac": "H0YKV8-1", "url": "", "sequence": { "sequence": "MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKK", "length": 81, "header": "tr|H0YKV8-1|H0YKV8_HUMAN Computationally mapped isoform of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=1 CANONICAL=P07355-1" }, "locus": { "chromosome": "15", "start_pos": 60386075, "end_pos": 60364429, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000557904.5", "url": "https://www.ensembl.org/id/ENST00000557904.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000452958.1", "url": "https://www.ensembl.org/id/ENSP00000452958.1" } ] } }, { "isoform_ac": "H0YKX9-1", "url": "", "sequence": { "sequence": "MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICS", "length": 134, "header": "tr|H0YKX9-1|H0YKX9_HUMAN Computationally mapped isoform of Annexin OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=1 CANONICAL=P07355-1" }, "locus": { "chromosome": "15", "start_pos": 60386075, "end_pos": 60347633, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000558558", "url": "https://www.ensembl.org/id/ENST00000558558" }, { "database": "Ensembl Peptide", "id": "ENSP00000452981", "url": "https://www.ensembl.org/id/ENSP00000452981" } ] } }, { "isoform_ac": "H0YKZ7-1", "url": "", "sequence": { "sequence": "MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMK", "length": 119, "header": "tr|H0YKZ7-1|H0YKZ7_HUMAN Computationally mapped isoform of Annexin OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=1 CANONICAL=P07355-1" }, "locus": { "chromosome": "15", "start_pos": 60386075, "end_pos": 60360941, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000559467.5", "url": "https://www.ensembl.org/id/ENST00000559467.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000453000.1", "url": "https://www.ensembl.org/id/ENSP00000453000.1" } ] } }, { "isoform_ac": "H0YL33-1", "url": "", "sequence": { "sequence": "MKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD", "length": 222, "header": "tr|H0YL33-1|H0YL33_HUMAN Computationally mapped isoform of Annexin OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2 CANONICAL=P07355-1" }, "locus": { "chromosome": "15", "start_pos": 60360946, "end_pos": 60347633, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000558985.6", "url": "https://www.ensembl.org/id/ENST00000558985.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000453039.2", "url": "https://www.ensembl.org/id/ENSP00000453039.2" } ] } }, { "isoform_ac": "H0YLE2-1", "url": "", "sequence": { "sequence": "MKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISD", "length": 45, "header": "tr|H0YLE2-1|H0YLE2_HUMAN Computationally mapped isoform of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=1 CANONICAL=P07355-1" }, "locus": { "chromosome": "15", "start_pos": 60360946, "end_pos": 60355961, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000559725.5", "url": "https://www.ensembl.org/id/ENST00000559725.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000453174.1", "url": "https://www.ensembl.org/id/ENSP00000453174.1" } ] } }, { "isoform_ac": "H0YLV6-1", "url": "", "sequence": { "sequence": "MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKVNAWAGNRRGLSH", "length": 132, "header": "tr|H0YLV6-1|H0YLV6_HUMAN Computationally mapped isoform of Annexin OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=1 CANONICAL=P07355-1" }, "locus": { "chromosome": "15", "start_pos": 60386075, "end_pos": 60357208, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000558503.6", "url": "https://www.ensembl.org/id/ENST00000558503.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000453356.1", "url": "https://www.ensembl.org/id/ENSP00000453356.1" } ] } }, { "isoform_ac": "H0YM50-1", "url": "", "sequence": { "sequence": "XNQILIWCQQCQENSPISSVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMK", "length": 248, "header": "tr|H0YM50-1|H0YM50_HUMAN Computationally mapped isoform of Annexin OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=1 CANONICAL=P07355-1" }, "locus": { "chromosome": "15", "start_pos": 60374505, "end_pos": 60351192, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000559176.5", "url": "https://www.ensembl.org/id/ENST00000559176.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000453464.1", "url": "https://www.ensembl.org/id/ENSP00000453464.1" } ] } }, { "isoform_ac": "H0YMD0-1", "url": "", "sequence": { "sequence": "MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQK", "length": 227, "header": "tr|H0YMD0-1|H0YMD0_HUMAN Computationally mapped isoform of Annexin OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=1 CANONICAL=P07355-1" }, "locus": { "chromosome": "15", "start_pos": 60386075, "end_pos": 60352384, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000560367.6", "url": "https://www.ensembl.org/id/ENST00000560367.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000453556.1", "url": "https://www.ensembl.org/id/ENSP00000453556.1" } ] } }, { "isoform_ac": "H0YMD9-1", "url": "", "sequence": { "sequence": "MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSN", "length": 65, "header": "tr|H0YMD9-1|H0YMD9_HUMAN Computationally mapped isoform of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=1 CANONICAL=P07355-1" }, "locus": { "chromosome": "15", "start_pos": 60386075, "end_pos": 60364477, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000559370.5", "url": "https://www.ensembl.org/id/ENST00000559370.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000453566.1", "url": "https://www.ensembl.org/id/ENSP00000453566.1" } ] } }, { "isoform_ac": "H0YMM1-1", "url": "", "sequence": { "sequence": "MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKE", "length": 149, "header": "tr|H0YMM1-1|ANXA2_HUMAN Computationally mapped isoform of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=1 CANONICAL=P07355-1" }, "locus": { "chromosome": "15", "start_pos": 60386075, "end_pos": 60357147, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000559350.5", "url": "https://www.ensembl.org/id/ENST00000559350.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000453663.1", "url": "https://www.ensembl.org/id/ENSP00000453663.1" } ] } }, { "isoform_ac": "H0YMT9-1", "url": "", "sequence": { "sequence": "MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIIC", "length": 133, "header": "tr|H0YMT9-1|H0YMT9_HUMAN Computationally mapped isoform of Annexin OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=1 CANONICAL=P07355-1" }, "locus": { "chromosome": "15", "start_pos": 60386075, "end_pos": 60357195, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000558986.5", "url": "https://www.ensembl.org/id/ENST00000558986.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000453739.1", "url": "https://www.ensembl.org/id/ENSP00000453739.1" } ] } }, { "isoform_ac": "H0YMU9-1", "url": "", "sequence": { "sequence": "MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKGGI", "length": 230, "header": "tr|H0YMU9-1|H0YMU9_HUMAN Computationally mapped isoform of Annexin OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=1 CANONICAL=P07355-1" }, "locus": { "chromosome": "15", "start_pos": 60386075, "end_pos": 60351816, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000560014.5", "url": "https://www.ensembl.org/id/ENST00000560014.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000453754.1", "url": "https://www.ensembl.org/id/ENSP00000453754.1" } ] } }, { "isoform_ac": "H0YMW4-1", "url": "", "sequence": { "sequence": "MSWPCDSVINQDHKTKEKNICFQKASFKMSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD", "length": 367, "header": "tr|H0YMW4-1|H0YMW4_HUMAN Computationally mapped isoform of Annexin OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2 CANONICAL=P07355-1" }, "locus": { "chromosome": "15", "start_pos": 60393110, "end_pos": 60347633, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000559780.6", "url": "https://www.ensembl.org/id/ENST00000559780.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000453770.2", "url": "https://www.ensembl.org/id/ENSP00000453770.2" } ] } }, { "isoform_ac": "H0YN28-1", "url": "", "sequence": { "sequence": "MKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAF", "length": 139, "header": "tr|H0YN28-1|H0YN28_HUMAN Computationally mapped isoform of Annexin OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=1 CANONICAL=P07355-1" }, "locus": { "chromosome": "15", "start_pos": 60360946, "end_pos": 60351734, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000560466.5", "url": "https://www.ensembl.org/id/ENST00000560466.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000453841.1", "url": "https://www.ensembl.org/id/ENSP00000453841.1" } ] } }, { "isoform_ac": "H0YN42-1", "url": "", "sequence": { "sequence": "MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAF", "length": 256, "header": "tr|H0YN42-1|H0YN42_HUMAN Computationally mapped isoform of Annexin OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=1 CANONICAL=P07355-1" }, "locus": { "chromosome": "15", "start_pos": 60386075, "end_pos": 60347633, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000559818", "url": "https://www.ensembl.org/id/ENST00000559818" }, { "database": "Ensembl Peptide", "id": "ENSP00000453859", "url": "https://www.ensembl.org/id/ENSP00000453859" } ] } }, { "isoform_ac": "H0YNA0-1", "url": "", "sequence": { "sequence": "MKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDAR", "length": 79, "header": "tr|H0YNA0-1|H0YNA0_HUMAN Computationally mapped isoform of Annexin OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=1 CANONICAL=P07355-1" }, "locus": { "chromosome": "15", "start_pos": 60360946, "end_pos": 60354154, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000558998.5", "url": "https://www.ensembl.org/id/ENST00000558998.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000453925.1", "url": "https://www.ensembl.org/id/ENSP00000453925.1" } ] } }, { "isoform_ac": "H0YNB8-1", "url": "", "sequence": { "sequence": "MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKVEEQRMALSLIMN", "length": 189, "header": "tr|H0YNB8-1|H0YNB8_HUMAN Computationally mapped isoform of Annexin OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2 CANONICAL=P07355-1" }, "locus": { "chromosome": "15", "start_pos": 60386075, "end_pos": 60354174, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000558169.6", "url": "https://www.ensembl.org/id/ENST00000558169.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000453945.2", "url": "https://www.ensembl.org/id/ENSP00000453945.2" } ] } }, { "isoform_ac": "H0YNP5-1", "url": "", "sequence": { "sequence": "MSTVHEILCKLSLEGDELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDM", "length": 175, "header": "tr|H0YNP5-1|H0YNP5_HUMAN Computationally mapped isoform of Annexin OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=1 CANONICAL=P07355-1" }, "locus": { "chromosome": "15", "start_pos": 60386075, "end_pos": 60351782, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000558132.5", "url": "https://www.ensembl.org/id/ENST00000558132.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000454096.1", "url": "https://www.ensembl.org/id/ENSP00000454096.1" } ] } }, { "isoform_ac": "P07355-1", "url": "", "sequence": { "sequence": "MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD", "length": 339, "header": "sp|P07355-1|ANXA2_HUMAN Isoform 1 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2 CANONICAL=P07355-1" }, "locus": { "chromosome": "15", "start_pos": 60386075, "end_pos": 60347633, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000396024.7", "url": "https://www.ensembl.org/id/ENST00000396024.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000379342.3", "url": "https://www.ensembl.org/id/ENSP00000379342.3" } ] } }, { "isoform_ac": "P07355-2", "url": "", "sequence": { "sequence": "MGRQLAGCGDAGKKASFKMSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD", "length": 357, "header": "sp|P07355-2|ANXA2_HUMAN Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2 CANONICAL=P07355-1" }, "locus": { "chromosome": "15", "start_pos": 60397913, "end_pos": 60347633, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000332680.8", "url": "https://www.ensembl.org/id/ENST00000332680.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000346032.3", "url": "https://www.ensembl.org/id/ENSP00000346032.3" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 153, "start_aa": "Thr", "end_pos": 153, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr153", "evidence": [ { "id": "P07355", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07355" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "18369606", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18369606" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "30444036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30444036" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "P07355", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P07355" } ] }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 153, "start_aa": "Thr", "end_pos": 153, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr153", "evidence": [ { "id": "GLY_000142", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000142" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 2, "start_aa": "Ser", "end_pos": 2, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2", "evidence": [ { "id": "P07355", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07355" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "18369606", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18369606" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "30444036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30444036" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] } ], "phosphorylation": [ { "start_pos": 123, "end_pos": 123, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" }, { "database": "PubMed", "id": "18491316", "url": "https://glygen.org/publication/PubMed/18491316" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Thr123" }, { "start_pos": 127, "end_pos": 127, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser127" }, { "start_pos": 12, "end_pos": 12, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P07355", "url": "http://phospho.elm.eu.org/byAccession/P07355.html" }, { "database": "PubMed", "id": "12962548", "url": "https://glygen.org/publication/PubMed/12962548" } ], "site_lbl": "Ser12" }, { "start_pos": 147, "end_pos": 147, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Tyr147" }, { "start_pos": 153, "end_pos": 153, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr153" }, { "start_pos": 184, "end_pos": 184, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Ser184" }, { "start_pos": 188, "end_pos": 188, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" }, { "database": "PubMed", "id": "17389395", "url": "https://glygen.org/publication/PubMed/17389395" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "phospho.ELM", "id": "P07355", "url": "http://phospho.elm.eu.org/byAccession/P07355.html" } ], "site_lbl": "Tyr188" }, { "start_pos": 18, "end_pos": 18, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P07355", "url": "http://phospho.elm.eu.org/byAccession/P07355.html" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser18" }, { "start_pos": 199, "end_pos": 199, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" }, { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" }, { "database": "phospho.ELM", "id": "P07355", "url": "http://phospho.elm.eu.org/byAccession/P07355.html" } ], "site_lbl": "Tyr199" }, { "start_pos": 19, "end_pos": 19, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068230", "url": "https://glygen.org/publication/PubMed/20068230" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P07355", "url": "http://phospho.elm.eu.org/byAccession/P07355.html" } ], "site_lbl": "Thr19" }, { "start_pos": 22, "end_pos": 22, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser22" }, { "start_pos": 238, "end_pos": 238, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" }, { "database": "PubMed", "id": "17016520", "url": "https://glygen.org/publication/PubMed/17016520" }, { "database": "PubMed", "id": "17389395", "url": "https://glygen.org/publication/PubMed/17389395" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" }, { "database": "phospho.ELM", "id": "P07355", "url": "http://phospho.elm.eu.org/byAccession/P07355.html" } ], "site_lbl": "Tyr238" }, { "start_pos": 24, "end_pos": 24, "kinase_uniprot_canonical_ac": "P12931-1", "kinase_gene_name": "SRC", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P07355", "url": "http://phospho.elm.eu.org/byAccession/P07355.html" }, { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" }, { "database": "PubMed", "id": "2456953", "url": "https://glygen.org/publication/PubMed/2456953" }, { "database": "PubMed", "id": "15302870", "url": "https://glygen.org/publication/PubMed/15302870" } ], "site_lbl": "Tyr24" }, { "start_pos": 24, "end_pos": 24, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by SRC", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" }, { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" }, { "database": "PubMed", "id": "16497976", "url": "https://glygen.org/publication/PubMed/16497976" }, { "database": "PubMed", "id": "17016520", "url": "https://glygen.org/publication/PubMed/17016520" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "17389395", "url": "https://glygen.org/publication/PubMed/17389395" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18707149", "url": "https://glygen.org/publication/PubMed/18707149" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "2456953", "url": "https://glygen.org/publication/PubMed/2456953" }, { "database": "phospho.ELM", "id": "P07355", "url": "http://phospho.elm.eu.org/byAccession/P07355.html" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" }, { "database": "PubMed", "id": "23512564", "url": "https://glygen.org/publication/PubMed/23512564" }, { "database": "PubMed", "id": "28669632", "url": "https://glygen.org/publication/PubMed/28669632" }, { "database": "PubMed", "id": "32629869", "url": "https://glygen.org/publication/PubMed/32629869" }, { "database": "PubMed", "id": "15302870", "url": "https://glygen.org/publication/PubMed/15302870" } ], "site_lbl": "Tyr24" }, { "start_pos": 26, "end_pos": 26, "kinase_uniprot_canonical_ac": "P05771-1", "kinase_gene_name": "PRKCB", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" }, { "database": "PubMed", "id": "18412141", "url": "https://glygen.org/publication/PubMed/18412141" } ], "site_lbl": "Ser26" }, { "start_pos": 26, "end_pos": 26, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" }, { "database": "PubMed", "id": "2946940", "url": "https://glygen.org/publication/PubMed/2946940" } ], "site_lbl": "Ser26" }, { "start_pos": 26, "end_pos": 26, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKC", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" }, { "database": "phospho.ELM", "id": "P07355", "url": "http://phospho.elm.eu.org/byAccession/P07355.html" }, { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" }, { "database": "PubMed", "id": "18412141", "url": "https://glygen.org/publication/PubMed/18412141" }, { "database": "PubMed", "id": "2174397", "url": "https://glygen.org/publication/PubMed/2174397" }, { "database": "PubMed", "id": "2946940", "url": "https://glygen.org/publication/PubMed/2946940" }, { "database": "PubMed", "id": "28669632", "url": "https://glygen.org/publication/PubMed/28669632" }, { "database": "PubMed", "id": "35257889", "url": "" } ], "site_lbl": "Ser26" }, { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "P05771-1", "kinase_gene_name": "PRKCB", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "8898866", "url": "https://glygen.org/publication/PubMed/8898866" } ], "site_lbl": "Ser2" }, { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser2" }, { "start_pos": 30, "end_pos": 30, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" }, { "database": "PubMed", "id": "15951569", "url": "https://glygen.org/publication/PubMed/15951569" }, { "database": "PubMed", "id": "17016520", "url": "https://glygen.org/publication/PubMed/17016520" }, { "database": "PubMed", "id": "17389395", "url": "https://glygen.org/publication/PubMed/17389395" }, { "database": "phospho.ELM", "id": "P07355", "url": "http://phospho.elm.eu.org/byAccession/P07355.html" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" } ], "site_lbl": "Tyr30" }, { "start_pos": 316, "end_pos": 316, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" }, { "database": "phospho.ELM", "id": "P07355", "url": "http://phospho.elm.eu.org/byAccession/P07355.html" } ], "site_lbl": "Tyr316" }, { "start_pos": 317, "end_pos": 317, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" }, { "database": "phospho.ELM", "id": "P07355", "url": "http://phospho.elm.eu.org/byAccession/P07355.html" } ], "site_lbl": "Tyr317" }, { "start_pos": 318, "end_pos": 318, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" }, { "database": "phospho.ELM", "id": "P07355", "url": "http://phospho.elm.eu.org/byAccession/P07355.html" } ], "site_lbl": "Tyr318" }, { "start_pos": 3, "end_pos": 3, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" }, { "database": "phospho.ELM", "id": "P07355", "url": "http://phospho.elm.eu.org/byAccession/P07355.html" } ], "site_lbl": "Thr3" }, { "start_pos": 75, "end_pos": 75, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" } ], "site_lbl": "Tyr75" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Mibefradil block of cloned T-type calcium channels.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2000", "authors": "Martin RL, Lee JH, Cribbs LL, Perez-Reyes E, Hanck DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "10991994", "url": "https://glygen.org/publication/PubMed/10991994" } ] }, { "title": "NO-independent regulatory site on soluble guanylate cyclase.", "journal": "Nature", "date": "2001", "authors": "Stasch JP, Becker EM, Alonso-Alija C, Apeler H, Dembowsky K, Feurer A, Gerzer R, Minuth T, Perzborn E, Pleiss U, Schroder H, Schroeder W, Stahl E, Steinke W, Straub A, Schramm M", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "11242081", "url": "https://glygen.org/publication/PubMed/11242081" } ] }, { "title": "Invited review: cross-bridge regulation by thin filament-associated proteins.", "journal": "Journal of applied physiology (Bethesda, Md. : 1985)", "date": "2001", "authors": "Morgan KG, Gangopadhyay SS", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "11457814", "url": "https://glygen.org/publication/PubMed/11457814" } ] }, { "title": "The sarcolemmal proteins dysferlin and caveolin-3 interact in skeletal muscle.", "journal": "Human molecular genetics", "date": "2001", "authors": "Matsuda C, Hayashi YK, Ogawa M, Aoki M, Murayama K, Nishino I, Nonaka I, Arahata K, Brown RH Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "11532985", "url": "https://glygen.org/publication/PubMed/11532985" } ] }, { "title": "Functional and biochemical analysis of endothelial (dys)function and NO/cGMP signaling in human blood vessels with and without nitroglycerin pretreatment.", "journal": "Circulation", "date": "2002", "authors": "Schulz E, Tsilimingas N, Rinze R, Reiter B, Wendt M, Oelze M, Woelken-Weckmuller S, Walter U, Reichenspurner H, Meinertz T, Munzel T", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "11889009", "url": "https://glygen.org/publication/PubMed/11889009" } ] }, { "title": "The blockage of the high-affinity lysine binding sites of plasminogen by EACA significantly inhibits prourokinase-induced plasminogen activation.", "journal": "Biochimica et biophysica acta", "date": "2002", "authors": "Sun Z, Chen YH, Wang P, Zhang J, Gurewich V, Zhang P, Liu JN", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "12007600", "url": "https://glygen.org/publication/PubMed/12007600" } ] }, { "title": "Identification of the enzymatic mechanism of nitroglycerin bioactivation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Chen Z, Zhang J, Stamler JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "12048254", "url": "https://glygen.org/publication/PubMed/12048254" } ] }, { "title": "Nuclear annexin II negatively regulates growth of LNCaP cells and substitution of ser 11 and 25 to glu prevents nucleo-cytoplasmic shuttling of annexin II.", "journal": "BMC biochemistry", "date": "2003", "authors": "Liu J, Rothermund CA, Ayala-Sanmartin J, Vishwanatha JK", "evidence": [ { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" } ], "reference": [ { "type": "PubMed", "id": "12962548", "url": "https://glygen.org/publication/PubMed/12962548" } ] }, { "title": "Isolation and characterization of alpha2-plasmin inhibitor from human plasma. A novel proteinase inhibitor which inhibits activator-induced clot lysis.", "journal": "The Journal of biological chemistry", "date": "1976", "authors": "Moroi M, Aoki N", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "134998", "url": "https://glygen.org/publication/PubMed/134998" } ] }, { "title": "Dysferlin interacts with annexins A1 and A2 and mediates sarcolemmal wound-healing.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Lennon NJ, Kho A, Bacskai BJ, Perlmutter SL, Hyman BT, Brown RH Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "14506282", "url": "https://glygen.org/publication/PubMed/14506282" } ] }, { "title": "CEACAM1, a cell-cell adhesion molecule, directly associates with annexin II in a three-dimensional model of mammary morphogenesis.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Kirshner J, Schumann D, Shively JE", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "reference": [ { "type": "PubMed", "id": "14522961", "url": "https://glygen.org/publication/PubMed/14522961" } ] }, { "title": "Smooth muscle contraction and relaxation.", "journal": "Advances in physiology education", "date": "2003", "authors": "Webb RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "14627618", "url": "https://glygen.org/publication/PubMed/14627618" } ] }, { "title": "Proteomic characterization of the human centrosome by protein correlation profiling.", "journal": "Nature", "date": "2003", "authors": "Andersen Jens S, Wilkinson Christopher J, Mayor Thibault, Mortensen Peter, Nigg Erich A, Mann Matthias", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "reference": [ { "type": "PubMed", "id": "14654843", "url": "https://glygen.org/publication/PubMed/14654843" } ] }, { "title": "An annexin 2 phosphorylation switch mediates p11-dependent translocation of annexin 2 to the cell surface.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Deora AB, Kreitzer G, Jacovina AT, Hajjar KA", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" }, { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" } ], "reference": [ { "type": "PubMed", "id": "15302870", "url": "https://glygen.org/publication/PubMed/15302870" } ] }, { "title": "Contribution of aldehyde dehydrogenase to mitochondrial bioactivation of nitroglycerin: evidence for the activation of purified soluble guanylate cyclase through direct formation of nitric oxide.", "journal": "The Biochemical journal", "date": "2005", "authors": "Kollau A, Hofer A, Russwurm M, Koesling D, Keung WM, Schmidt K, Brunner F, Mayer B", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "15377279", "url": "https://glygen.org/publication/PubMed/15377279" } ] }, { "title": "Human platelet myosin light chain kinase requires the calcium-binding protein calmodulin for activity.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1979", "authors": "Hathaway DR, Adelstein RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "156362", "url": "https://glygen.org/publication/PubMed/156362" } ] }, { "title": "Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.", "journal": "Molecular & cellular proteomics : MCP", "date": "2005", "authors": "Zhang Y, Wolf-Yadlin A, Ross PL, Pappin DJ, Rush J, Lauffenburger DA, White FM", "evidence": [ { "database": "iPTMnet", "id": "P07355-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355-1" } ], "reference": [ { "type": "PubMed", "id": "15951569", "url": "https://glygen.org/publication/PubMed/15951569" } ] }, { "title": "Proteome profiling of interleukin-12 treated human T helper cells.", "journal": "Proteomics", "date": "2005", "authors": "Rosengren AT, Nyman TA, Lahesmaa R", "evidence": [ { "database": "Reactome", "id": "R-HSA-8950505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8950505" } ], "reference": [ { "type": "PubMed", "id": "16038020", "url": "https://glygen.org/publication/PubMed/16038020" } ] }, { "title": "Proteomic identification of proteins conjugated to ISG15 in mouse and human cells.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Giannakopoulos NV, Luo JK, Papov V, Zou W, Lenschow DJ, Jacobs BS, Borden EC, Li J, Virgin HW, Zhang DE", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "reference": [ { "type": "PubMed", "id": "16139798", "url": "https://glygen.org/publication/PubMed/16139798" } ] }, { "title": "Global identification of O-GlcNAc-modified proteins.", "journal": "Analytical chemistry", "date": "2006", "authors": "Nandi A, Sprung R, Barma DK, Zhao Y, Kim SC, Falck JR, Zhao Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07355", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07355" } ], "reference": [ { "type": "PubMed", "id": "16408927", "url": "https://glygen.org/publication/PubMed/16408927" } ] }, { "title": "A common phosphotyrosine signature for the Bcr-Abl kinase.", "journal": "Blood", "date": "2006", "authors": "Goss VL, Lee KA, Moritz A, Nardone J, Spek EJ, MacNeill J, Rush J, Comb MJ, Polakiewicz RD", "evidence": [ { "database": "iPTMnet", "id": "P07355-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355-1" } ], "reference": [ { "type": "PubMed", "id": "16497976", "url": "https://glygen.org/publication/PubMed/16497976" } ] }, { "title": "Phosphoproteome analysis of the human mitotic spindle.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Nousiainen M, Sillje HH, Sauer G, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "P07355-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355-1" } ], "reference": [ { "type": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" } ] }, { "title": "Effects of HER2 overexpression on cell signaling networks governing proliferation and migration.", "journal": "Molecular systems biology", "date": "2006", "authors": "Wolf-Yadlin A, Kumar N, Zhang Y, Hautaniemi S, Zaman M, Kim HD, Grantcharova V, Lauffenburger DA, White FM", "evidence": [ { "database": "iPTMnet", "id": "P07355-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355-1" } ], "reference": [ { "type": "PubMed", "id": "17016520", "url": "https://glygen.org/publication/PubMed/17016520" } ] }, { "title": "Bioactivation of nitroglycerin by the mitochondrial aldehyde dehydrogenase.", "journal": "Trends in cardiovascular medicine", "date": "2006", "authors": "Chen Z, Stamler JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "17055381", "url": "https://glygen.org/publication/PubMed/17055381" } ] }, { "title": "Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.", "journal": "J. Proteome Res.", "date": "2006", "authors": "Chi A, Valencia JC, Hu ZZ, Watabe H, Yamaguchi H, Mangini NJ, Huang H, Canfield VA, Cheng KC, Yang F, Abe R, Yamagishi S, Shabanowitz J, Hearing VJ, Wu C, Appella E, Hunt DF", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "reference": [ { "type": "PubMed", "id": "17081065", "url": "https://glygen.org/publication/PubMed/17081065" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P07355-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355-1" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Molina H, Horn DM, Tang N, Mathivanan S, Pandey A", "evidence": [ { "database": "iPTMnet", "id": "P07355-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355-1" } ], "reference": [ { "type": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" } ] }, { "title": "Foxp3 controls regulatory T-cell function by interacting with AML1/Runx1.", "journal": "Nature", "date": "2007", "authors": "Ono M, Yaguchi H, Ohkura N, Kitabayashi I, Nagamura Y, Nomura T, Miyachi Y, Tsukada T, Sakaguchi S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8950505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8950505" } ], "reference": [ { "type": "PubMed", "id": "17377532", "url": "https://glygen.org/publication/PubMed/17377532" } ] }, { "title": "Multiple reaction monitoring for robust quantitative proteomic analysis of cellular signaling networks.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Wolf-Yadlin A, Hautaniemi S, Lauffenburger DA, White FM", "evidence": [ { "database": "iPTMnet", "id": "P07355-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355-1" } ], "reference": [ { "type": "PubMed", "id": "17389395", "url": "https://glygen.org/publication/PubMed/17389395" } ] }, { "title": "Evaluation of aprotinin and tranexamic acid in different in vitro and in vivo models of fibrinolysis, coagulation and thrombus formation.", "journal": "Journal of thrombosis and haemostasis : JTH", "date": "2007", "authors": "Sperzel M, Huetter J", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "17666018", "url": "https://glygen.org/publication/PubMed/17666018" } ] }, { "title": "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.", "journal": "Journal of proteome research", "date": "2007", "authors": "Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD", "evidence": [ { "database": "iPTMnet", "id": "P07355-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355-1" } ], "reference": [ { "type": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" } ] }, { "title": "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer.", "journal": "Cell", "date": "2007", "authors": "Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ", "evidence": [ { "database": "iPTMnet", "id": "P07355-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355-1" } ], "reference": [ { "type": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" } ] }, { "title": "The protein-tyrosine kinase substrate, calpactin I heavy chain (p36), is part of the primer recognition protein complex that interacts with DNA polymerase alpha.", "journal": "J. Biol. Chem.", "date": "1991", "authors": "Jindal HK, Chaney WG, Anderson CW, Davis RG, Vishwanatha JK", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "reference": [ { "type": "PubMed", "id": "1825830", "url": "https://glygen.org/publication/PubMed/1825830" } ] }, { "title": "Plasminogen activation by receptor-bound urokinase. A kinetic study with both cell-associated and isolated receptor.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Ellis V, Behrendt N, Dano K", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "1829461", "url": "https://glygen.org/publication/PubMed/1829461" } ] }, { "title": "Identification of new O-GlcNAc modified proteins using a click-chemistry-based tagging.", "journal": "Analytical and bioanalytical chemistry", "date": "2008", "authors": "Gurcel C, Vercoutter-Edouart AS, Fonbonne C, Mortuaire M, Salvador A, Michalski JC, Lemoine J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07355", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07355" } ], "reference": [ { "type": "PubMed", "id": "18369606", "url": "https://glygen.org/publication/PubMed/18369606" } ] }, { "title": "Epstein-Barr virus latent membrane protein 1 mediates serine 25 phosphorylation and nuclear entry of annexin A2 via PI-PLC-PKCalpha/PKCbeta pathway.", "journal": "Molecular carcinogenesis", "date": "2008", "authors": "Luo W, Yan G, Li L, Wang Z, Liu H, Zhou S, Liu S, Tang M, Yi W, Dong Z, Cao Y", "evidence": [ { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" } ], "reference": [ { "type": "PubMed", "id": "18412141", "url": "https://glygen.org/publication/PubMed/18412141" } ] }, { "title": "Motif-specific sampling of phosphoproteomes.", "journal": "Journal of proteome research", "date": "2008", "authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "P07355-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355-1" } ], "reference": [ { "type": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ] }, { "title": "Cellular receptor for urokinase plasminogen activator. Carboxyl-terminal processing and membrane anchoring by glycosyl-phosphatidylinositol.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Ploug M, Ronne E, Behrendt N, Jensen AL, Blasi F, Dano K", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "1846368", "url": "https://glygen.org/publication/PubMed/1846368" } ] }, { "title": "Phosphoproteome analysis of the human Chang liver cells using SCX and a complementary mass spectrometric strategy.", "journal": "Proteomics", "date": "2008", "authors": "Sui S, Wang J, Yang B, Song L, Zhang J, Chen M, Liu J, Lu Z, Cai Y, Chen S, Bi W, Zhu Y, He F, Qian X", "evidence": [ { "database": "iPTMnet", "id": "P07355-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355-1" } ], "reference": [ { "type": "PubMed", "id": "18491316", "url": "https://glygen.org/publication/PubMed/18491316" } ] }, { "title": "TiO(2)-based phosphoproteomic analysis of the plasma membrane and the effects of phosphatase inhibitor treatment.", "journal": "Journal of proteome research", "date": "2008", "authors": "Thingholm TE, Larsen MR, Ingrell CR, Kassem M, Jensen ON", "evidence": [ { "database": "iPTMnet", "id": "P07355-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355-1" } ], "reference": [ { "type": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "P07355-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.", "journal": "Molecular cell", "date": "2008", "authors": "Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P07355-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355-1" } ], "reference": [ { "type": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ] }, { "title": "Immobilized metal affinity chromatography revisited: pH/acid control toward high selectivity in phosphoproteomics.", "journal": "Journal of proteome research", "date": "2008", "authors": "Tsai CF, Wang YT, Chen YR, Lai CY, Lin PY, Pan KT, Chen JY, Khoo KH, Chen YJ", "evidence": [ { "database": "iPTMnet", "id": "P07355-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355-1" } ], "reference": [ { "type": "PubMed", "id": "18707149", "url": "https://glygen.org/publication/PubMed/18707149" } ] }, { "title": "Annexin A2 is a C-terminal PCSK9-binding protein that regulates endogenous low density lipoprotein receptor levels.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Mayer G, Poirier S, Seidah NG", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "reference": [ { "type": "PubMed", "id": "18799458", "url": "https://glygen.org/publication/PubMed/18799458" } ] }, { "title": "Molecular pharmacology of human Cav3.2 T-type Ca2+ channels: block by antihypertensives, antiarrhythmics, and their analogs.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2009", "authors": "Perez-Reyes E, Van Deusen AL, Vitko I", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "18974361", "url": "https://glygen.org/publication/PubMed/18974361" } ] }, { "title": "The molecular anatomy of caldesmon.", "journal": "The Biochemical journal", "date": "1991", "authors": "Marston SB, Redwood CS", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "1930128", "url": "https://glygen.org/publication/PubMed/1930128" } ] }, { "title": "Membrane repair defects in muscular dystrophy are linked to altered interaction between MG53, caveolin-3, and dysferlin.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Cai C, Weisleder N, Ko JK, Komazaki S, Sunada Y, Nishi M, Takeshima H, Ma J", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "19380584", "url": "https://glygen.org/publication/PubMed/19380584" } ] }, { "title": "Phosphoproteomic analysis of distinct tumor cell lines in response to nocodazole treatment.", "journal": "Proteomics", "date": "2009", "authors": "Nagano K, Shinkawa T, Mutoh H, Kondoh O, Morimoto S, Inomata N, Ashihara M, Ishii N, Aoki Y, Haramura M", "evidence": [ { "database": "iPTMnet", "id": "P07355-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355-1" } ], "reference": [ { "type": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P07355-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355-1" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "Extensive crosstalk between O-GlcNAcylation and phosphorylation regulates cytokinesis.", "journal": "Science signaling", "date": "2010", "authors": "Wang Z, Udeshi ND, Slawson C, Compton PD, Sakabe K, Cheung WD, Shabanowitz J, Hunt DF, Hart GW", "evidence": [ { "database": "iPTMnet", "id": "P07355-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355-1" } ], "reference": [ { "type": "PubMed", "id": "20068230", "url": "https://glygen.org/publication/PubMed/20068230" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P07355-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Phosphoproteome analysis of human liver tissue by long-gradient nanoflow LC coupled with multiple stage MS analysis.", "journal": "Electrophoresis", "date": "2010", "authors": "Han G, Ye M, Liu H, Song C, Sun D, Wu Y, Jiang X, Chen R, Wang C, Wang L, Zou H", "evidence": [ { "database": "iPTMnet", "id": "P07355-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355-1" } ], "reference": [ { "type": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ] }, { "title": "The human receptor for urokinase plasminogen activator. NH2-terminal amino acid sequence and glycosylation variants.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Behrendt N, Ronne E, Ploug M, Petri T, Lober D, Nielsen LS, Schleuning WD, Blasi F, Appella E, Dano K", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "2156852", "url": "https://glygen.org/publication/PubMed/2156852" } ] }, { "title": "The receptor for urokinase type plasminogen activator polarizes expression of the protease to the leading edge of migrating monocytes and promotes degradation of enzyme inhibitor complexes.", "journal": "The Journal of cell biology", "date": "1990", "authors": "Estreicher A, Muhlhauser J, Carpentier JL, Orci L, Vassalli JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "2166055", "url": "https://glygen.org/publication/PubMed/2166055" } ] }, { "title": "Characterization of the human lipocortin-2-encoding multigene family: its structure suggests the existence of a short amino acid unit undergoing duplication.", "journal": "Gene", "date": "1990", "authors": "Spano F, Raugei G, Palla E, Colella C, Melli M", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" }, { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" } ], "reference": [ { "type": "PubMed", "id": "2174397", "url": "https://glygen.org/publication/PubMed/2174397" } ] }, { "title": "Cochlin induced TREK-1 co-expression and annexin A2 secretion: role in trabecular meshwork cell elongation and motility.", "journal": "PLoS ONE", "date": "2011", "authors": "Goel Manik, Sienkiewicz Adam E, Picciani Renata, Lee Richard K, Bhattacharya Sanjoy K", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "reference": [ { "type": "PubMed", "id": "21886777", "url": "https://glygen.org/publication/PubMed/21886777" } ] }, { "title": "In vivo imaging of molecular interactions at damaged sarcolemma.", "journal": "Developmental cell", "date": "2012", "authors": "Roostalu U, Strahle U", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "22421042", "url": "https://glygen.org/publication/PubMed/22421042" } ] }, { "title": "Cinaciguat, a soluble guanylate cyclase activator, unloads the heart but also causes hypotension in acute decompensated heart failure.", "journal": "European heart journal", "date": "2013", "authors": "Erdmann E, Semigran MJ, Nieminen MS, Gheorghiade M, Agrawal R, Mitrovic V, Mebazaa A", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "22778174", "url": "https://glygen.org/publication/PubMed/22778174" } ] }, { "title": "Annexin A2 is a natural extrahepatic inhibitor of the PCSK9-induced LDL receptor degradation.", "journal": "PloS one", "date": "2012", "authors": "Seidah NG, Poirier S, Denis M, Parker R, Miao B, Mapelli C, Prat A, Wassef H, Davignon J, Hajjar KA, Mayer G", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "reference": [ { "type": "PubMed", "id": "22848640", "url": "https://glygen.org/publication/PubMed/22848640" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" }, { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Characterization of the gene for human plasminogen, a key proenzyme in the fibrinolytic system.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Petersen TE, Martzen MR, Ichinose A, Davie EW", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "2318848", "url": "https://glygen.org/publication/PubMed/2318848" } ] }, { "title": "The annexin A2/S100A10 system in health and disease: emerging paradigms.", "journal": "Journal of biomedicine & biotechnology", "date": "2012", "authors": "Hedhli N, Falcone DJ, Huang B, Cesarman-Maus G, Kraemer R, Zhai H, Tsirka SE, Santambrogio L, Hajjar KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "23193360", "url": "https://glygen.org/publication/PubMed/23193360" } ] }, { "title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.", "journal": "Journal of proteome research", "date": "2013", "authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07355", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07355" } ], "reference": [ { "type": "PubMed", "id": "23301498", "url": "https://glygen.org/publication/PubMed/23301498" } ] }, { "title": "Annexin A2 system in human biology: cell surface and beyond.", "journal": "Seminars in thrombosis and hemostasis", "date": "2013", "authors": "Luo M, Hajjar KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "23483454", "url": "https://glygen.org/publication/PubMed/23483454" } ] }, { "title": "Increased beta-oxidation with improved glucose uptake capacity in adipose tissue from obese after weight loss and maintenance.", "journal": "Obesity (Silver Spring, Md.)", "date": "2014", "authors": "Bouwman FG, Wang P, van Baak M, Saris WH, Mariman EC", "evidence": [ { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" } ], "reference": [ { "type": "PubMed", "id": "23512564", "url": "https://glygen.org/publication/PubMed/23512564" } ] }, { "title": "Proteome profiling of human neutrophil granule subsets, secretory vesicles, and cell membrane: correlation with transcriptome profiling of neutrophil precursors.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Rorvig S, Ostergaard O, Heegaard NH, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "23650620", "url": "https://glygen.org/publication/PubMed/23650620" } ] }, { "title": "Low threshold T-type calcium channels as targets for novel epilepsy treatments.", "journal": "British journal of clinical pharmacology", "date": "2014", "authors": "Powell KL, Cain SM, Snutch TP, O'Brien TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "23834404", "url": "https://glygen.org/publication/PubMed/23834404" } ] }, { "title": "Amino-acid sequence of human alpha 2-antiplasmin.", "journal": "European journal of biochemistry", "date": "1987", "authors": "Lijnen HR, Holmes WE, van Hoef B, Wiman B, Rodriguez H, Collen D", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "2440681", "url": "https://glygen.org/publication/PubMed/2440681" } ] }, { "title": "A discontinuous epitope on p36, the major substrate of src tyrosine-protein-kinase, brings the phosphorylation site into the neighbourhood of a consensus sequence for Ca2+/lipid-binding proteins.", "journal": "FEBS letters", "date": "1988", "authors": "Johnsson N, Johnsson K, Weber K", "evidence": [ { "database": "iPTMnet", "id": "P07355-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355-1" } ], "reference": [ { "type": "PubMed", "id": "2456953", "url": "https://glygen.org/publication/PubMed/2456953" } ] }, { "title": "Annexin A2 reduces PCSK9 protein levels via a translational mechanism and interacts with the M1 and M2 domains of PCSK9.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Ly K, Saavedra YG, Canuel M, Routhier S, Desjardins R, Hamelin J, Mayne J, Lazure C, Seidah NG, Day R", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "reference": [ { "type": "PubMed", "id": "24808179", "url": "https://glygen.org/publication/PubMed/24808179" } ] }, { "title": "Calcium channel blockers in cardiovascular pharmacotherapy.", "journal": "Journal of cardiovascular pharmacology and therapeutics", "date": "2014", "authors": "Godfraind T", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "24872348", "url": "https://glygen.org/publication/PubMed/24872348" } ] }, { "title": "Discovery of the Fibrinolysis Inhibitor AZD6564, Acting via Interference of a Protein-Protein Interaction.", "journal": "ACS medicinal chemistry letters", "date": "2014", "authors": "Cheng L, Pettersen D, Ohlsson B, Schell P, Karle M, Evertsson E, Pahlen S, Jonforsen M, Plowright AT, Bostrom J, Fex T, Thelin A, Hilgendorf C, Xue Y, Wahlund G, Lindberg W, Larsson LO, Gustafsson D", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "24900876", "url": "https://glygen.org/publication/PubMed/24900876" } ] }, { "title": "The single-chain form of tissue-type plasminogen activator has catalytic activity: studies with a mutant enzyme that lacks the cleavage site.", "journal": "Biochemistry", "date": "1989", "authors": "Boose JA, Kuismanen E, Gerard R, Sambrook J, Gething MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "2496749", "url": "https://glygen.org/publication/PubMed/2496749" } ] }, { "title": "Interaction between plasminogen activator inhibitor type 1 (PAI-1) bound to fibrin and either tissue-type plasminogen activator (t-PA) or urokinase-type plasminogen activator (u-PA). Binding of t-PA/PAI-1 complexes to fibrin mediated by both the finger and the kringle-2 domain of t-PA.", "journal": "The Journal of clinical investigation", "date": "1989", "authors": "Wagner OF, de Vries C, Hohmann C, Veerman H, Pannekoek H", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "2503541", "url": "https://glygen.org/publication/PubMed/2503541" } ] }, { "title": "Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2014", "authors": "Impens F, Radoshevich L, Cossart P, Ribet D", "evidence": [ { "database": "UniProtKB", "id": "H0YMW4", "url": "https://www.uniprot.org/uniprot/H0YMW4" } ], "reference": [ { "type": "PubMed", "id": "25114211", "url": "https://glygen.org/publication/PubMed/25114211" } ] }, { "title": "Annexin A2 mediates Mycoplasma pneumoniae community-acquired respiratory distress syndrome toxin binding to eukaryotic cells.", "journal": "mBio", "date": "2014-08-19", "authors": "Somarajan Sudha R, Al-Asadi Fadi, Ramasamy Kumaraguruparan, Pandranki Lavanya, Baseman Joel B, Kannan T R", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "reference": [ { "type": "PubMed", "id": "25139904", "url": "https://glygen.org/publication/PubMed/25139904" } ] }, { "title": "Plasminogen activation initiated by single-chain urokinase-type plasminogen activator. Potentiation by U937 monocytes.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Ellis V, Scully MF, Kakkar VV", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "2521625", "url": "https://glygen.org/publication/PubMed/2521625" } ] }, { "title": "Characterization and differential expression of human vascular smooth muscle myosin light chain 2 isoform in nonmuscle cells.", "journal": "Biochemistry", "date": "1989", "authors": "Kumar CC, Mohan SR, Zavodny PJ, Narula SK, Leibowitz PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "2526655", "url": "https://glygen.org/publication/PubMed/2526655" } ] }, { "title": "Accessibility of receptor-bound urokinase to type-1 plasminogen activator inhibitor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Cubellis MV, Andreasen P, Ragno P, Mayer M, Dano K, Blasi F", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "2544876", "url": "https://glygen.org/publication/PubMed/2544876" } ] }, { "title": "The Physiology, Pathology, and Pharmacology of Voltage-Gated Calcium Channels and Their Future Therapeutic Potential.", "journal": "Pharmacological reviews", "date": "2015", "authors": "Zamponi GW, Striessnig J, Koschak A, Dolphin AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "26362469", "url": "https://glygen.org/publication/PubMed/26362469" } ] }, { "title": "Proteomic analysis of O-GlcNAcylated proteins in invasive ductal breast carcinomas with and without lymph node metastasis.", "journal": "Amino acids", "date": "2016", "authors": "Jiang K, Gao Y, Hou W, Tian F, Ying W, Li L, Bai B, Hou G, Wang PG, Zhang L", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07355", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07355" } ], "reference": [ { "type": "PubMed", "id": "26374642", "url": "https://glygen.org/publication/PubMed/26374642" } ] }, { "title": "UBAP2 negatively regulates the invasion of hepatocellular carcinoma cell by ubiquitinating and degradating Annexin A2.", "journal": "Oncotarget", "date": "2016", "authors": "Bai Dou-Sheng, Wu Chao, Yang Liu-Xiao, Zhang Chi, Zhang Peng-Fei, He Yi-Zhou, Cai Jia-Bin, Song Zheng-Ji, Dong Zhao-Ru, Huang Xiao-Yong, Ke Ai-Wu, Shi Guo-Ming", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "reference": [ { "type": "PubMed", "id": "27121050", "url": "https://glygen.org/publication/PubMed/27121050" } ] }, { "title": "The distribution of heavy-chain isoforms of myosin in airways smooth muscle from adult and neonate humans.", "journal": "The Biochemical journal", "date": "1989", "authors": "Mohammad MA, Sparrow MP", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "2764880", "url": "https://glygen.org/publication/PubMed/2764880" } ] }, { "title": "Formation of Nitric Oxide by Aldehyde Dehydrogenase-2 Is Necessary and Sufficient for Vascular Bioactivation of Nitroglycerin.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Opelt M, Eroglu E, Waldeck-Weiermair M, Russwurm M, Koesling D, Malli R, Graier WF, Fassett JT, Schrammel A, Mayer B", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "27679490", "url": "https://glygen.org/publication/PubMed/27679490" } ] }, { "title": "Regulation of the Equilibrium between Closed and Open Conformations of Annexin A2 by N-Terminal Phosphorylation and S100A4-Binding.", "journal": "Structure (London, England : 1993)", "date": "2017", "authors": "Ecsedi P, Kiss B, Gogl G, Radnai L, Buday L, Koprivanacz K, Liliom K, Leveles I, Vertessy B, Jeszenoi N, Hetenyi C, Schlosser G, Katona G, Nyitray L", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" }, { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" } ], "reference": [ { "type": "PubMed", "id": "28669632", "url": "https://glygen.org/publication/PubMed/28669632" } ] }, { "title": "Direct comparison of tadalafil with sildenafil for the treatment of erectile dysfunction: a systematic review and meta-analysis.", "journal": "International urology and nephrology", "date": "2017", "authors": "Gong B, Ma M, Xie W, Yang X, Huang Y, Sun T, Luo Y, Huang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "28741090", "url": "https://glygen.org/publication/PubMed/28741090" } ] }, { "title": "Mapping and Quantification of Over 2000 O-linked Glycopeptides in Activated Human T Cells with Isotope-Targeted Glycoproteomics (Isotag).", "journal": "Molecular & cellular proteomics : MCP", "date": "2018", "authors": "Woo CM, Lund PJ, Huang AC, Davis MM, Bertozzi CR, Pitteri SJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07355", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07355" }, { "database": "O-GlcNAc Atlas", "id": "P07355", "url": "https://oglcnac.org/atlas/detail/P07355" }, { "database": "GlyGen", "id": "GLY_000142", "url": "https://data.glygen.org/GLY_000142" } ], "reference": [ { "type": "PubMed", "id": "29351928", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "title": "Activation of plasminogen by pro-urokinase. I. Mechanism.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Lijnen HR, Zamarron C, Blaber M, Winkler ME, Collen D", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "2935528", "url": "https://glygen.org/publication/PubMed/2935528" } ] }, { "title": "The protein-tyrosine kinase substrate p36 is also a substrate for protein kinase C in vitro and in vivo.", "journal": "Molecular and cellular biology", "date": "1986", "authors": "Gould KL, Woodgett JR, Isacke CM, Hunter T", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" }, { "database": "iPTMnet", "id": "P07355-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355-1" } ], "reference": [ { "type": "PubMed", "id": "2946940", "url": "https://glygen.org/publication/PubMed/2946940" } ] }, { "title": "Interaction of one-chain and two-chain tissue plasminogen activator with intact and plasmin-degraded fibrin.", "journal": "Biochemistry", "date": "1987", "authors": "Higgins DL, Vehar GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "2962641", "url": "https://glygen.org/publication/PubMed/2962641" } ] }, { "title": "Amino acid sequence of human histidine-rich glycoprotein derived from the nucleotide sequence of its cDNA.", "journal": "Biochemistry", "date": "1986", "authors": "Koide T, Foster D, Yoshitake S, Davie EW", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "3011081", "url": "https://glygen.org/publication/PubMed/3011081" } ] }, { "title": "Two human 35 kd inhibitors of phospholipase A2 are related to substrates of pp60v-src and of the epidermal growth factor receptor/kinase.", "journal": "Cell", "date": "1986", "authors": "Huang K S, Wallner B P, Mattaliano R J, Tizard R, Burne C, Frey A, Hession C, McGray P, Sinclair L K, Chow E P", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "reference": [ { "type": "PubMed", "id": "3013422", "url": "https://glygen.org/publication/PubMed/3013422" } ] }, { "title": "Binding of single-chain prourokinase to the urokinase receptor of human U937 cells.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Cubellis MV, Nolli ML, Cassani G, Blasi F", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "3023326", "url": "https://glygen.org/publication/PubMed/3023326" } ] }, { "title": "Combinatorial regulation of hepatic cytoplasmic signaling and nuclear transcriptional events by the OGT/REV-ERBalpha complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2018", "authors": "Berthier A, Vinod M, Porez G, Steenackers A, Alexandre J, Yamakawa N, Gheeraert C, Ploton M, Marechal X, Dubois-Chevalier J, Hovasse A, Schaeffer-Reiss C, Cianferani S, Rolando C, Bray F, Duez H, Eeckhoute J, Lefebvre T, Staels B, Lefebvre P", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07355", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07355" } ], "reference": [ { "type": "PubMed", "id": "30397120", "url": "https://glygen.org/publication/PubMed/30397120" } ] }, { "title": "O-GlcNAc-induced nuclear translocation of hnRNP-K is associated with progression and metastasis of cholangiocarcinoma.", "journal": "Molecular oncology", "date": "2019", "authors": "Phoomak C, Park D, Silsirivanit A, Sawanyawisuth K, Vaeteewoottacharn K, Detarya M, Wongkham C, Lebrilla CB, Wongkham S", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07355", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07355" } ], "reference": [ { "type": "PubMed", "id": "30444036", "url": "https://glygen.org/publication/PubMed/30444036" } ] }, { "title": "Purification and characterization of a plasminogen activator inhibitor from the histiocytic lymphoma cell line U-937.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Kruithof EK, Vassalli JD, Schleuning WD, Mattaliano RJ, Bachmann F", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "3090045", "url": "https://glygen.org/publication/PubMed/3090045" } ] }, { "title": "Next-generation unnatural monosaccharides reveal that ESRRB O-GlcNAcylation regulates pluripotency of mouse embryonic stem cells.", "journal": "Nature communications", "date": "2019", "authors": "Hao Y, Fan X, Shi Y, Zhang C, Sun DE, Qin K, Qin W, Zhou W, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07355", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07355" } ], "reference": [ { "type": "PubMed", "id": "31492838", "url": "https://glygen.org/publication/PubMed/31492838" } ] }, { "title": "Expression of Annexin A2 Promotes Cancer Progression in Estrogen Receptor Negative Breast Cancers.", "journal": "Cells", "date": "2020-06-30", "authors": "Mahdi Amira F, Malacrida Beatrice, Nolan Joanne, McCumiskey Mary E, Merrigan Anne B, Lal Ashish, Tormey Shona, Lowery Aoife J, McGourty Kieran, Kiely Patrick A", "evidence": [ { "database": "iPTMnet", "id": "P07355", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355" } ], "reference": [ { "type": "PubMed", "id": "32629869", "url": "https://glygen.org/publication/PubMed/32629869" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07355", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07355" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07355", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07355" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07355", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07355" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "Comparative O-GlcNAc Proteomic Analysis Reveals a Role of O-GlcNAcylated SAM68 in Lung Cancer Aggressiveness.", "journal": "Cancers", "date": "2022", "authors": "Lin CH, Liao CC, Wang SY, Peng CY, Yeh YC, Chen MY, Chou TY", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07355", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07355" } ], "reference": [ { "type": "PubMed", "id": "35008409", "url": "https://glygen.org/publication/PubMed/35008409" } ] }, { "title": "O-GlcNAcylation promotes fatty acid synthase activity under nutritional stress as a pro-survival mechanism in cancer cells.", "journal": "Proteomics", "date": "2022", "authors": "Wong YK, Wang J, Lim TK, Lin Q, Yap CT, Shen HM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07355", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07355" } ], "reference": [ { "type": "PubMed", "id": "35083852", "url": "https://glygen.org/publication/PubMed/35083852" } ] }, { "title": "Spatiotemporal Activation of Protein O-GlcNAcylation in Living Cells.", "journal": "Journal of the American Chemical Society", "date": "2022", "authors": "He J, Fan Z, Tian Y, Yang W, Zhou Y, Zhu Q, Zhang W, Qin W, Yi W", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07355", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07355" } ], "reference": [ { "type": "PubMed", "id": "35138101", "url": "https://glygen.org/publication/PubMed/35138101" } ] }, { "title": "Long non\u2011coding RNA LINC00460 contributes as a potential prognostic biomarker through its oncogenic role with ANXA2 in colorectal polyps.", "journal": "Molecular biology reports", "date": "2023-04-06", "authors": "Hosseini Farzaneh Alsadat, Rejali Leili, Zabihi Mohammad Reza, Salehi Zahra, Daskar-Abkenar Elahe, Taraz Tannaz, Fatemi Nayeralsadat, Hashemi Mehrdad, Asadzadeh-Aghdaei Hamid, Nazemalhosseini-Mojarad Ehsan", "evidence": [ { "database": "RefSeq", "id": "NP_001002857", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002857" } ], "reference": [ { "type": "PubMed", "id": "37024747", "url": "https://glygen.org/publication/PubMed/37024747" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07355", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07355" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "METTL3-mediated ANXA2 inhibition confers neuroprotection in ischemic stroke: Evidence from in vivo and in vitro studies.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2023", "authors": "Liu B, Xing Z, Song F, Li D, Zhao B, Xu C, Xia W, Ji H", "evidence": [ { "database": "RefSeq", "id": "NP_001002857", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002857" } ], "reference": [ { "type": "PubMed", "id": "37249328", "url": "https://glygen.org/publication/PubMed/37249328" } ] }, { "title": "Association of pro-fibrinolytic receptor AnnexinA2 with tissue plasminogen activator/Inhibitor-1 in pre-eclampsia.", "journal": "African health sciences", "date": "2023-03", "authors": "Ruikar Komal, Khode Vitthal, Shetty Shilpa S, Sarathkumar E, Patil Prakash, Patil Satish, Bargale Anil, Sadashiv Roshni, Shetty Praveenkumar", "evidence": [ { "database": "RefSeq", "id": "NP_001002857", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002857" } ], "reference": [ { "type": "PubMed", "id": "37545924", "url": "https://glygen.org/publication/PubMed/37545924" } ] }, { "title": "Tissue plasminogen activator receptor ANXA2 and its complementary regulator anti-inflammatory ANXA1 as prognostic indicators of inflammatory response in COVID-19 pathogenesis.", "journal": "Immunobiology", "date": "2023-09", "authors": "Shenoy Rathika D, Nithin Kuriakose , Vijaykrishnaraj M , Patil Prakash, Jayaswamy Pavan K, Alagundagi Dhananjay B, Shetty Praveenkumar", "evidence": [ { "database": "RefSeq", "id": "NP_001002857", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002857" } ], "reference": [ { "type": "PubMed", "id": "37579635", "url": "https://glygen.org/publication/PubMed/37579635" } ] }, { "title": "Isoforms of myosin and actin in human, monkey and rat myometrium. Comparison of pregnant and non-pregnant uterus proteins.", "journal": "European journal of biochemistry", "date": "1986", "authors": "Cavaille F, Janmot C, Ropert S, d'Albis A", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "3780718", "url": "https://glygen.org/publication/PubMed/3780718" } ] }, { "title": "Annexin A2 Stabilizes Oncogenic JAG1 Intracellular Domain by Inhibiting Proteasomal Degradation in Glioblastoma Cells.", "journal": "International journal of molecular sciences", "date": "2023-09-30", "authors": "Ham Seok Won, Kim Jung Yun, Seo Sunyoung, Hong Nayoung, Park Min Ji, Kim Yoonji, Jang Junseok, Park Sehyeon, Lee Silvee Jisoo, Kim Jun-Kyum, Kim Eun-Jung, Kim Sung-Ok, Kim Sung-Chan, Park Jong-Whi, Kim Hyunggee", "evidence": [ { "database": "RefSeq", "id": "NP_001002857", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002857" } ], "reference": [ { "type": "PubMed", "id": "37834227", "url": "https://glygen.org/publication/PubMed/37834227" } ] }, { "title": "Tissue plasminogen activator: peptide analyses confirm an indirectly derived amino acid sequence, identify the active site serine residue, establish glycosylation sites, and localize variant differences.", "journal": "Biochemistry", "date": "1984", "authors": "Pohl G, Kallstrom M, Bergsdorf N, Wallen P, Jornvall H", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "6433976", "url": "https://glygen.org/publication/PubMed/6433976" } ] }, { "title": "Isolation and characterization of a human plasma protein with affinity for the lysine binding sites in plasminogen. Role in the regulation of fibrinolysis and identification as histidine-rich glycoprotein.", "journal": "The Journal of biological chemistry", "date": "1980", "authors": "Lijnen HR, Hoylaerts M, Collen D", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "6448849", "url": "https://glygen.org/publication/PubMed/6448849" } ] }, { "title": "Kinetics of the activation of plasminogen by human tissue plasminogen activator. Role of fibrin.", "journal": "The Journal of biological chemistry", "date": "1982", "authors": "Hoylaerts M, Rijken DC, Lijnen HR, Collen D", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "7199524", "url": "https://glygen.org/publication/PubMed/7199524" } ] }, { "title": "Identification and characterization of alpha-protein kinase C binding proteins in normal and transformed REF52 cells.", "journal": "Biochemistry", "date": "1994", "authors": "Hyatt S L, Liao L, Chapline C, Jaken S", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "reference": [ { "type": "PubMed", "id": "8110754", "url": "https://glygen.org/publication/PubMed/8110754" } ] }, { "title": "An endothelial cell-surface form of annexin II binds human cytomegalovirus.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1994", "authors": "Wright J F, Kurosky A, Wasi S", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "reference": [ { "type": "PubMed", "id": "8117306", "url": "https://glygen.org/publication/PubMed/8117306" } ] }, { "title": "Annexin II is a major component of fusogenic endosomal vesicles.", "journal": "J. Cell Biol.", "date": "1993", "authors": "Emans N, Gorvel J P, Walter C, Gerke V, Kellner R, Griffiths G, Gruenberg J", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "reference": [ { "type": "PubMed", "id": "8449982", "url": "https://glygen.org/publication/PubMed/8449982" } ] }, { "title": "The crystal structure and ion channel activity of human annexin II, a peripheral membrane protein.", "journal": "J. Mol. Biol.", "date": "1996", "authors": "Burger A, Berendes R, Liemann S, Benz J, Hofmann A, G\u00f6ttig P, Huber R, Gerke V, Thiel C, R\u00f6misch J, Weber K", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "reference": [ { "type": "PubMed", "id": "8636985", "url": "https://glygen.org/publication/PubMed/8636985" } ] }, { "title": "Targeting of proteins to granule subsets is determined by timing and not by sorting: The specific granule protein NGAL is localized to azurophil granules when expressed in HL-60 cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Le Cabec V, Cowland JB, Calafat J, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "8692836", "url": "https://glygen.org/publication/PubMed/8692836" } ] }, { "title": "Sildenafil: an orally active type 5 cyclic GMP-specific phosphodiesterase inhibitor for the treatment of penile erectile dysfunction.", "journal": "International journal of impotence research", "date": "1996", "authors": "Boolell M, Allen MJ, Ballard SA, Gepi-Attee S, Muirhead GJ, Naylor AM, Osterloh IH, Gingell C", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "8858389", "url": "https://glygen.org/publication/PubMed/8858389" } ] }, { "title": "Mapping of a regulatory important site for protein kinase C phosphorylation in the N-terminal domain of annexin II.", "journal": "Biochimica et biophysica acta", "date": "1996", "authors": "Jost M, Gerke V", "evidence": [ { "database": "iPTMnet", "id": "P07355-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07355-1" } ], "reference": [ { "type": "PubMed", "id": "8898866", "url": "https://glygen.org/publication/PubMed/8898866" } ] }, { "title": "HRG Tokushima: molecular and cellular characterization of histidine-rich glycoprotein (HRG) deficiency.", "journal": "Blood", "date": "1998", "authors": "Shigekiyo T, Yoshida H, Matsumoto K, Azuma H, Wakabayashi S, Saito S, Fujikawa K, Koide T", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "9414276", "url": "https://glygen.org/publication/PubMed/9414276" } ] }, { "title": "Cardiovascular T-type calcium channels: physiological and pharmacological significance.", "journal": "Journal of hypertension. Supplement : official journal of the International Society of Hypertension", "date": "1997", "authors": "Triggle DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "9481611", "url": "https://glygen.org/publication/PubMed/9481611" } ] }, { "title": "Effects of sildenafil on the relaxation of human corpus cavernosum tissue in vitro and on the activities of cyclic nucleotide phosphodiesterase isozymes.", "journal": "The Journal of urology", "date": "1998", "authors": "Ballard SA, Gingell CJ, Tang K, Turner LA, Price ME, Naylor AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "9598563", "url": "https://glygen.org/publication/PubMed/9598563" } ] }, { "title": "Sildenafil, a novel inhibitor of phosphodiesterase type 5 in human corpus cavernosum smooth muscle cells.", "journal": "Life sciences", "date": "1998", "authors": "Moreland RB, Goldstein I, Traish A", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "9600334", "url": "https://glygen.org/publication/PubMed/9600334" } ] }, { "title": "YC-1 potentiates nitric oxide- and carbon monoxide-induced cyclic GMP effects in human platelets.", "journal": "Molecular pharmacology", "date": "1998", "authors": "Friebe A, Mullershausen F, Smolenski A, Walter U, Schultz G, Koesling D", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "9855623", "url": "https://glygen.org/publication/PubMed/9855623" } ] }, { "title": "The crystal structure of a complex of p11 with the annexin II N-terminal peptide.", "journal": "Nature structural biology", "date": "1999", "authors": "Rety S, Sopkova J, Renouard M, Osterloh D, Gerke V, Tabaries S, Russo-Marie F, Lewit-Bentley A", "evidence": [ { "database": "Reactome", "id": "R-HSA-75205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205" } ], "reference": [ { "type": "PubMed", "id": "9886297", "url": "https://glygen.org/publication/PubMed/9886297" } ] } ], "pathway": [ { "id": "hsa:302", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:302", "resource": "KEGG Pathway" }, { "id": "R-HSA-445355", "name": "Smooth Muscle Contraction", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355", "resource": "Reactome", "description": "Smooth Muscle Contraction" }, { "id": "R-HSA-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-HSA-75205", "name": "Dissolution of Fibrin Clot", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75205", "resource": "Reactome", "description": "Dissolution of Fibrin Clot" }, { "id": "R-HSA-8950505", "name": "Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8950505", "resource": "Reactome", "description": "Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation" } ], "orthologs": [ { "uniprot_canonical_ac": "P07356-1", "protein_name": "Annexin A2", "gene_name": "Anxa2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSTVHEILCKLSLEGDHSTPPSAYGSVKPYTNFDAERDALNIETAVKTKGVDEVTIVNILTNRSNVQRQDIAFAYQRRTKKELPSALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARELYDAGVKRKGTDVPKWISIMTERSVCHLQKVFERYKSYSPYDMLESIKKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD", "length": 339 }, "evidence": [ { "id": "45917858", "url": "http://www.informatics.jax.org/homology/45917858", "database": "MGI" }, { "id": "P07355", "url": "https://omabrowser.org/oma/group/P07355/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q07936-1", "protein_name": "Annexin A2", "gene_name": "Anxa2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSTVHEILCKLSLEGDHSTPPSAYGSVKPYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELPSAMKSALSGHLETVMLGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGEFRKLLVALAKGKRAEDGSVIDYELIDQDARELYDAGVKRKGTDVPKWISIMTERSVCHLQKVFERYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYFIQQDTKGDYQKALLYLCGGDD", "length": 339 }, "evidence": [ { "id": "45917858", "url": "http://www.informatics.jax.org/homology/45917858", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 31, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "basement membrane", "id": "GO:0005604", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005604", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "endosome", "id": "GO:0005768", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005768", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "early endosome", "id": "GO:0005769", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005769", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "lipid droplet", "id": "GO:0005811", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005811", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "adherens junction", "id": "GO:0005912", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005912", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "basolateral plasma membrane", "id": "GO:0016323", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016323", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "lysosomal membrane", "id": "GO:0005765", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005765", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "late endosome membrane", "id": "GO:0031902", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031902", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "azurophil granule lumen", "id": "GO:0035578", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035578", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "melanosome", "id": "GO:0042470", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042470", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "nuclear matrix", "id": "GO:0016363", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016363", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "vesicle", "id": "GO:0031982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031982", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "sarcolemma", "id": "GO:0042383", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042383", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "midbody", "id": "GO:0030496", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030496", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "myelin sheath adaxonal region", "id": "GO:0035749", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035749", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "Schmidt-Lanterman incisure", "id": "GO:0043220", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043220", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "PCSK9-AnxA2 complex", "id": "GO:1990667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990667", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "cornified envelope", "id": "GO:0001533", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001533", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "RNA polymerase II transcription regulator complex", "id": "GO:0090575", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090575", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "plasma membrane protein complex", "id": "GO:0098797", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098797", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "collagen-containing extracellular matrix", "id": "GO:0062023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062023", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "AnxA2-p11 complex", "id": "GO:1990665", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990665", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 16, "go_terms": [ { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "cytoskeletal protein binding", "id": "GO:0008092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008092", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "calcium-dependent phospholipid binding", "id": "GO:0005544", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005544", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "phospholipase inhibitor activity", "id": "GO:0004859", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004859", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "protease binding", "id": "GO:0002020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002020", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "serine-type endopeptidase inhibitor activity", "id": "GO:0004867", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004867", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "calcium channel activity", "id": "GO:0005262", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005262", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "phosphatidylinositol-4,5-bisphosphate binding", "id": "GO:0005546", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005546", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "calcium-dependent protein binding", "id": "GO:0048306", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048306", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "phospholipase A2 inhibitor activity", "id": "GO:0019834", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019834", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "S100 protein binding", "id": "GO:0044548", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044548", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "cadherin binding involved in cell-cell adhesion", "id": "GO:0098641", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098641", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "phosphatidylserine binding", "id": "GO:0001786", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001786", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "virion binding", "id": "GO:0046790", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046790", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 21, "go_terms": [ { "name": "positive regulation of plasminogen activation", "id": "GO:0010756", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010756", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "angiogenesis", "id": "GO:0001525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001525", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "collagen fibril organization", "id": "GO:0030199", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030199", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "fibrinolysis", "id": "GO:0042730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042730", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "membrane raft assembly", "id": "GO:0001765", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001765", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "positive regulation of receptor recycling", "id": "GO:0001921", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001921", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "vesicle budding from membrane", "id": "GO:0006900", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006900", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "positive regulation of vesicle fusion", "id": "GO:0031340", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031340", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "negative regulation of low-density lipoprotein particle receptor catabolic process", "id": "GO:0032804", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032804", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "osteoclast development", "id": "GO:0036035", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036035", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "positive regulation of vacuole organization", "id": "GO:0044090", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044090", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "positive regulation of low-density lipoprotein particle clearance", "id": "GO:1905581", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905581", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "positive regulation of low-density lipoprotein particle receptor binding", "id": "GO:1905597", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905597", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "positive regulation of low-density lipoprotein receptor activity", "id": "GO:1905599", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905599", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "positive regulation of receptor-mediated endocytosis involved in cholesterol transport", "id": "GO:1905602", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905602", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "negative regulation of receptor internalization", "id": "GO:0002091", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002091", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "mRNA transcription by RNA polymerase II", "id": "GO:0042789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042789", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "regulation of neurogenesis", "id": "GO:0050767", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050767", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "positive regulation of exocytosis", "id": "GO:0045921", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045921", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" }, { "name": "positive regulation of plasma membrane repair", "id": "GO:1905686", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905686", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 62, "end_pos": 64, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "ISGylated.", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" }, { "database": "PubMed", "id": "16139798", "url": "https://glygen.org/publication/PubMed/16139798" } ] }, { "annotation": "Phosphorylation of Tyr-24 enhances heat stress-induced translocation to the cell surface.", "evidence": [ { "database": "UniProtKB", "id": "P07355", "url": "https://www.uniprot.org/uniprot/P07355" }, { "database": "PubMed", "id": "15302870", "url": "https://glygen.org/publication/PubMed/15302870" }, { "database": "PubMed", "id": "2946940", "url": "https://glygen.org/publication/PubMed/2946940" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 2, 153 ], "snv_sites": [ 153 ], "glycation_sites": [], "phosphorylation_sites": [ 2, 3, 12, 18, 19, 22, 24, 26, 30, 75, 123, 127, 147, 153, 184, 188, 199, 238, 316, 317, 318 ], "sequon_annotation_sites": [ { "start_pos": 62, "end_pos": 64 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 25 }, { "field": "total_sites", "count": 21 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 127 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }