{
    "uniprot_canonical_ac": "P07333-1",
    "uniprot_ac": "P07333",
    "uniprot_id": "CSF1R_HUMAN",
    "mass": {
        "chemical_mass": 107984.0,
        "monoisotopic_mass": 107984.0
    },
    "refseq": {
        "ac": "NP_001275634",
        "name": "macrophage colony-stimulating factor 1 receptor isoform a precursor",
        "summary": "The protein encoded by this gene is the receptor for colony stimulating factor 1, a cytokine which controls the production, differentiation, and function of macrophages. This receptor mediates most if not all of the biological effects of this cytokine. Ligand binding activates the receptor kinase through a process of oligomerization and transphosphorylation. The encoded protein is a tyrosine kinase transmembrane receptor and member of the CSF1/PDGF receptor family of tyrosine-protein kinases. Mutations in this gene have been associated with a predisposition to myeloid malignancy. The first intron of this gene contains a transcriptionally inactive ribosomal protein L7 processed pseudogene oriented in the opposite direction. Alternative splicing results in multiple transcript variants. Expression of a splice variant from an LTR promoter has been found in Hodgkin lymphoma (HL), HL cell lines and anaplastic large cell lymphoma. [provided by RefSeq, Mar 2017].",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001275634"
    },
    "gene_names": [
        {
            "name": "CSF1R",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/P07333",
            "id": "P07333"
        },
        {
            "name": "BANDDOS; C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; GPSC; HDLS; HDLS1; M-CSF-R",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001275634",
            "id": "NP_001275634"
        },
        {
            "name": "CSF1R",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001275634",
            "id": "NP_001275634"
        },
        {
            "name": "FMS",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/P07333",
            "id": "P07333"
        }
    ],
    "protein_names": [
        {
            "name": "Macrophage colony-stimulating factor 1 receptor",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "P07333"
        },
        {
            "name": "2.7.10.1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P07333"
        },
        {
            "name": "CSF-1 receptor",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P07333"
        },
        {
            "name": "CSF-1-R",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P07333"
        },
        {
            "name": "CSF-1R",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P07333"
        },
        {
            "name": "M-CSF-R",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P07333"
        },
        {
            "name": "McDonough feline sarcoma viral (v-fms) oncogene homolog; CD115 antigen; FMS proto-oncogene; macrophage colony stimulating factor I receptor; CSF-1 receptor; proto-oncogene c-Fms",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001275634",
            "id": "NP_001275634"
        },
        {
            "name": "Proto-oncogene c-Fms",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P07333"
        },
        {
            "name": "macrophage colony-stimulating factor 1 receptor isoform a precursor",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001275634",
            "id": "NP_001275634"
        }
    ],
    "function": [
        {
            "annotation": "CSF1R regulates schizophrenia-related stress response and vascular association of microglia/macrophages. Publication Status: Online-Only",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001275634",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001275634"
                },
                {
                    "database": "PubMed",
                    "id": "37542262",
                    "url": "https://glygen.org/publication/PubMed/37542262"
                }
            ]
        },
        {
            "annotation": "CSF1R-dependent macrophages in the salivary gland are essential for epithelial regeneration after radiation-induced injury.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001275634",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001275634"
                },
                {
                    "database": "PubMed",
                    "id": "37922341",
                    "url": "https://glygen.org/publication/PubMed/37922341"
                }
            ]
        },
        {
            "annotation": "The protein encoded by this gene is the receptor for colony stimulating factor 1, a cytokine which controls the production, differentiation, and function of macrophages. This receptor mediates most if not all of the biological effects of this cytokine. Ligand binding activates the receptor kinase through a process of oligomerization and transphosphorylation. The encoded protein is a tyrosine kinase transmembrane receptor and member of the CSF1/PDGF receptor family of tyrosine-protein kinases. Mutations in this gene have been associated with a predisposition to myeloid malignancy. The first intron of this gene contains a transcriptionally inactive ribosomal protein L7 processed pseudogene oriented in the opposite direction. Alternative splicing results in multiple transcript variants. Expression of a splice variant from an LTR promoter has been found in Hodgkin lymphoma (HL), HL cell lines and anaplastic large cell lymphoma. [provided by RefSeq, Mar 2017].",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001275634",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001275634"
                }
            ]
        },
        {
            "annotation": "The role of CD14 and CSF1R in osteoarthritis and gastritis.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001275634",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001275634"
                },
                {
                    "database": "PubMed",
                    "id": "37904379",
                    "url": "https://glygen.org/publication/PubMed/37904379"
                }
            ]
        },
        {
            "annotation": "Tyrosine-protein kinase that acts as a cell-surface receptor for CSF1 and IL34 and plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of pro-inflammatory chemokines in response to IL34 and CSF1, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone and tooth development. Required for normal male and female fertility, and for normal development of milk ducts and acinar structures in the mammary gland during pregnancy. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration, and promotes cancer cell invasion. Activates several signaling pathways in response to ligand binding, including the ERK1/2 and the JNK pathway (PubMed:20504948, PubMed:30982609). Phosphorylates PIK3R1, PLCG2, GRB2, SLA2 and CBL. Activation of PLCG2 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate, that then lead to the activation of protein kinase C family members, especially PRKCD. Phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, leads to activation of the AKT1 signaling pathway. Activated CSF1R also mediates activation of the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1, and of the SRC family kinases SRC, FYN and YES1. Activated CSF1R transmits signals both via proteins that directly interact with phosphorylated tyrosine residues in its intracellular domain, or via adapter proteins, such as GRB2. Promotes activation of STAT family members STAT3, STAT5A and/or STAT5B. Promotes tyrosine phosphorylation of SHC1 and INPP5D/SHIP-1. Receptor signaling is down-regulated by protein phosphatases, such as INPP5D/SHIP-1, that dephosphorylate the receptor and its downstream effectors, and by rapid internalization of the activated receptor. In the central nervous system, may play a role in the development of microglia macrophages (PubMed:30982608).",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333#function"
                },
                {
                    "database": "PubMed",
                    "id": "19193011",
                    "url": "https://glygen.org/publication/PubMed/19193011"
                },
                {
                    "database": "PubMed",
                    "id": "18467591",
                    "url": "https://glygen.org/publication/PubMed/18467591"
                },
                {
                    "database": "PubMed",
                    "id": "20489731",
                    "url": "https://glygen.org/publication/PubMed/20489731"
                },
                {
                    "database": "PubMed",
                    "id": "18814279",
                    "url": "https://glygen.org/publication/PubMed/18814279"
                },
                {
                    "database": "PubMed",
                    "id": "20504948",
                    "url": "https://glygen.org/publication/PubMed/20504948"
                },
                {
                    "database": "PubMed",
                    "id": "7683918",
                    "url": "https://glygen.org/publication/PubMed/7683918"
                },
                {
                    "database": "PubMed",
                    "id": "16170366",
                    "url": "https://glygen.org/publication/PubMed/16170366"
                },
                {
                    "database": "PubMed",
                    "id": "15117969",
                    "url": "https://glygen.org/publication/PubMed/15117969"
                },
                {
                    "database": "PubMed",
                    "id": "20829061",
                    "url": "https://glygen.org/publication/PubMed/20829061"
                },
                {
                    "database": "PubMed",
                    "id": "16337366",
                    "url": "https://glygen.org/publication/PubMed/16337366"
                },
                {
                    "database": "PubMed",
                    "id": "19934330",
                    "url": "https://glygen.org/publication/PubMed/19934330"
                },
                {
                    "database": "PubMed",
                    "id": "12882960",
                    "url": "https://glygen.org/publication/PubMed/12882960"
                },
                {
                    "database": "PubMed",
                    "id": "30982608",
                    "url": "https://glygen.org/publication/PubMed/30982608"
                },
                {
                    "database": "PubMed",
                    "id": "30982609",
                    "url": "https://glygen.org/publication/PubMed/30982609"
                },
                {
                    "database": "PubMed",
                    "id": "16648572",
                    "url": "https://glygen.org/publication/PubMed/16648572"
                },
                {
                    "database": "PubMed",
                    "id": "17121910",
                    "url": "https://glygen.org/publication/PubMed/17121910"
                }
            ]
        },
        {
            "annotation": "Upregulation of APAF1 and CSF1R in Peripheral Blood Mononuclear Cells of Parkinson's Disease. Publication Status: Online-Only",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001275634",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001275634"
                },
                {
                    "database": "PubMed",
                    "id": "37108258",
                    "url": "https://glygen.org/publication/PubMed/37108258"
                }
            ]
        }
    ],
    "disease": [
        {
            "disease_id": "DOID:0080523",
            "recommended_name": {
                "id": "DOID:0080523",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:0080523",
                "name": "adult-onset leukoencephalopathy with axonal spheroids and pigmented glia",
                "description": "A leukodystrophy that is characterized by progressive dementia, apraxia, apathy, impaired balance, parkinsonism, spasticity and epilepsy and has_material_basis_in heterozygous mutation in the CSF1R gene on chromosome 5q32."
            },
            "synonyms": [
                {
                    "id": "DOID:0080523",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0080523",
                    "name": "hereditary diffuse leukoencephalopathy with spheroids",
                    "description": ""
                },
                {
                    "id": "MONDO:0800027",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0800027",
                    "name": "leukoencephalopathy, diffuse hereditary, with spheroids 1",
                    "description": "A rare autosomal dominant disease characterized by a complex phenotype including progressive dementia, apraxia, apathy, impaired balance, parkinsonism, spasticity and epilepsy."
                },
                {
                    "id": "MONDO:0800027",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0800027",
                    "name": "HDLS",
                    "description": ""
                },
                {
                    "id": "MONDO:0800027",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0800027",
                    "name": "hereditary diffuse leukoencephalopathy with spheroids",
                    "description": ""
                },
                {
                    "id": "MONDO:0800027",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0800027",
                    "name": "leukoencephalopathy, diffuse hereditary, with spheroids",
                    "description": ""
                },
                {
                    "id": "MONDO:0800027",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0800027",
                    "name": "leukoencephalopathy, hereditary diffuse, with spheroids",
                    "description": ""
                },
                {
                    "id": "MONDO:0800027",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0800027",
                    "name": "ALSP",
                    "description": ""
                },
                {
                    "id": "MONDO:0800027",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0800027",
                    "name": "FPSG",
                    "description": ""
                },
                {
                    "id": "MONDO:0800027",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0800027",
                    "name": "GPSC",
                    "description": ""
                },
                {
                    "id": "MONDO:0800027",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0800027",
                    "name": "POLD",
                    "description": ""
                },
                {
                    "id": "MONDO:0800027",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0800027",
                    "name": "adult-onset leukoencephalopathy with axonal spheroids and pigmented glia",
                    "description": ""
                },
                {
                    "id": "MONDO:0800027",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0800027",
                    "name": "autosomal dominant leukoencephalopathy with neuroaxonal spheroids",
                    "description": ""
                },
                {
                    "id": "MONDO:0800027",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0800027",
                    "name": "dementia, familial, Neumann type",
                    "description": ""
                },
                {
                    "id": "MONDO:0800027",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0800027",
                    "name": "familial dementia, Neumann type",
                    "description": ""
                },
                {
                    "id": "MONDO:0800027",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0800027",
                    "name": "familial progressive subcortical gliosis",
                    "description": ""
                },
                {
                    "id": "MONDO:0800027",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0800027",
                    "name": "gliosis, familial progressive subcortical",
                    "description": ""
                },
                {
                    "id": "MONDO:0800027",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0800027",
                    "name": "leukoencephalopathy with neuroaxonal spheroids, autosomal dominant",
                    "description": ""
                },
                {
                    "id": "MONDO:0800027",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0800027",
                    "name": "leukoencephalopathy, adult-onset, with axonal spheroids and pigmented glia",
                    "description": ""
                },
                {
                    "id": "MONDO:0800027",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0800027",
                    "name": "pigmentary orthochromatic leukodystrophy",
                    "description": ""
                },
                {
                    "id": "MONDO:0800027",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0800027",
                    "name": "subcortical gliosis of Neumann",
                    "description": ""
                },
                {
                    "id": "MONDO:0800027",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0800027",
                    "name": "adult-onset leukodystrophy with neuroaxonal spheroids",
                    "description": ""
                },
                {
                    "id": "MONDO:0800027",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0800027",
                    "name": "hereditary diffuse leukoencephalopathy with axonal spheroids",
                    "description": ""
                },
                {
                    "id": "MONDO:0800027",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0800027",
                    "name": "neuroaxonal leukodystrophy",
                    "description": ""
                },
                {
                    "id": "MIM:221820",
                    "resource": "MIM",
                    "url": "https://www.omim.org/entry/221820",
                    "name": "Leukoencephalopathy, hereditary diffuse, with spheroids 1",
                    "description": "Leukoencephalopathy, hereditary diffuse, with spheroids 1"
                }
            ],
            "evidence": [
                {
                    "id": "221820",
                    "database": "MIM",
                    "url": "https://www.omim.org/entry/221820"
                }
            ]
        },
        {
            "disease_id": "MONDO:0032772",
            "recommended_name": {
                "id": "MONDO:0032772",
                "resource": "MONDO",
                "url": "https://monarchinitiative.org/disease/MONDO:0032772",
                "name": "brain abnormalities, neurodegeneration, and dysosteosclerosis",
                "description": ""
            },
            "synonyms": [
                {
                    "id": "MONDO:0032772",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0032772",
                    "name": "BANDDOS",
                    "description": ""
                },
                {
                    "id": "MONDO:0032772",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0032772",
                    "name": "BRAIN ABNORMALITIES, NEURODEGENERATION, AND DYSOSTEOSCLEROSIS",
                    "description": ""
                },
                {
                    "id": "MIM:618476",
                    "resource": "MIM",
                    "url": "https://www.omim.org/entry/618476",
                    "name": "Brain abnormalities, neurodegeneration, and dysosteosclerosis",
                    "description": "Brain abnormalities, neurodegeneration, and dysosteosclerosis"
                }
            ],
            "evidence": [
                {
                    "id": "618476",
                    "database": "MIM",
                    "url": "https://www.omim.org/entry/618476"
                }
            ]
        }
    ],
    "snv": [
        {
            "evidence": [
                {
                    "id": "rs144404275",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs144404275"
                },
                {
                    "id": "rs144404275",
                    "database": "1000Genomes",
                    "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs144404275"
                },
                {
                    "id": "rs144404275",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs144404275"
                },
                {
                    "id": "rs144404275",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs144404275#frequency_tab"
                },
                {
                    "id": "rs144404275",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs144404275"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 153,
            "end_pos": 153,
            "sequence_org": "N",
            "sequence_mut": "H",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->HYS).",
            "chr_id": "5",
            "chr_pos": "150080187",
            "ref_nt": "G",
            "alt_nt": "null",
            "minor_allelic_frequency": "0.001398",
            "site_lbl": "N153",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs901809745",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs901809745"
                },
                {
                    "id": "rs901809745",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs901809745"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 153,
            "end_pos": 153,
            "sequence_org": "N",
            "sequence_mut": "S",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->SYS).",
            "chr_id": "5",
            "chr_pos": "150080186",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N153",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs746693381",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746693381"
                },
                {
                    "id": "rs746693381",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746693381"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 240,
            "end_pos": 240,
            "sequence_org": "N",
            "sequence_mut": "D",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->DNT).",
            "chr_id": "5",
            "chr_pos": "150078123",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N240",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs754023795",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754023795"
                },
                {
                    "id": "rs754023795",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754023795"
                },
                {
                    "id": "rs754023795",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs754023795"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 240,
            "end_pos": 240,
            "sequence_org": "N",
            "sequence_mut": "K",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->KNT).",
            "chr_id": "5",
            "chr_pos": "150078121",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N240",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1297158711",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1297158711"
                },
                {
                    "id": "rs1297158711",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs1297158711"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 242,
            "end_pos": 242,
            "sequence_org": "T",
            "sequence_mut": "A",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->NNA).",
            "chr_id": "5",
            "chr_pos": "150078117",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "T242",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1462650029",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1462650029"
                },
                {
                    "id": "rs1462650029",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs1462650029"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 310,
            "end_pos": 310,
            "sequence_org": "I",
            "sequence_mut": "S",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NLI->NLS).",
            "chr_id": "5",
            "chr_pos": "150073454",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "I310",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs747430864",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747430864"
                },
                {
                    "id": "rs747430864",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747430864"
                },
                {
                    "id": "rs747430864",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs747430864"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 337,
            "end_pos": 337,
            "sequence_org": "T",
            "sequence_mut": "I",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->NWI).",
            "chr_id": "5",
            "chr_pos": "150073373",
            "ref_nt": "A",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "T337",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs752528521",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752528521"
                },
                {
                    "id": "rs752528521",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752528521"
                },
                {
                    "id": "rs752528521",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs752528521"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 355,
            "end_pos": 355,
            "sequence_org": "T",
            "sequence_mut": "N",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->NAN).",
            "chr_id": "5",
            "chr_pos": "150073319",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "T355",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1341604312",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1341604312"
                },
                {
                    "id": "rs1341604312",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs1341604312#frequency_tab"
                },
                {
                    "id": "rs1341604312",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs1341604312"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain",
                "o-glyco-site-loss"
            ],
            "start_pos": 363,
            "end_pos": 363,
            "sequence_org": "T",
            "sequence_mut": "N",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TFT->NFT).",
            "chr_id": "5",
            "chr_pos": "150070566",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "T363",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs149753251",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149753251"
                },
                {
                    "id": "rs149753251",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149753251"
                },
                {
                    "id": "rs149753251",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs149753251#frequency_tab"
                },
                {
                    "id": "rs149753251",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs149753251"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 414,
            "end_pos": 414,
            "sequence_org": "S",
            "sequence_mut": "C",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->NGC).",
            "chr_id": "5",
            "chr_pos": "150070260",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "S414",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs149753251",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149753251"
                },
                {
                    "id": "rs149753251",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149753251"
                },
                {
                    "id": "rs149753251",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs149753251#frequency_tab"
                },
                {
                    "id": "rs149753251",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs149753251"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 414,
            "end_pos": 414,
            "sequence_org": "S",
            "sequence_mut": "F",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->NGF).",
            "chr_id": "5",
            "chr_pos": "150070260",
            "ref_nt": "A",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "S414",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs766613030",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766613030"
                },
                {
                    "id": "rs766613030",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766613030"
                },
                {
                    "id": "rs766613030",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs766613030"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 414,
            "end_pos": 414,
            "sequence_org": "S",
            "sequence_mut": "P",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->NGP).",
            "chr_id": "5",
            "chr_pos": "150070261",
            "ref_nt": "G",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "S414",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs545534658",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs545534658"
                },
                {
                    "id": "rs545534658",
                    "database": "1000Genomes",
                    "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs545534658"
                },
                {
                    "id": "rs545534658",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs545534658"
                },
                {
                    "id": "rs545534658",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs545534658#frequency_tab"
                },
                {
                    "id": "rs545534658",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs545534658"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 428,
            "end_pos": 428,
            "sequence_org": "N",
            "sequence_mut": "K",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->KVT).",
            "chr_id": "5",
            "chr_pos": "150070217",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "0.0002",
            "site_lbl": "N428",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs140815605",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs140815605"
                },
                {
                    "id": "rs140815605",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs140815605"
                },
                {
                    "id": "rs140815605",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs140815605#frequency_tab"
                },
                {
                    "id": "rs140815605",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs140815605"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 428,
            "end_pos": 428,
            "sequence_org": "N",
            "sequence_mut": "S",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).",
            "chr_id": "5",
            "chr_pos": "150070218",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N428",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs774944970",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774944970"
                },
                {
                    "id": "rs774944970",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774944970"
                },
                {
                    "id": "rs774944970",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs774944970"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 47,
            "end_pos": 47,
            "sequence_org": "S",
            "sequence_mut": "G",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->NGG).",
            "chr_id": "5",
            "chr_pos": "150080935",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "S47",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs774848316",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774848316"
                },
                {
                    "id": "rs774848316",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774848316"
                },
                {
                    "id": "rs774848316",
                    "database": "NCI-TCGA",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774848316"
                },
                {
                    "id": "rs774848316",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs774848316"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain",
                "o-glyco-site-loss"
            ],
            "start_pos": 731,
            "end_pos": 731,
            "sequence_org": "T",
            "sequence_mut": "N",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TSS->NSS).",
            "chr_id": "5",
            "chr_pos": "150057533",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "T731",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1351811725",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1351811725"
                },
                {
                    "id": "rs1351811725",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs1351811725"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 73,
            "end_pos": 73,
            "sequence_org": "N",
            "sequence_mut": "D",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->DAT).",
            "chr_id": "5",
            "chr_pos": "150080857",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N73",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs756076440",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756076440"
                },
                {
                    "id": "rs756076440",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756076440"
                },
                {
                    "id": "rs756076440",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs756076440#frequency_tab"
                },
                {
                    "id": "rs756076440",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs756076440"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 74,
            "end_pos": 74,
            "sequence_org": "A",
            "sequence_mut": "T",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NNA->NNT).",
            "chr_id": "5",
            "chr_pos": "150080854",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "A74",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1325333723",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1325333723"
                },
                {
                    "id": "rs1325333723",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs1325333723#frequency_tab"
                },
                {
                    "id": "rs1325333723",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs1325333723"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 75,
            "end_pos": 75,
            "sequence_org": "T",
            "sequence_mut": "A",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->NAA).",
            "chr_id": "5",
            "chr_pos": "150080851",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "T75",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs748096324",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748096324"
                },
                {
                    "id": "rs748096324",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748096324"
                },
                {
                    "id": "rs748096324",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs748096324#frequency_tab"
                },
                {
                    "id": "rs748096324",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs748096324"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 75,
            "end_pos": 75,
            "sequence_org": "T",
            "sequence_mut": "I",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->NAI).",
            "chr_id": "5",
            "chr_pos": "150080850",
            "ref_nt": "A",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "T75",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1157519987",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1157519987"
                },
                {
                    "id": "rs1157519987",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs1157519987"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 807,
            "end_pos": 807,
            "sequence_org": "S",
            "sequence_mut": "C",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->NDC).",
            "chr_id": "5",
            "chr_pos": "150056241",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "S807",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs757426806",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757426806"
                },
                {
                    "id": "rs757426806",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757426806"
                },
                {
                    "id": "rs757426806",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs757426806"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain",
                "o-glyco-site-loss"
            ],
            "start_pos": 928,
            "end_pos": 928,
            "sequence_org": "S",
            "sequence_mut": "N",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SSS->NSS).",
            "chr_id": "5",
            "chr_pos": "150054205",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "S928",
            "keywords": [
                "ebi",
                "germline"
            ]
        }
    ],
    "mutagenesis": [
        {
            "start_pos": 301,
            "end_pos": 301,
            "sequence_org": "L",
            "sequence_mut": "S",
            "comment": "Constitutive kinase activity.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                },
                {
                    "database": "PubMed",
                    "id": "15117969",
                    "url": "https://glygen.org/publication/PubMed/15117969"
                }
            ]
        },
        {
            "start_pos": 708,
            "end_pos": 708,
            "sequence_org": "Y",
            "sequence_mut": "F",
            "comment": "Impairs degradation of activated CSF1R.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                },
                {
                    "database": "PubMed",
                    "id": "10340379",
                    "url": "https://glygen.org/publication/PubMed/10340379"
                }
            ]
        },
        {
            "start_pos": 802,
            "end_pos": 802,
            "sequence_org": "D",
            "sequence_mut": "V",
            "comment": "Constitutive kinase activity. Loss of inhibition by imatinib.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                },
                {
                    "database": "PubMed",
                    "id": "16170366",
                    "url": "https://glygen.org/publication/PubMed/16170366"
                },
                {
                    "database": "PubMed",
                    "id": "10340379",
                    "url": "https://glygen.org/publication/PubMed/10340379"
                }
            ]
        },
        {
            "start_pos": 809,
            "end_pos": 809,
            "sequence_org": "Y",
            "sequence_mut": "F",
            "comment": "Reduced kinase activity. Reduced interaction with SRC, FYN and YES1.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                },
                {
                    "database": "PubMed",
                    "id": "7681396",
                    "url": "https://glygen.org/publication/PubMed/7681396"
                }
            ]
        },
        {
            "start_pos": 969,
            "end_pos": 969,
            "sequence_org": "Y",
            "sequence_mut": "F",
            "comment": "Abolishes down-regulation of activated CSF1R.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                },
                {
                    "database": "PubMed",
                    "id": "15117969",
                    "url": "https://glygen.org/publication/PubMed/15117969"
                }
            ]
        }
    ],
    "expression_tissue": [
        {
            "tissue": {
                "name": "Adult mammalian kidney",
                "namespace": "UBERON",
                "id": "0000082",
                "url": "http://purl.obolibrary.org/obo/UBERON_0000082"
            },
            "score": "71.62",
            "present": "MEDIUM",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000182578",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182578"
                }
            ]
        },
        {
            "tissue": {
                "name": "Oral cavity",
                "namespace": "UBERON",
                "id": "0000167",
                "url": "http://purl.obolibrary.org/obo/UBERON_0000167"
            },
            "score": "78.06",
            "present": "MEDIUM",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000182578",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182578"
                }
            ]
        },
        {
            "tissue": {
                "name": "Stomach",
                "namespace": "UBERON",
                "id": "0000945",
                "url": "http://purl.obolibrary.org/obo/UBERON_0000945"
            },
            "score": "87.19",
            "present": "HIGH",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000182578",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182578"
                }
            ]
        },
        {
            "tissue": {
                "name": "Uterus",
                "namespace": "UBERON",
                "id": "0000995",
                "url": "http://purl.obolibrary.org/obo/UBERON_0000995"
            },
            "score": "71.58",
            "present": "MEDIUM",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000182578",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182578"
                }
            ]
        },
        {
            "tissue": {
                "name": "Esophagus",
                "namespace": "UBERON",
                "id": "0001043",
                "url": "http://purl.obolibrary.org/obo/UBERON_0001043"
            },
            "score": "94.98",
            "present": "HIGH",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000182578",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182578"
                }
            ]
        },
        {
            "tissue": {
                "name": "Rectum",
                "namespace": "UBERON",
                "id": "0001052",
                "url": "http://purl.obolibrary.org/obo/UBERON_0001052"
            },
            "score": "90.06",
            "present": "HIGH",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000182578",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182578"
                }
            ]
        },
        {
            "tissue": {
                "name": "Colon",
                "namespace": "UBERON",
                "id": "0001155",
                "url": "http://purl.obolibrary.org/obo/UBERON_0001155"
            },
            "score": "69.31",
            "present": "MEDIUM",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000182578",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182578"
                }
            ]
        },
        {
            "tissue": {
                "name": "Urinary bladder",
                "namespace": "UBERON",
                "id": "0001255",
                "url": "http://purl.obolibrary.org/obo/UBERON_0001255"
            },
            "score": "82",
            "present": "HIGH",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000182578",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182578"
                }
            ]
        },
        {
            "tissue": {
                "name": "Thyroid gland",
                "namespace": "UBERON",
                "id": "0002046",
                "url": "http://purl.obolibrary.org/obo/UBERON_0002046"
            },
            "score": "72.86",
            "present": "MEDIUM",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000182578",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182578"
                }
            ]
        },
        {
            "tissue": {
                "name": "Lung",
                "namespace": "UBERON",
                "id": "0002048",
                "url": "http://purl.obolibrary.org/obo/UBERON_0002048"
            },
            "score": "75.12",
            "present": "MEDIUM",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000182578",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182578"
                }
            ]
        },
        {
            "tissue": {
                "name": "Liver",
                "namespace": "UBERON",
                "id": "0002107",
                "url": "http://purl.obolibrary.org/obo/UBERON_0002107"
            },
            "score": "82.89",
            "present": "HIGH",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000182578",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182578"
                }
            ]
        },
        {
            "tissue": {
                "name": "Prostate gland",
                "namespace": "UBERON",
                "id": "0002367",
                "url": "http://purl.obolibrary.org/obo/UBERON_0002367"
            },
            "score": "81.48",
            "present": "MEDIUM",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000182578",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182578"
                }
            ]
        },
        {
            "tissue": {
                "name": "Thoracic mammary gland",
                "namespace": "UBERON",
                "id": "0005200",
                "url": "http://purl.obolibrary.org/obo/UBERON_0005200"
            },
            "score": "83.43",
            "present": "HIGH",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000182578",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182578"
                }
            ]
        }
    ],
    "expression_disease": [
        {
            "significant": "Yes",
            "trend": "down",
            "name": "Prostate cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:10283",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P07333",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07333"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:10283",
                    "recommended_name": {
                        "id": "DOID:10283",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:10283",
                        "name": "prostate cancer",
                        "description": "A male reproductive organ cancer that is located_in the prostate."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "NGP - new growth of prostate",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "hereditary prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "malignant tumor of the prostate",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "prostate cancer, familial",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "prostate neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "prostatic cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "prostatic neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "tumor of the prostate",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012597",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012597",
                            "name": "prostate cancer, hereditary, 9",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012597",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012597",
                            "name": "prostate cancer, hereditary, 9",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012597",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012597",
                            "name": "prostate cancer, hereditary, type 9",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012597",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012597",
                            "name": "HPC9",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "prostate cancer, hereditary, 12",
                            "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "EHBP1 familial prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "familial prostate cancer caused by mutation in EHBP1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "prostate cancer, hereditary, 12",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "prostate cancer, hereditary, type 12",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "HPC12",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012244",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012244",
                            "name": "prostate cancer, hereditary, 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012244",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012244",
                            "name": "prostate cancer, hereditary, 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012244",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012244",
                            "name": "prostate cancer, hereditary, type 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012244",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012244",
                            "name": "HPC5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012093",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012093",
                            "name": "prostate cancer, hereditary, 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012093",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012093",
                            "name": "prostate cancer, hereditary, 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012093",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012093",
                            "name": "prostate cancer, hereditary, type 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012093",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012093",
                            "name": "prostate cancer, susceptibility to, 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012093",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012093",
                            "name": "HPC3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "prostate cancer, hereditary, 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "prostate cancer, hereditary, 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "prostate cancer, hereditary, type 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "prostate cancer, susceptibility to, 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "HPC4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "prostate cancer, hereditary, on chromosome 7",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "prostate cancer, hereditary, 13",
                            "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "MSMB familial prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "familial prostate cancer caused by mutation in MSMB",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "prostate cancer, hereditary, 13",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "prostate cancer, hereditary, type 13",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "HPC13",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "prostate cancer, hereditary, 8",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "prostate cancer, hereditary, 8",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "prostate cancer, hereditary, type 8",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "HPC8",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "predisposing for prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "prostate cancer, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012300",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012300",
                            "name": "prostate cancer, hereditary, 6",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012300",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012300",
                            "name": "prostate cancer, hereditary, 6",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012300",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012300",
                            "name": "prostate cancer, hereditary, type 6",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012300",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012300",
                            "name": "HPC6",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012300",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012300",
                            "name": "prostate cancer, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012620",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012620",
                            "name": "prostate cancer, hereditary, 10",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012620",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012620",
                            "name": "HPC10",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012620",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012620",
                            "name": "prostate cancer, hereditary, 10",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "familial prostate carcinoma",
                            "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "familial prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "hereditary prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "hereditary prostate carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, familial",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, hereditary",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012470",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012470",
                            "name": "prostate cancer, hereditary, 7",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012470",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012470",
                            "name": "HPC7",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012470",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012470",
                            "name": "prostate cancer, hereditary, 7",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012470",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012470",
                            "name": "prostate cancer aggressiveness",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "prostate cancer, hereditary, 1",
                            "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "RNASEL familial prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "familial prostate cancer caused by mutation in RNASEL",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "prostate cancer 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "prostate cancer, hereditary, 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "prostate cancer, hereditary, type 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "HPC1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "Prca1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012768",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012768",
                            "name": "prostate cancer, hereditary, 11",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012768",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012768",
                            "name": "HPC11",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012768",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012768",
                            "name": "prostate cancer, hereditary, 11",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012769",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012769",
                            "name": "prostate cancer, hereditary, 14",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012769",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012769",
                            "name": "HPC14",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012769",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012769",
                            "name": "prostate cancer, hereditary, 14",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012770",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012770",
                            "name": "prostate cancer, hereditary, 15",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012770",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012770",
                            "name": "HPC15",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012770",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012770",
                            "name": "prostate cancer, hereditary, 15",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010257",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010257",
                            "name": "prostate cancer, hereditary, X-linked 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010257",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010257",
                            "name": "HPCX1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010257",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010257",
                            "name": "prostate cancer, hereditary, X-linked 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010257",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010257",
                            "name": "prostate cancer susceptibility, X-linked",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010405",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010405",
                            "name": "prostate cancer, hereditary, X-linked 2",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010405",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010405",
                            "name": "HPCX2",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010405",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010405",
                            "name": "prostate cancer, hereditary, X-linked 2",
                            "description": ""
                        },
                        {
                            "id": "MIM:611868",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/611868",
                            "name": "Prostate cancer, hereditary, 12",
                            "description": "Prostate cancer, hereditary, 12"
                        },
                        {
                            "id": "MIM:611928",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/611928",
                            "name": "Prostate cancer, hereditary, 13",
                            "description": "Prostate cancer, hereditary, 13"
                        },
                        {
                            "id": "MIM:176807",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/176807",
                            "name": "Prostate cancer",
                            "description": "Prostate cancer"
                        },
                        {
                            "id": "MIM:601518",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/601518",
                            "name": "Prostate cancer, hereditary, 1",
                            "description": "Prostate cancer, hereditary, 1"
                        },
                        {
                            "id": "MIM:611955",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/611955",
                            "name": "Prostate cancer, hereditary, 11",
                            "description": "Prostate cancer, hereditary, 11"
                        }
                    ]
                }
            ]
        },
        {
            "significant": "No",
            "trend": "down",
            "name": "Stomach cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:10534",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P07333",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07333"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:10534",
                    "recommended_name": {
                        "id": "DOID:10534",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:10534",
                        "name": "stomach cancer",
                        "description": "A gastrointestinal system cancer that is located_in the stomach."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:10534",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10534",
                            "name": "gastric cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:10534",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10534",
                            "name": "gastric neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer",
                            "description": "A primary or metastatic malignant neoplasm involving the stomach."
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "Ca lesser curvature - stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "cancer of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer risk after h. pylori infection",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant gastric neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant gastric tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant gastric tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant neoplasm of lesser curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant neoplasm of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant neoplasm of the stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant stomach neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of body of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of greater curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of lesser curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of the stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of body of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of greater curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of lesser curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of the stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "stomach cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "Ca body - stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "ca greater curvature of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant neoplasm of body of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer, intestinal",
                            "description": ""
                        },
                        {
                            "id": "MIM:613659",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/613659",
                            "name": "Gastric cancer",
                            "description": "Gastric cancer"
                        }
                    ]
                }
            ]
        },
        {
            "significant": "No",
            "trend": "down",
            "name": "Urinary bladder cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:11054",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P07333",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07333"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:11054",
                    "recommended_name": {
                        "id": "DOID:11054",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:11054",
                        "name": "urinary bladder cancer",
                        "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:11054",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11054",
                            "name": "bladder cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:11054",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11054",
                            "name": "tumor of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder cancer",
                            "description": "A primary or metastatic malignant neoplasm involving the bladder."
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "tumor of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "tumour of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "bladder cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "cancer of urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant bladder neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant bladder tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant bladder tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm of bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm of the urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm of urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm, bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm, urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor of bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor of the urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor of urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor, urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumour of bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumour of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumour of the urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumour of urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant urinary bladder neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant urinary bladder tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant urinary bladder tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder malignant neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder malignant tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder malignant tumour",
                            "description": ""
                        },
                        {
                            "id": "MIM:109800",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/109800",
                            "name": "Bladder cancer",
                            "description": "Bladder cancer"
                        }
                    ]
                }
            ]
        },
        {
            "significant": "No",
            "trend": "up",
            "name": "Head and neck cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:11934",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P07333",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07333"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:11934",
                    "recommended_name": {
                        "id": "DOID:11934",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:11934",
                        "name": "head and neck cancer",
                        "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:11934",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11934",
                            "name": "head and neck neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:11934",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11934",
                            "name": "head and neck tumours",
                            "description": ""
                        },
                        {
                            "id": "DOID:11934",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11934",
                            "name": "head/neck neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:11934",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11934",
                            "name": "tumor of head and neck",
                            "description": ""
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "down",
            "name": "Lung cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:1324",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P07333",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07333"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:1324",
                    "recommended_name": {
                        "id": "DOID:1324",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:1324",
                        "name": "lung cancer",
                        "description": "A respiratory system cancer that is located_in the lung."
                    },
                    "synonyms": [
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "LNCR1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "lung cancer susceptibility 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "LNCR3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "lung cancer susceptibility 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "adenocarcinoma of lung, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "lung cancer susceptibility 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "LNCR4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "lung cancer susceptibility 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "lung cancer susceptibility 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "LNCR5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "lung cancer susceptibility 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer",
                            "description": "A malignant neoplasm involving the lung."
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "adenocarcinoma of lung, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "cancer of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, protection against, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant neoplasm of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant neoplasm of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumor of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumor of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumour of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumour of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "Nonsmall cell lung cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "alveolar cell carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, protection against",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MIM:211980",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/211980",
                            "name": "Lung cancer",
                            "description": "Lung cancer"
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "down",
            "name": "Breast cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:1612",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P07333",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07333"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:1612",
                    "recommended_name": {
                        "id": "DOID:1612",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:1612",
                        "name": "breast cancer",
                        "description": "A thoracic cancer that originates in the mammary gland."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "breast tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "malignant neoplasm of breast",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "malignant tumor of the breast",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "mammary cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "mammary tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "primary breast cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "hereditary breast carcinoma",
                            "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, lobular, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, protection against, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "familial breast cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "familial breast carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "familial cancer of breast",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "familial cancer of the breast",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "hereditary breast cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "hereditary breast carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, familial",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, familial Male",
                            "description": ""
                        },
                        {
                            "id": "MIM:114480",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/114480",
                            "name": "Breast cancer",
                            "description": "Breast cancer"
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "up",
            "name": "Thyroid cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:1781",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P07333",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07333"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:1781",
                    "recommended_name": {
                        "id": "DOID:1781",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:1781",
                        "name": "thyroid cancer",
                        "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:1781",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1781",
                            "name": "thyroid gland cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:1781",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1781",
                            "name": "Thyroid gland neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:1781",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1781",
                            "name": "malignant neoplasm of thyroid gland",
                            "description": ""
                        },
                        {
                            "id": "DOID:1781",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1781",
                            "name": "malignant tumour of thyroid gland",
                            "description": ""
                        },
                        {
                            "id": "DOID:1781",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1781",
                            "name": "neoplasm of thyroid gland",
                            "description": ""
                        },
                        {
                            "id": "DOID:1781",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1781",
                            "name": "thyroid neoplasm",
                            "description": ""
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "up",
            "name": "Kidney cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:263",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P07333",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07333"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:263",
                    "recommended_name": {
                        "id": "DOID:263",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:263",
                        "name": "kidney cancer",
                        "description": "A urinary system cancer that is located_in the kidney."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:263",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:263",
                            "name": "malignant neoplasm of kidney except pelvis",
                            "description": ""
                        },
                        {
                            "id": "DOID:263",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:263",
                            "name": "malignant tumour of kidney",
                            "description": ""
                        },
                        {
                            "id": "DOID:263",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:263",
                            "name": "renal cancer",
                            "description": ""
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "down",
            "name": "Liver cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:3571",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P07333",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07333"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:3571",
                    "recommended_name": {
                        "id": "DOID:3571",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:3571",
                        "name": "liver cancer",
                        "description": "A hepatobiliary system cancer that is located_in the liver."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "Ca liver - primary",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "Resectable malignant neoplasm of Liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "hepatic cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "hepatic neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "malignant hepato-biliary neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "malignant neoplasm of liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "malignant neoplasm of liver, primary",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "malignant tumor of liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "neoplasm of liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "non-resectable primary hepatic malignant neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "primary liver cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "primary malignant neoplasm of liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "resectable malignant neoplasm of the liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "malignant neoplasm of liver, not specified as primary or secondary",
                            "description": ""
                        }
                    ]
                }
            ]
        },
        {
            "significant": "No",
            "trend": "up",
            "name": "Uterine cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:363",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P07333",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07333"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:363",
                    "recommended_name": {
                        "id": "DOID:363",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:363",
                        "name": "uterine cancer",
                        "description": "A female reproductive organ cancer that is located_in the uterus."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "CA - cancer of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "Tumour of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "malignant neoplasm of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "malignant uterine tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "neoplasm of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "uterine tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "uterus neoplasm",
                            "description": ""
                        }
                    ]
                }
            ]
        },
        {
            "significant": "No",
            "trend": "down",
            "name": "Esophageal cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:5041",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P07333",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07333"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:5041",
                    "recommended_name": {
                        "id": "DOID:5041",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:5041",
                        "name": "esophageal cancer",
                        "description": "A gastrointestinal system cancer that is located_in the esophagus."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "Ca lower third oesophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "Ca middle third oesophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "esophagus cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant neoplasm of distal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant neoplasm of lower third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant neoplasm of middle third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant neoplasm of proximal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant neoplasm of upper third esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant tumor of Distal Third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant tumor of Proximal Third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant tumor of abdominal esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant tumor of the middle Third of the esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal cancer",
                            "description": "A primary or metastatic malignant neoplasm involving the esophagus."
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "cancer of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "cancer of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal carcinoma, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal squamous cell carcinoma, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophagus cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant esophageal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant esophageal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant esophageal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant esophagus neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant esophagus tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of the esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of the oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant oesophagus neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant oesophagus tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of the esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of the oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "oesophagus cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Ca lower third esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Ca lower third oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Ca middle third esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Ca middle third oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of distal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of distal third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of lower third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of lower third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of middle third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of middle third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of proximal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of proximal third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of upper third esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of upper third oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of abdominal esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of distal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of proximal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of the middle third of the esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of abdominal oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of distal third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of proximal third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of the middle third of the oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Aerodigestive tract cancer, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Escc, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal squamous cell carcinoma, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "gastric cardia adenocarcinoma, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MIM:133239",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/133239",
                            "name": "Esophageal cancer",
                            "description": "Esophageal cancer"
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "down",
            "name": "Colorectal cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:9256",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P07333",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07333"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:9256",
                    "recommended_name": {
                        "id": "DOID:9256",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9256",
                        "name": "colorectal cancer",
                        "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
                    },
                    "synonyms": [
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer",
                            "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of colorectum",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, advanced, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer with chromosomal instability, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectum cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectum neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of colorectum",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "CRC",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "large intestine cancer",
                            "description": ""
                        },
                        {
                            "id": "MIM:114500",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/114500",
                            "name": "Colorectal cancer",
                            "description": "Colorectal cancer"
                        }
                    ]
                }
            ]
        }
    ],
    "species": [
        {
            "name": "Homo sapiens",
            "taxid": 9606,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "common_name": "Human"
        }
    ],
    "gene": [
        {
            "name": "CSF1R",
            "url": "https://www.uniprot.org/uniprot/P07333",
            "locus": {
                "chromosome": "5",
                "start_pos": 150053291,
                "end_pos": 150113372,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSG00000182578",
                        "url": "https://www.ensembl.org/id/ENSG00000182578"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSG00000182578",
            "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182578",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "2.7.10.1",
            "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.7.10.1&UniProtAcc=P07333",
            "database": "BRENDA",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "cd00096",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00096",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "cd04975",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd04975",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "cd05106",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05106",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "cd20936",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20936",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "CHEMBL1844",
            "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1844",
            "database": "ChEMBL",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "CSF1R",
            "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CSF1R",
            "database": "GeneCards",
            "categories": [
                "Gene Annotation",
                "Organism-specific"
            ]
        },
        {
            "id": "1436",
            "url": "https://www.ncbi.nlm.nih.gov/gene/1436",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "1955",
            "url": "https://glyconnect.expasy.org/browser/proteins/1955",
            "database": "GlyConnect",
            "categories": [
                "Glycoproteomics",
                "Glycan"
            ]
        },
        {
            "id": "2433",
            "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=2433",
            "database": "HGNC",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "P07333",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:P07333*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR000719",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000719",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR001245",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001245",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR001824",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001824",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR003598",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR003598",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR003599",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR007110",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR008266",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR008266",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR011009",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR011009",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR013151",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR013151",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR013783",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR017441",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017441",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR020635",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR020635",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR030658",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR030658",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR036179",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "hsa:1436",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1436",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "164770",
            "url": "http://www.omim.org/entry/164770",
            "database": "MIM",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "221820",
            "url": "http://www.omim.org/entry/221820",
            "database": "MIM",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "618476",
            "url": "http://www.omim.org/entry/618476",
            "database": "MIM",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "NX_P07333",
            "url": "https://www.nextprot.org/entry/NX_P07333",
            "database": "neXtProt",
            "categories": [
                "Protein",
                "Organism-specific"
            ]
        },
        {
            "id": "TIHKAKY",
            "url": "https://omabrowser.org/oma/group/TIHKAKY/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "1614410at2759",
            "url": "http://www.orthodb.org/?query=1614410at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR24416",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24416",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR24416:SF47",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24416:SF47",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "2I0V",
            "url": "https://www.rcsb.org/structure/2I0V",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2I0Y",
            "url": "https://www.rcsb.org/structure/2I0Y",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2I1M",
            "url": "https://www.rcsb.org/structure/2I1M",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2OGV",
            "url": "https://www.rcsb.org/structure/2OGV",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "3BEA",
            "url": "https://www.rcsb.org/structure/3BEA",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "3DPK",
            "url": "https://www.rcsb.org/structure/3DPK",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "3KRJ",
            "url": "https://www.rcsb.org/structure/3KRJ",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "3KRL",
            "url": "https://www.rcsb.org/structure/3KRL",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "3LCD",
            "url": "https://www.rcsb.org/structure/3LCD",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "3LCO",
            "url": "https://www.rcsb.org/structure/3LCO",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4DKD",
            "url": "https://www.rcsb.org/structure/4DKD",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4HW7",
            "url": "https://www.rcsb.org/structure/4HW7",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4LIQ",
            "url": "https://www.rcsb.org/structure/4LIQ",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4R7H",
            "url": "https://www.rcsb.org/structure/4R7H",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4R7I",
            "url": "https://www.rcsb.org/structure/4R7I",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4WRL",
            "url": "https://www.rcsb.org/structure/4WRL",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4WRM",
            "url": "https://www.rcsb.org/structure/4WRM",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6IG8",
            "url": "https://www.rcsb.org/structure/6IG8",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6N33",
            "url": "https://www.rcsb.org/structure/6N33",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6T2W",
            "url": "https://www.rcsb.org/structure/6T2W",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6WXJ",
            "url": "https://www.rcsb.org/structure/6WXJ",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7MFC",
            "url": "https://www.rcsb.org/structure/7MFC",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "8CGC",
            "url": "https://www.rcsb.org/structure/8CGC",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "PF00047",
            "url": "http://pfam.xfam.org/family/PF00047",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF07714",
            "url": "http://pfam.xfam.org/family/PF07714",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF13927",
            "url": "http://pfam.xfam.org/family/PF13927",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "P07333",
            "url": "https://pharos.nih.gov/targets/P07333",
            "database": "PHAROS",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "PR_P07333",
            "url": "http://purl.obolibrary.org/obo/PR_P07333",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "R-HSA-449836",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-8853884",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8853884",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-9680350",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_001275634",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001275634",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "10596",
            "url": "https://www.rhea-db.org/rhea/10596",
            "database": "Rhea",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "D6RGW1",
            "url": "https://www.uniprot.org/uniprot/D6RGW1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "D6RGW1-1",
            "url": "https://www.uniprot.org/uniprot/D6RGW1-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "E9PEK4",
            "url": "https://www.uniprot.org/uniprot/E9PEK4",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "E9PEK4-1",
            "url": "https://www.uniprot.org/uniprot/E9PEK4-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "H0YAL5",
            "url": "https://www.uniprot.org/uniprot/H0YAL5",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "H0YAL5-1",
            "url": "https://www.uniprot.org/uniprot/H0YAL5-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P07333",
            "url": "https://www.uniprot.org/uniprot/P07333",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P07333-1",
            "url": "https://www.uniprot.org/uniprot/P07333-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P07333-2",
            "url": "https://www.uniprot.org/uniprot/P07333-2",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MGPGVLLLLLVATAWHGQGIPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFEDQDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSALMGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTYRHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTFINGSGTLLCAASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYPEVLSQEPFHKVTVQSLLTVETLEHNQTYECRAHNSVGSGSWAFIPISAGAHTHPPDEFLFTPVVVACMSIMALLLLLLLLLLYKYKQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGVDYKNIHLEKKYVRRDSGFSSQGVDTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQICSFLQEQAQEDRRERDYTNLPSSSRSGGSGSSSSELEEESSSEHLTCCEQGDIAQPLLQPNNYQFC",
        "length": 972,
        "header": "sp|P07333-1|CSF1R_HUMAN Isoform 1 of Macrophage colony-stimulating factor 1 receptor  OS=Homo sapiens OX=9606 GN=CSF1R PE=1 SV=2 CANONICAL=P07333-1"
    },
    "isoforms": [
        {
            "isoform_ac": "D6RGW1-1",
            "url": "",
            "sequence": {
                "sequence": "MRHTNYSFSPWHGFTIHRAKFIQSQDYQCSALMGGRKVMSISIRLKVQK",
                "length": 49,
                "header": "tr|D6RGW1-1|D6RGW1_HUMAN Computationally mapped isoform of Colony stimulating factor 1 receptor  OS=Homo sapiens OX=9606 GN=CSF1R PE=1 SV=1 CANONICAL=P07333-1"
            },
            "locus": {
                "chromosome": "5",
                "start_pos": 150080199,
                "end_pos": 150080053,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000511344.1",
                        "url": "https://www.ensembl.org/id/ENST00000511344.1"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000421174.1",
                        "url": "https://www.ensembl.org/id/ENSP00000421174.1"
                    }
                ]
            }
        },
        {
            "isoform_ac": "E9PEK4-1",
            "url": "",
            "sequence": {
                "sequence": "MGPGVLLLLLVATAWHGQGIPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFEDQDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSALMGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTYRHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTFINGSGTLLCAASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYPEVLSQEPFHKVTVQSLLTVETLEHNQTYECRAHNSVGSGSWAFIPISAGAHTHPPDEFLFTPVVVACMSIMALLLLLLLLLLYKYKQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGTVASPARVWTPMWR",
                "length": 671,
                "header": "tr|E9PEK4-1|CSF1R_HUMAN Computationally mapped isoform of Macrophage colony-stimulating factor 1 receptor  OS=Homo sapiens OX=9606 GN=CSF1R PE=1 SV=1 CANONICAL=P07333-1"
            },
            "locus": {
                "chromosome": "5",
                "start_pos": 150086427,
                "end_pos": 150057549,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000504875.5",
                        "url": "https://www.ensembl.org/id/ENST00000504875.5"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000422212.1",
                        "url": "https://www.ensembl.org/id/ENSP00000422212.1"
                    }
                ]
            }
        },
        {
            "isoform_ac": "H0YAL5-1",
            "url": "",
            "sequence": {
                "sequence": "AGSPWALGQRPFGAQGLKGPVCVAATAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGIS",
                "length": 64,
                "header": "tr|H0YAL5-1|H0YAL5_HUMAN Computationally mapped isoform of Colony stimulating factor 1 receptor  OS=Homo sapiens OX=9606 GN=CSF1R PE=4 SV=1 CANONICAL=P07333-1"
            },
            "locus": {
                "chromosome": "5",
                "start_pos": 150061668,
                "end_pos": 150058264,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000515068.1",
                        "url": "https://www.ensembl.org/id/ENST00000515068.1"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000427545.1",
                        "url": "https://www.ensembl.org/id/ENSP00000427545.1"
                    }
                ]
            }
        },
        {
            "isoform_ac": "P07333-1",
            "url": "",
            "sequence": {
                "sequence": "MGPGVLLLLLVATAWHGQGIPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFEDQDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSALMGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTYRHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTFINGSGTLLCAASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYPEVLSQEPFHKVTVQSLLTVETLEHNQTYECRAHNSVGSGSWAFIPISAGAHTHPPDEFLFTPVVVACMSIMALLLLLLLLLLYKYKQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGVDYKNIHLEKKYVRRDSGFSSQGVDTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQICSFLQEQAQEDRRERDYTNLPSSSRSGGSGSSSSELEEESSSEHLTCCEQGDIAQPLLQPNNYQFC",
                "length": 972,
                "header": "sp|P07333-1|CSF1R_HUMAN Isoform 1 of Macrophage colony-stimulating factor 1 receptor  OS=Homo sapiens OX=9606 GN=CSF1R PE=1 SV=2 CANONICAL=P07333-1"
            },
            "locus": {
                "chromosome": "5",
                "start_pos": 150086427,
                "end_pos": 150054072,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000286301.7",
                        "url": "https://www.ensembl.org/id/ENST00000286301.7"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000286301.3",
                        "url": "https://www.ensembl.org/id/ENSP00000286301.3"
                    }
                ]
            }
        },
        {
            "isoform_ac": "P07333-2",
            "url": "",
            "sequence": {
                "sequence": "MGPGVLLLLLVATAWHGQGIPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFEDQDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSALMGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVGTPSPSLCPA",
                "length": 306,
                "header": "sp|P07333-2|CSF1R_HUMAN Isoform 2 of Macrophage colony-stimulating factor 1 receptor  OS=Homo sapiens OX=9606 GN=CSF1R PE=1 SV=2 CANONICAL=P07333-1"
            },
            "locus": {
                "chromosome": "5",
                "start_pos": 150086427,
                "end_pos": 150070543,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000543093.1",
                        "url": "https://www.ensembl.org/id/ENST00000543093.1"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000445282.1",
                        "url": "https://www.ensembl.org/id/ENSP00000445282.1"
                    }
                ]
            }
        }
    ],
    "glycosylation": [
        {
            "glytoucan_ac": "G11629QQ",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported_with_glycan",
            "site_seq": "N",
            "relation": "attached",
            "comment": "",
            "start_pos": 153,
            "start_aa": "Asn",
            "end_pos": 153,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn153",
            "evidence": [
                {
                    "id": "1955",
                    "database": "GlyConnect",
                    "url": "https://glyconnect.expasy.org/browser/proteins/1955"
                },
                {
                    "id": "29391424",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/29391424"
                }
            ]
        },
        {
            "glytoucan_ac": "G37881RL",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported_with_glycan",
            "site_seq": "N",
            "relation": "attached",
            "comment": "",
            "start_pos": 153,
            "start_aa": "Asn",
            "end_pos": 153,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn153",
            "evidence": [
                {
                    "id": "1955",
                    "database": "GlyConnect",
                    "url": "https://glyconnect.expasy.org/browser/proteins/1955"
                },
                {
                    "id": "29391424",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/29391424"
                }
            ]
        },
        {
            "glytoucan_ac": "G39595FH",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported_with_glycan",
            "site_seq": "N",
            "relation": "attached",
            "comment": "",
            "start_pos": 153,
            "start_aa": "Asn",
            "end_pos": 153,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn153",
            "evidence": [
                {
                    "id": "1955",
                    "database": "GlyConnect",
                    "url": "https://glyconnect.expasy.org/browser/proteins/1955"
                },
                {
                    "id": "29391424",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/29391424"
                }
            ]
        },
        {
            "glytoucan_ac": "G64394MX",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported_with_glycan",
            "site_seq": "N",
            "relation": "attached",
            "comment": "",
            "start_pos": 153,
            "start_aa": "Asn",
            "end_pos": 153,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn153",
            "evidence": [
                {
                    "id": "1955",
                    "database": "GlyConnect",
                    "url": "https://glyconnect.expasy.org/browser/proteins/1955"
                },
                {
                    "id": "29391424",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/29391424"
                }
            ]
        },
        {
            "glytoucan_ac": "G81263BG",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported_with_glycan",
            "site_seq": "N",
            "relation": "attached",
            "comment": "",
            "start_pos": 153,
            "start_aa": "Asn",
            "end_pos": 153,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn153",
            "evidence": [
                {
                    "id": "1955",
                    "database": "GlyConnect",
                    "url": "https://glyconnect.expasy.org/browser/proteins/1955"
                },
                {
                    "id": "29391424",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/29391424"
                }
            ]
        },
        {
            "glytoucan_ac": "G86795LJ",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported_with_glycan",
            "site_seq": "N",
            "relation": "attached",
            "comment": "",
            "start_pos": 153,
            "start_aa": "Asn",
            "end_pos": 153,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn153",
            "evidence": [
                {
                    "id": "1955",
                    "database": "GlyConnect",
                    "url": "https://glyconnect.expasy.org/browser/proteins/1955"
                },
                {
                    "id": "29391424",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/29391424"
                }
            ]
        },
        {
            "glytoucan_ac": "G89205CJ",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported_with_glycan",
            "site_seq": "N",
            "relation": "attached",
            "comment": "",
            "start_pos": 153,
            "start_aa": "Asn",
            "end_pos": 153,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn153",
            "evidence": [
                {
                    "id": "1955",
                    "database": "GlyConnect",
                    "url": "https://glyconnect.expasy.org/browser/proteins/1955"
                },
                {
                    "id": "29391424",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/29391424"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 153,
            "start_aa": "Asn",
            "end_pos": 153,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn153",
            "evidence": [
                {
                    "id": "P07333",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P07333#ptm_processing"
                },
                {
                    "id": "23090970",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/23090970"
                },
                {
                    "id": "GLY_000143",
                    "database": "GlyGen",
                    "url": "https://data.glygen.org/GLY_000143"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 240,
            "start_aa": "Asn",
            "end_pos": 240,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn240",
            "evidence": [
                {
                    "id": "P07333",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P07333#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 275,
            "start_aa": "Asn",
            "end_pos": 275,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn275",
            "evidence": [
                {
                    "id": "P07333",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P07333#ptm_processing"
                },
                {
                    "id": "23090970",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/23090970"
                },
                {
                    "id": "GLY_000143",
                    "database": "GlyGen",
                    "url": "https://data.glygen.org/GLY_000143"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 302,
            "start_aa": "Asn",
            "end_pos": 302,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn302",
            "evidence": [
                {
                    "id": "P07333",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P07333#ptm_processing"
                },
                {
                    "id": "16335952",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/16335952"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 335,
            "start_aa": "Asn",
            "end_pos": 335,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn335",
            "evidence": [
                {
                    "id": "P07333",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P07333#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "G22310AV",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported_with_glycan",
            "site_seq": "N",
            "relation": "attached",
            "comment": "",
            "start_pos": 353,
            "start_aa": "Asn",
            "end_pos": 353,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn353",
            "evidence": [
                {
                    "id": "1955",
                    "database": "GlyConnect",
                    "url": "https://glyconnect.expasy.org/browser/proteins/1955"
                },
                {
                    "id": "29391424",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/29391424"
                }
            ]
        },
        {
            "glytoucan_ac": "G37881RL",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported_with_glycan",
            "site_seq": "N",
            "relation": "attached",
            "comment": "",
            "start_pos": 353,
            "start_aa": "Asn",
            "end_pos": 353,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn353",
            "evidence": [
                {
                    "id": "1955",
                    "database": "GlyConnect",
                    "url": "https://glyconnect.expasy.org/browser/proteins/1955"
                },
                {
                    "id": "29391424",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/29391424"
                }
            ]
        },
        {
            "glytoucan_ac": "G43089EG",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported_with_glycan",
            "site_seq": "N",
            "relation": "attached",
            "comment": "",
            "start_pos": 353,
            "start_aa": "Asn",
            "end_pos": 353,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn353",
            "evidence": [
                {
                    "id": "1955",
                    "database": "GlyConnect",
                    "url": "https://glyconnect.expasy.org/browser/proteins/1955"
                },
                {
                    "id": "29391424",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/29391424"
                }
            ]
        },
        {
            "glytoucan_ac": "G57888GL",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported_with_glycan",
            "site_seq": "N",
            "relation": "attached",
            "comment": "",
            "start_pos": 353,
            "start_aa": "Asn",
            "end_pos": 353,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn353",
            "evidence": [
                {
                    "id": "1955",
                    "database": "GlyConnect",
                    "url": "https://glyconnect.expasy.org/browser/proteins/1955"
                },
                {
                    "id": "29391424",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/29391424"
                }
            ]
        },
        {
            "glytoucan_ac": "G84452RH",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported_with_glycan",
            "site_seq": "N",
            "relation": "attached",
            "comment": "",
            "start_pos": 353,
            "start_aa": "Asn",
            "end_pos": 353,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn353",
            "evidence": [
                {
                    "id": "1955",
                    "database": "GlyConnect",
                    "url": "https://glyconnect.expasy.org/browser/proteins/1955"
                },
                {
                    "id": "29391424",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/29391424"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 353,
            "start_aa": "Asn",
            "end_pos": 353,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn353",
            "evidence": [
                {
                    "id": "P07333",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P07333#ptm_processing"
                },
                {
                    "id": "16335952",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/16335952"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 412,
            "start_aa": "Asn",
            "end_pos": 412,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn412",
            "evidence": [
                {
                    "id": "P07333",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P07333#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 428,
            "start_aa": "Asn",
            "end_pos": 428,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn428",
            "evidence": [
                {
                    "id": "P07333",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P07333#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 45,
            "start_aa": "Asn",
            "end_pos": 45,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn45",
            "evidence": [
                {
                    "id": "P07333",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P07333#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 480,
            "start_aa": "Asn",
            "end_pos": 480,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn480",
            "evidence": [
                {
                    "id": "P07333",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P07333#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 73,
            "start_aa": "Asn",
            "end_pos": 73,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn73",
            "evidence": [
                {
                    "id": "P07333",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P07333#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "G06356OH",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported_with_glycan",
            "site_seq": "N",
            "relation": "attached",
            "comment": "",
            "start_pos": 805,
            "start_aa": "Asn",
            "end_pos": 805,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn805",
            "evidence": [
                {
                    "id": "1955",
                    "database": "GlyConnect",
                    "url": "https://glyconnect.expasy.org/browser/proteins/1955"
                },
                {
                    "id": "29391424",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/29391424"
                }
            ]
        },
        {
            "glytoucan_ac": "G22310AV",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported_with_glycan",
            "site_seq": "N",
            "relation": "attached",
            "comment": "",
            "start_pos": 805,
            "start_aa": "Asn",
            "end_pos": 805,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn805",
            "evidence": [
                {
                    "id": "1955",
                    "database": "GlyConnect",
                    "url": "https://glyconnect.expasy.org/browser/proteins/1955"
                },
                {
                    "id": "29391424",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/29391424"
                }
            ]
        },
        {
            "glytoucan_ac": "G37881RL",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported_with_glycan",
            "site_seq": "N",
            "relation": "attached",
            "comment": "",
            "start_pos": 805,
            "start_aa": "Asn",
            "end_pos": 805,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn805",
            "evidence": [
                {
                    "id": "1955",
                    "database": "GlyConnect",
                    "url": "https://glyconnect.expasy.org/browser/proteins/1955"
                },
                {
                    "id": "29391424",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/29391424"
                }
            ]
        },
        {
            "glytoucan_ac": "G48414YA",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported_with_glycan",
            "site_seq": "N",
            "relation": "attached",
            "comment": "",
            "start_pos": 805,
            "start_aa": "Asn",
            "end_pos": 805,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn805",
            "evidence": [
                {
                    "id": "1955",
                    "database": "GlyConnect",
                    "url": "https://glyconnect.expasy.org/browser/proteins/1955"
                },
                {
                    "id": "29391424",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/29391424"
                }
            ]
        },
        {
            "glytoucan_ac": "G52527GH",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported_with_glycan",
            "site_seq": "N",
            "relation": "attached",
            "comment": "",
            "start_pos": 805,
            "start_aa": "Asn",
            "end_pos": 805,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn805",
            "evidence": [
                {
                    "id": "1955",
                    "database": "GlyConnect",
                    "url": "https://glyconnect.expasy.org/browser/proteins/1955"
                },
                {
                    "id": "29391424",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/29391424"
                }
            ]
        },
        {
            "glytoucan_ac": "G84452RH",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported_with_glycan",
            "site_seq": "N",
            "relation": "attached",
            "comment": "",
            "start_pos": 805,
            "start_aa": "Asn",
            "end_pos": 805,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn805",
            "evidence": [
                {
                    "id": "1955",
                    "database": "GlyConnect",
                    "url": "https://glyconnect.expasy.org/browser/proteins/1955"
                },
                {
                    "id": "29391424",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/29391424"
                }
            ]
        }
    ],
    "phosphorylation": [
        {
            "start_pos": 546,
            "end_pos": 546,
            "kinase_uniprot_canonical_ac": "P07333-1",
            "kinase_gene_name": "CSF1R",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                },
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                },
                {
                    "database": "PubMed",
                    "id": "20489731",
                    "url": "https://glygen.org/publication/PubMed/20489731"
                }
            ],
            "site_lbl": "Tyr546"
        },
        {
            "start_pos": 546,
            "end_pos": 546,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "Phosphotyrosine; by autocatalysis",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                },
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                },
                {
                    "database": "PubMed",
                    "id": "22974529",
                    "url": "https://glygen.org/publication/PubMed/22974529"
                },
                {
                    "database": "PubMed",
                    "id": "24336230",
                    "url": "https://glygen.org/publication/PubMed/24336230"
                },
                {
                    "database": "PubMed",
                    "id": "30136118",
                    "url": "https://glygen.org/publication/PubMed/30136118"
                },
                {
                    "database": "PubMed",
                    "id": "31827782",
                    "url": "https://glygen.org/publication/PubMed/31827782"
                }
            ],
            "site_lbl": "Tyr546"
        },
        {
            "start_pos": 561,
            "end_pos": 561,
            "kinase_uniprot_canonical_ac": "P07333-1",
            "kinase_gene_name": "CSF1R",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "phospho.ELM",
                    "id": "P07333",
                    "url": "http://phospho.elm.eu.org/byAccession/P07333.html"
                },
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                },
                {
                    "database": "PubMed",
                    "id": "15297464",
                    "url": "https://glygen.org/publication/PubMed/15297464"
                }
            ],
            "site_lbl": "Tyr561"
        },
        {
            "start_pos": 561,
            "end_pos": 561,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "Phosphotyrosine; by autocatalysis",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                },
                {
                    "database": "IntAct",
                    "id": "P07333",
                    "url": "https://www.ebi.ac.uk/intact/interactors/id:P07333*"
                },
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                },
                {
                    "database": "PubMed",
                    "id": "7730365",
                    "url": "https://glygen.org/publication/PubMed/7730365"
                },
                {
                    "database": "PubMed",
                    "id": "21049007",
                    "url": "https://glygen.org/publication/PubMed/21049007"
                }
            ],
            "site_lbl": "Tyr561"
        },
        {
            "start_pos": 699,
            "end_pos": 699,
            "kinase_uniprot_canonical_ac": "P07333-1",
            "kinase_gene_name": "CSF1R",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                },
                {
                    "database": "PubMed",
                    "id": "15297464",
                    "url": "https://glygen.org/publication/PubMed/15297464"
                },
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                },
                {
                    "database": "PubMed",
                    "id": "19369195",
                    "url": "https://glygen.org/publication/PubMed/19369195"
                }
            ],
            "site_lbl": "Tyr699"
        },
        {
            "start_pos": 699,
            "end_pos": 699,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "Phosphotyrosine; by autocatalysis",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                },
                {
                    "database": "phospho.ELM",
                    "id": "P07333",
                    "url": "http://phospho.elm.eu.org/byAccession/P07333.html"
                },
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                },
                {
                    "database": "PubMed",
                    "id": "21049007",
                    "url": "https://glygen.org/publication/PubMed/21049007"
                },
                {
                    "database": "PubMed",
                    "id": "22974529",
                    "url": "https://glygen.org/publication/PubMed/22974529"
                },
                {
                    "database": "PubMed",
                    "id": "31827782",
                    "url": "https://glygen.org/publication/PubMed/31827782"
                },
                {
                    "database": "PubMed",
                    "id": "20489731",
                    "url": "https://glygen.org/publication/PubMed/20489731"
                }
            ],
            "site_lbl": "Tyr699"
        },
        {
            "start_pos": 708,
            "end_pos": 708,
            "kinase_uniprot_canonical_ac": "P07333-1",
            "kinase_gene_name": "CSF1R",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                },
                {
                    "database": "PubMed",
                    "id": "15297464",
                    "url": "https://glygen.org/publication/PubMed/15297464"
                },
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                },
                {
                    "database": "PubMed",
                    "id": "20489731",
                    "url": "https://glygen.org/publication/PubMed/20489731"
                }
            ],
            "site_lbl": "Tyr708"
        },
        {
            "start_pos": 708,
            "end_pos": 708,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "Phosphotyrosine; by autocatalysis",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                },
                {
                    "database": "phospho.ELM",
                    "id": "P07333",
                    "url": "http://phospho.elm.eu.org/byAccession/P07333.html"
                },
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                },
                {
                    "database": "PubMed",
                    "id": "22974529",
                    "url": "https://glygen.org/publication/PubMed/22974529"
                },
                {
                    "database": "PubMed",
                    "id": "23924795",
                    "url": "https://glygen.org/publication/PubMed/23924795"
                },
                {
                    "database": "PubMed",
                    "id": "29796177",
                    "url": "https://glygen.org/publication/PubMed/29796177"
                },
                {
                    "database": "PubMed",
                    "id": "30136118",
                    "url": "https://glygen.org/publication/PubMed/30136118"
                }
            ],
            "site_lbl": "Tyr708"
        },
        {
            "start_pos": 713,
            "end_pos": 713,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "Phosphoserine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                },
                {
                    "database": "PubMed",
                    "id": "19369195",
                    "url": "https://glygen.org/publication/PubMed/19369195"
                },
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                },
                {
                    "database": "PubMed",
                    "id": "35494241",
                    "url": ""
                }
            ],
            "site_lbl": "Ser713"
        },
        {
            "start_pos": 723,
            "end_pos": 723,
            "kinase_uniprot_canonical_ac": "P07333-1",
            "kinase_gene_name": "CSF1R",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                },
                {
                    "database": "PubMed",
                    "id": "15297464",
                    "url": "https://glygen.org/publication/PubMed/15297464"
                },
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                },
                {
                    "database": "PubMed",
                    "id": "20489731",
                    "url": "https://glygen.org/publication/PubMed/20489731"
                }
            ],
            "site_lbl": "Tyr723"
        },
        {
            "start_pos": 723,
            "end_pos": 723,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "Phosphotyrosine; by autocatalysis",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                },
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                },
                {
                    "database": "PubMed",
                    "id": "9191055",
                    "url": "https://glygen.org/publication/PubMed/9191055"
                },
                {
                    "database": "IntAct",
                    "id": "P07333",
                    "url": "https://www.ebi.ac.uk/intact/interactors/id:P07333*"
                },
                {
                    "database": "PubMed",
                    "id": "9312046",
                    "url": "https://glygen.org/publication/PubMed/9312046"
                },
                {
                    "database": "phospho.ELM",
                    "id": "P07333",
                    "url": "http://phospho.elm.eu.org/byAccession/P07333.html"
                },
                {
                    "database": "PubMed",
                    "id": "21266043",
                    "url": "https://glygen.org/publication/PubMed/21266043"
                },
                {
                    "database": "PubMed",
                    "id": "22974529",
                    "url": "https://glygen.org/publication/PubMed/22974529"
                },
                {
                    "database": "PubMed",
                    "id": "23924795",
                    "url": "https://glygen.org/publication/PubMed/23924795"
                },
                {
                    "database": "PubMed",
                    "id": "24019961",
                    "url": "https://glygen.org/publication/PubMed/24019961"
                },
                {
                    "database": "PubMed",
                    "id": "24336230",
                    "url": "https://glygen.org/publication/PubMed/24336230"
                },
                {
                    "database": "PubMed",
                    "id": "29796177",
                    "url": "https://glygen.org/publication/PubMed/29796177"
                },
                {
                    "database": "PubMed",
                    "id": "30136118",
                    "url": "https://glygen.org/publication/PubMed/30136118"
                }
            ],
            "site_lbl": "Tyr723"
        },
        {
            "start_pos": 809,
            "end_pos": 809,
            "kinase_uniprot_canonical_ac": "P07333-1",
            "kinase_gene_name": "CSF1R",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                },
                {
                    "database": "PubMed",
                    "id": "1833648",
                    "url": "https://glygen.org/publication/PubMed/1833648"
                },
                {
                    "database": "phospho.ELM",
                    "id": "P07333",
                    "url": "http://phospho.elm.eu.org/byAccession/P07333.html"
                },
                {
                    "database": "PubMed",
                    "id": "15297464",
                    "url": "https://glygen.org/publication/PubMed/15297464"
                },
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                },
                {
                    "database": "PubMed",
                    "id": "20489731",
                    "url": "https://glygen.org/publication/PubMed/20489731"
                }
            ],
            "site_lbl": "Tyr809"
        },
        {
            "start_pos": 809,
            "end_pos": 809,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "Phosphotyrosine; by autocatalysis",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                },
                {
                    "database": "IntAct",
                    "id": "P07333",
                    "url": "https://www.ebi.ac.uk/intact/interactors/id:P07333*"
                },
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                },
                {
                    "database": "PubMed",
                    "id": "7681396",
                    "url": "https://glygen.org/publication/PubMed/7681396"
                },
                {
                    "database": "phospho.ELM",
                    "id": "P07333",
                    "url": "http://phospho.elm.eu.org/byAccession/P07333.html"
                },
                {
                    "database": "PubMed",
                    "id": "7579387",
                    "url": "https://glygen.org/publication/PubMed/7579387"
                },
                {
                    "database": "PubMed",
                    "id": "2168557",
                    "url": "https://glygen.org/publication/PubMed/2168557"
                },
                {
                    "database": "PubMed",
                    "id": "22974529",
                    "url": "https://glygen.org/publication/PubMed/22974529"
                },
                {
                    "database": "PubMed",
                    "id": "24336230",
                    "url": "https://glygen.org/publication/PubMed/24336230"
                },
                {
                    "database": "PubMed",
                    "id": "31827782",
                    "url": "https://glygen.org/publication/PubMed/31827782"
                }
            ],
            "site_lbl": "Tyr809"
        },
        {
            "start_pos": 923,
            "end_pos": 923,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "Phosphotyrosine; by autocatalysis",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                },
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                },
                {
                    "database": "PubMed",
                    "id": "21049007",
                    "url": "https://glygen.org/publication/PubMed/21049007"
                },
                {
                    "database": "PubMed",
                    "id": "22974529",
                    "url": "https://glygen.org/publication/PubMed/22974529"
                }
            ],
            "site_lbl": "Tyr923"
        },
        {
            "start_pos": 969,
            "end_pos": 969,
            "kinase_uniprot_canonical_ac": "P07333-1",
            "kinase_gene_name": "CSF1R",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                },
                {
                    "database": "PubMed",
                    "id": "11850825",
                    "url": "https://glygen.org/publication/PubMed/11850825"
                },
                {
                    "database": "PubMed",
                    "id": "15297464",
                    "url": "https://glygen.org/publication/PubMed/15297464"
                }
            ],
            "site_lbl": "Tyr969"
        },
        {
            "start_pos": 969,
            "end_pos": 969,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "Phosphotyrosine; by autocatalysis",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "site_lbl": "Tyr969"
        }
    ],
    "glycation": [],
    "keywords": [
        "enzyme",
        "glycoprotein",
        "glycoprotein_predicted",
        "glycoprotein_reported",
        "glycoprotein_reported_with_glycan"
    ],
    "publication": [
        {
            "title": "Beta-catenin regulates expression of cyclin D1 in colon carcinoma cells.",
            "journal": "Nature",
            "date": "1999",
            "authors": "Tetsu O, McCormick F",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-8853884",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8853884"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10201372",
                    "url": "https://glygen.org/publication/PubMed/10201372"
                }
            ]
        },
        {
            "title": "The cyclin D1 gene is a target of the beta-catenin/LEF-1 pathway.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "1999",
            "authors": "Shtutman M, Zhurinsky J, Simcha I, Albanese C, D'Amico M, Pestell R, Ben-Ze'ev A",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-8853884",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8853884"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10318916",
                    "url": "https://glygen.org/publication/PubMed/10318916"
                }
            ]
        },
        {
            "title": "Cell specific transformation by c-fms activating loop mutations is attributable to constitutive receptor degradation.",
            "journal": "Oncogene",
            "date": "1999",
            "authors": "Morley GM, Uden M, Gullick WJ, Dibb NJ",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10340379",
                    "url": "https://glygen.org/publication/PubMed/10340379"
                }
            ]
        },
        {
            "title": "Processing, secretion, and anti-HIV-1 activity of IL-16 with or without a signal peptide in CD4+ T cells.",
            "journal": "Journal of immunology (Baltimore, Md. : 1950)",
            "date": "1999",
            "authors": "Zhou P, Devadas K, Tewari D, Jegorow A, Notkins AL",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-449836",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10395686",
                    "url": "https://glygen.org/publication/PubMed/10395686"
                }
            ]
        },
        {
            "title": "Identification of a CD4 domain required for interleukin-16 binding and lymphocyte activation.",
            "journal": "The Journal of biological chemistry",
            "date": "1999",
            "authors": "Liu Y, Cruikshank WW, O'Loughlin T, O'Reilly P, Center DM, Kornfeld H",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-449836",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10438516",
                    "url": "https://glygen.org/publication/PubMed/10438516"
                }
            ]
        },
        {
            "title": "C-Cbl binds the CSF-1 receptor at tyrosine 973, a novel phosphorylation site in the receptor's carboxy-terminus.",
            "journal": "Oncogene",
            "date": "2002",
            "authors": "Wilhelmsen K, Burkhalter S, van der Geer P",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11850825",
                    "url": "https://glygen.org/publication/PubMed/11850825"
                }
            ]
        },
        {
            "title": "IL-28, IL-29 and their class II cytokine receptor IL-28R.",
            "journal": "Nature immunology",
            "date": "2003",
            "authors": "Sheppard P, Kindsvogel W, Xu W, Henderson K, Schlutsmeyer S, Whitmore TE, Kuestner R, Garrigues U, Birks C, Roraback J, Ostrander C, Dong D, Shin J, Presnell S, Fox B, Haldeman B, Cooper E, Taft D, Gilbert T, Grant FJ, Tackett M, Krivan W, McKnight G, Clegg C, Foster D, Klucher KM",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-449836",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12469119",
                    "url": "https://glygen.org/publication/PubMed/12469119"
                }
            ]
        },
        {
            "title": "Taxilin; a novel syntaxin-binding protein that is involved in Ca2+-dependent exocytosis in neuroendocrine cells.",
            "journal": "Genes to cells : devoted to molecular & cellular mechanisms",
            "date": "2003",
            "authors": "Nogami S, Satoh S, Nakano M, Shimizu H, Fukushima H, Maruyama A, Terano A, Shirataki H",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-449836",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12558796",
                    "url": "https://glygen.org/publication/PubMed/12558796"
                }
            ]
        },
        {
            "title": "Mutational analysis of class III receptor tyrosine kinases (C-KIT, C-FMS, FLT3) in idiopathic myelofibrosis.",
            "journal": "British journal of haematology",
            "date": "2003",
            "authors": "Abu-Duhier FM, Goodeve AC, Care RS, Gari M, Wilson GA, Peake IR, Reilly JT",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "1436",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/1436"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12580961",
                    "url": "https://glygen.org/publication/PubMed/12580961"
                }
            ]
        },
        {
            "title": "The inositol 5'-phosphatase SHIP-1 and the Src kinase Lyn negatively regulate macrophage colony-stimulating factor-induced Akt activity.",
            "journal": "The Journal of biological chemistry",
            "date": "2003",
            "authors": "Baran CP, Tridandapani S, Helgason CD, Humphries RK, Krystal G, Marsh CB",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-9680350",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12882960",
                    "url": "https://glygen.org/publication/PubMed/12882960"
                }
            ]
        },
        {
            "title": "Macrophage colony stimulating factor activates phosphatidylcholine hydrolysis by cytoplasmic phospholipase A2.",
            "journal": "The EMBO journal",
            "date": "1992",
            "authors": "Nakamura T, Lin LL, Kharbanda S, Knopf J, Kufe D",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9680350",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "1334462",
                    "url": "https://glygen.org/publication/PubMed/1334462"
                }
            ]
        },
        {
            "title": "Autocrine CSF-1R activation promotes Src-dependent disruption of mammary epithelial architecture.",
            "journal": "The Journal of cell biology",
            "date": "2004",
            "authors": "Wrobel CN, Debnath J, Lin E, Beausoleil S, Roussel MF, Brugge JS",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15117969",
                    "url": "https://glygen.org/publication/PubMed/15117969"
                }
            ]
        },
        {
            "title": "A juxtamembrane tyrosine in the colony stimulating factor-1 receptor regulates ligand-induced Src association, receptor kinase function, and down-regulation.",
            "journal": "The Journal of biological chemistry",
            "date": "2004",
            "authors": "Rohde CM, Schrum J, Lee AW",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15297464",
                    "url": "https://glygen.org/publication/PubMed/15297464"
                }
            ]
        },
        {
            "title": "CSF-1 regulation of the wandering macrophage: complexity in action.",
            "journal": "Trends Cell Biol.",
            "date": "2004",
            "authors": "Pixley Fiona J, Stanley E Richard",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15519852",
                    "url": "https://glygen.org/publication/PubMed/15519852"
                }
            ]
        },
        {
            "title": "FMS receptor for M-CSF (CSF-1) is sensitive to the kinase inhibitor imatinib and mutation of Asp-802 to Val confers resistance.",
            "journal": "Oncogene",
            "date": "2006",
            "authors": "Taylor JR, Brownlow N, Domin J, Dibb NJ",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16170366",
                    "url": "https://glygen.org/publication/PubMed/16170366"
                }
            ]
        },
        {
            "title": "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.",
            "journal": "Journal of proteome research",
            "date": "2005",
            "authors": "Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333#ptm_processing"
                },
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16335952",
                    "url": "https://glygen.org/publication/PubMed/16335952"
                }
            ]
        },
        {
            "title": "Colony-stimulating factor-1 in immunity and inflammation.",
            "journal": "Current opinion in immunology",
            "date": "2006-02",
            "authors": "Chitu Violeta, Stanley E Richard",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16337366",
                    "url": "https://glygen.org/publication/PubMed/16337366"
                }
            ]
        },
        {
            "title": "Proteinase 3 is an IL-32 binding protein.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "2006",
            "authors": "Novick D, Rubinstein M, Azam T, Rabinkov A, Dinarello CA, Kim SH",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-449836",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16488976",
                    "url": "https://glygen.org/publication/PubMed/16488976"
                }
            ]
        },
        {
            "title": "Homodimeric cross-over structure of the human granulocyte colony-stimulating factor (GCSF) receptor signaling complex.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "2006",
            "authors": "Tamada T, Honjo E, Maeda Y, Okamoto T, Ishibashi M, Tokunaga M, Kuroki R",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-449836",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16492764",
                    "url": "https://glygen.org/publication/PubMed/16492764"
                }
            ]
        },
        {
            "title": "Inhibition of phosphorylation of the colony-stimulating factor-1 receptor (c-Fms) tyrosine kinase in transfected cells by ABT-869 and other tyrosine kinase inhibitors.",
            "journal": "Molecular cancer therapeutics",
            "date": "2006-04",
            "authors": "Guo Jun, Marcotte Patrick A, McCall J Owen, Dai Yujia, Pease Lori J, Michaelides Michael R, Davidsen Steven K, Glaser Keith B",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16648572",
                    "url": "https://glygen.org/publication/PubMed/16648572"
                }
            ]
        },
        {
            "title": "A c-fms tyrosine kinase inhibitor, Ki20227, suppresses osteoclast differentiation and osteolytic bone destruction in a bone metastasis model.",
            "journal": "Molecular cancer therapeutics",
            "date": "2006-11",
            "authors": "Ohno Hiroaki, Kubo Kazuo, Murooka Hideko, Kobayashi Yoshiko, Nishitoba Tsuyoshi, Shibuya Masabumi, Yoneda Toshiyuki, Isoe Toshiyuki",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17121910",
                    "url": "https://glygen.org/publication/PubMed/17121910"
                }
            ]
        },
        {
            "title": "Crystal structure of the tyrosine kinase domain of colony-stimulating factor-1 receptor (cFMS) in complex with two inhibitors.",
            "journal": "J. Biol. Chem.",
            "date": "2007",
            "authors": "Schubert Carsten, Schalk-Hihi C\u00e9line, Struble Geoffrey T, Ma Hong-Chang, Petrounia Ioanna P, Brandt Benjamin, Deckman Ingrid C, Patch Raymond J, Player Mark R, Spurlino John C, Springer Barry A",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17132624",
                    "url": "https://glygen.org/publication/PubMed/17132624"
                }
            ]
        },
        {
            "title": "The 2.7 A crystal structure of the autoinhibited human c-Fms kinase domain.",
            "journal": "J. Mol. Biol.",
            "date": "2007",
            "authors": "Walter Mark, Lucet Isabelle S, Patel Onisha, Broughton Sophie E, Bamert Rebecca, Williams Neal K, Fantino Emmanuelle, Wilks Andrew F, Rossjohn Jamie",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17292918",
                    "url": "https://glygen.org/publication/PubMed/17292918"
                }
            ]
        },
        {
            "title": "Patterns of somatic mutation in human cancer genomes.",
            "journal": "Nature",
            "date": "2007",
            "authors": "Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17344846",
                    "url": "https://glygen.org/publication/PubMed/17344846"
                }
            ]
        },
        {
            "title": "Myc rescue of a mutant CSF-1 receptor impaired in mitogenic signalling.",
            "journal": "Nature",
            "date": "1991",
            "authors": "Roussel MF, Cleveland JL, Shurtleff SA, Sherr CJ",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P07333-1",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333-1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "1833648",
                    "url": "https://glygen.org/publication/PubMed/1833648"
                }
            ]
        },
        {
            "title": "Design and synthesis of a pyrido[2,3-d]pyrimidin-5-one class of anti-inflammatory FMS inhibitors.",
            "journal": "Bioorg. Med. Chem. Lett.",
            "date": "2008",
            "authors": "Huang Hui, Hutta Daniel A, Hu Huaping, DesJarlais Renee L, Schubert Carsten, Petrounia Ioanna P, Chaikin Margery A, Manthey Carl L, Player Mark R",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18342505",
                    "url": "https://glygen.org/publication/PubMed/18342505"
                }
            ]
        },
        {
            "title": "Discovery of a cytokine and its receptor by functional screening of the extracellular proteome.",
            "journal": "Science (New York, N.Y.)",
            "date": "2008",
            "authors": "Lin H, Lee E, Hestir K, Leo C, Huang M, Bosch E, Halenbeck R, Wu G, Zhou A, Behrens D, Hollenbaugh D, Linnemann T, Qin M, Wong J, Chu K, Doberstein SK, Williams LT",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-449836",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18467591",
                    "url": "https://glygen.org/publication/PubMed/18467591"
                }
            ]
        },
        {
            "title": "Novel splice variants derived from the receptor tyrosine kinase superfamily are potential therapeutics for rheumatoid arthritis.",
            "journal": "Arthritis Res. Ther.",
            "date": "2008",
            "authors": "Jin P, Zhang J, Sumariwalla PF, Ni I, Jorgensen B, Crawford D, Phillips S, Feldmann M, Shepard HM, Paleolog EM",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18593464",
                    "url": "https://glygen.org/publication/PubMed/18593464"
                }
            ]
        },
        {
            "title": "Macrophage colony stimulating factor: not just for macrophages anymore! A gateway into complex biologies.",
            "journal": "Int. Immunopharmacol.",
            "date": "2008",
            "authors": "Douglass Thomas G, Driggers Lara, Zhang Jian Gang, Hoa Neil, Delgado Christina, Williams Christopher C, Dan Qinhong, Sanchez Ramon, Jeffes Edward W B, Wepsic H Terry, Myers Michael P, Koths Kirston, Jadus Martin R",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18687298",
                    "url": "https://glygen.org/publication/PubMed/18687298"
                }
            ]
        },
        {
            "title": "Imatinib mesylate suppresses bone metastases of breast cancer by inhibiting osteoclasts through the blockade of c-Fms signals.",
            "journal": "International journal of cancer",
            "date": "2009-01-01",
            "authors": "Hiraga Toru, Nakamura Hiroaki",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18814279",
                    "url": "https://glygen.org/publication/PubMed/18814279"
                }
            ]
        },
        {
            "title": "Blood monocytes: development, heterogeneity, and relationship with dendritic cells.",
            "journal": "Annu. Rev. Immunol.",
            "date": "2009",
            "authors": "Auffray Cedric, Sieweke Michael H, Geissmann Frederic",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19132917",
                    "url": "https://glygen.org/publication/PubMed/19132917"
                }
            ]
        },
        {
            "title": "Pyrido[2,3-d]pyrimidin-5-ones: a novel class of antiinflammatory macrophage colony-stimulating factor-1 receptor inhibitors.",
            "journal": "Journal of medicinal chemistry",
            "date": "2009-02-26",
            "authors": "Huang Hui, Hutta Daniel A, Rinker James M, Hu Huaping, Parsons William H, Schubert Carsten, DesJarlais Renee L, Crysler Carl S, Chaikin Margery A, Donatelli Robert R, Chen Yanmin, Cheng Deping, Zhou Zhao, Yurkow Edward, Manthey Carl L, Player Mark R",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19193011",
                    "url": "https://glygen.org/publication/PubMed/19193011"
                }
            ]
        },
        {
            "title": "Large-scale proteomics analysis of the human kinome.",
            "journal": "Molecular & cellular proteomics : MCP",
            "date": "2009",
            "authors": "Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                },
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19369195",
                    "url": "https://glygen.org/publication/PubMed/19369195"
                }
            ]
        },
        {
            "title": "Invasion of human breast cancer cells in vivo requires both paracrine and autocrine loops involving the colony-stimulating factor-1 receptor.",
            "journal": "Cancer research",
            "date": "2009-12-15",
            "authors": "Patsialou Antonia, Wyckoff Jeffrey, Wang Yarong, Goswami Sumanta, Stanley E Richard, Condeelis John S",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19934330",
                    "url": "https://glygen.org/publication/PubMed/19934330"
                }
            ]
        },
        {
            "title": "VentX, a novel lymphoid-enhancing factor/T-cell factor-associated transcription repressor, is a putative tumor suppressor.",
            "journal": "Cancer research",
            "date": "2010",
            "authors": "Gao H, Le Y, Wu X, Silberstein LE, Giese RW, Zhu Z",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-8853884",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8853884"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20028861",
                    "url": "https://glygen.org/publication/PubMed/20028861"
                }
            ]
        },
        {
            "title": "Structure-based drug design enables conversion of a DFG-in binding CSF-1R kinase inhibitor to a DFG-out binding mode.",
            "journal": "Bioorg. Med. Chem. Lett.",
            "date": "2010",
            "authors": "Meyers Marvin J, Pelc Matthew, Kamtekar Satwik, Day Jacqueline, Poda Gennadiy I, Hall Molly K, Michener Marshall L, Reitz Beverly A, Mathis Karl J, Pierce Betsy S, Parikh Mihir D, Mischke Deborah A, Long Scott A, Parlow John J, Anderson David R, Thorarensen Atli",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20137931",
                    "url": "https://glygen.org/publication/PubMed/20137931"
                }
            ]
        },
        {
            "title": "Colony stimulating factor-1 receptor as a target for small molecule inhibitors.",
            "journal": "Bioorg. Med. Chem.",
            "date": "2010",
            "authors": "Mashkani Baratali, Griffith Renate, Ashman Leonie K",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20156689",
                    "url": "https://glygen.org/publication/PubMed/20156689"
                }
            ]
        },
        {
            "title": "IL-34 and M-CSF share the receptor Fms but are not identical in biological activity and signal activation.",
            "journal": "Cell death and differentiation",
            "date": "2010",
            "authors": "Chihara T, Suzu S, Hassan R, Chutiwitoonchai N, Hiyoshi M, Motoyoshi K, Kimura F, Okada S",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-9680350",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350"
                },
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20489731",
                    "url": "https://glygen.org/publication/PubMed/20489731"
                }
            ]
        },
        {
            "title": "Functional overlap but differential expression of CSF-1 and IL-34 in their CSF-1 receptor-mediated regulation of myeloid cells.",
            "journal": "Journal of leukocyte biology",
            "date": "2010",
            "authors": "Wei S, Nandi S, Chitu V, Yeung YG, Yu W, Huang M, Williams LT, Lin H, Stanley ER",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20504948",
                    "url": "https://glygen.org/publication/PubMed/20504948"
                }
            ]
        },
        {
            "title": "Macrophage-colony stimulating factor and interleukin-34 induce chemokines in human whole blood.",
            "journal": "Cytokine",
            "date": "2010-12",
            "authors": "Eda Hiroyuki, Zhang Jian, Keith Robert H, Michener Marshall, Beidler David R, Monahan Joseph B",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20829061",
                    "url": "https://glygen.org/publication/PubMed/20829061"
                }
            ]
        },
        {
            "title": "Profiling Y561-dependent and -independent substrates of CSF-1R in epithelial cells.",
            "journal": "PloS one",
            "date": "2010",
            "authors": "Knowlton ML, Selfors LM, Wrobel CN, Gu TL, Ballif BA, Gygi SP, Polakiewicz R, Brugge JS",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9680350",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350"
                },
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21049007",
                    "url": "https://glygen.org/publication/PubMed/21049007"
                }
            ]
        },
        {
            "title": "Macrophage colony-stimulating factor and its receptor signaling augment glycated albumin-induced retinal microglial inflammation in vitro.",
            "journal": "BMC cell biology",
            "date": "2011",
            "authors": "Liu W, Xu GZ, Jiang CH, Tian J",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21266043",
                    "url": "https://glygen.org/publication/PubMed/21266043"
                }
            ]
        },
        {
            "title": "VentX trans-activates p53 and p16ink4a to regulate cellular senescence.",
            "journal": "The Journal of biological chemistry",
            "date": "2011",
            "authors": "Wu X, Gao H, Ke W, Hager M, Xiao S, Freeman MR, Zhu Z",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-8853884",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8853884"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21325273",
                    "url": "https://glygen.org/publication/PubMed/21325273"
                }
            ]
        },
        {
            "title": "Expression cloning of a human granulocyte colony-stimulating factor receptor: a structural mosaic of hematopoietin receptor, immunoglobulin, and fibronectin domains.",
            "journal": "The Journal of experimental medicine",
            "date": "1990",
            "authors": "Larsen A, Davis T, Curtis BM, Gimpel S, Sims JE, Cosman D, Park L, Sorensen E, March CJ, Smith CA",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-449836",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "2147944",
                    "url": "https://glygen.org/publication/PubMed/2147944"
                }
            ]
        },
        {
            "title": "The homeobox transcription factor VentX controls human macrophage terminal differentiation and proinflammatory activation.",
            "journal": "The Journal of clinical investigation",
            "date": "2011",
            "authors": "Wu X, Gao H, Ke W, Giese RW, Zhu Z",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-8853884",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8853884"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21670496",
                    "url": "https://glygen.org/publication/PubMed/21670496"
                }
            ]
        },
        {
            "title": "A point mutation at tyrosine-809 in the human colony-stimulating factor 1 receptor impairs mitogenesis without abrogating tyrosine kinase activity, association with phosphatidylinositol 3-kinase, or induction of c-fos and junB genes.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "1990",
            "authors": "Roussel MF, Shurtleff SA, Downing JR, Sherr CJ",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "2168557",
                    "url": "https://glygen.org/publication/PubMed/2168557"
                }
            ]
        },
        {
            "title": "A cytokine gene screen uncovers SOCS1 as genetic risk factor for multiple sclerosis.",
            "journal": "Genes and immunity",
            "date": "2012",
            "authors": "Vandenbroeck K, Alvarez J, Swaminathan B, Alloza I, Matesanz F, Urcelay E, Comabella M, Alcina A, Fedetz M, Ortiz MA, Izquierdo G, Fernandez O, Rodriguez-Ezpeleta N, Matute C, Caillier S, Arroyo R, Montalban X, Oksenberg JR, Antiguedad A, Aransay A",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-449836",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21716315",
                    "url": "https://glygen.org/publication/PubMed/21716315"
                }
            ]
        },
        {
            "title": "Colony-stimulating factor 1 activates protein kinase C in human monocytes.",
            "journal": "The EMBO journal",
            "date": "1990",
            "authors": "Imamura K, Dianoux A, Nakamura T, Kufe D",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9680350",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "2196173",
                    "url": "https://glygen.org/publication/PubMed/2196173"
                }
            ]
        },
        {
            "title": "Extracellular complexes of the hematopoietic human and mouse CSF-1 receptor are driven by common assembly principles.",
            "journal": "Structure (London, England : 1993)",
            "date": "2011",
            "authors": "Elegheert J, Desfosses A, Shkumatov AV, Wu X, Bracke N, Verstraete K, Van Craenenbroeck K, Brooks BR, Svergun DI, Vergauwen B, Gutsche I, Savvides SN",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9680350",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22153499",
                    "url": "https://glygen.org/publication/PubMed/22153499"
                }
            ]
        },
        {
            "title": "Mutations in the colony stimulating factor 1 receptor (CSF1R) gene cause hereditary diffuse leukoencephalopathy with spheroids.",
            "journal": "Nature genetics",
            "date": "2011",
            "authors": "Rademakers R, Baker M, Nicholson AM, Rutherford NJ, Finch N, Soto-Ortolaza A, Lash J, Wider C, Wojtas A, DeJesus-Hernandez M, Adamson J, Kouri N, Sundal C, Shuster EA, Aasly J, MacKenzie J, Roeber S, Kretzschmar HA, Boeve BF, Knopman DS, Petersen RC, Cairns NJ, Ghetti B, Spina S, Garbern J, Tselis AC, Uitti R, Das P, Van Gerpen JA, Meschia JF, Levy S, Broderick DF, Graff-Radford N, Ross OA, Miller BB, Swerdlow RH, Dickson DW, Wszolek ZK",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22197934",
                    "url": "https://glygen.org/publication/PubMed/22197934"
                }
            ]
        },
        {
            "title": "Structural basis for the dual recognition of helical cytokines IL-34 and CSF-1 by CSF-1R.",
            "journal": "Structure (London, England : 1993)",
            "date": "2012",
            "authors": "Ma X, Lin WY, Chen Y, Stawicki S, Mukhyala K, Wu Y, Martin F, Bazan JF, Starovasnik MA",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9680350",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22483114",
                    "url": "https://glygen.org/publication/PubMed/22483114"
                }
            ]
        },
        {
            "title": "Cloning and expression of porcine Colony Stimulating Factor-1 (CSF-1) and Colony Stimulating Factor-1 Receptor (CSF-1R) and analysis of the species specificity of stimulation by CSF-1 and Interleukin 34.",
            "journal": "Cytokine",
            "date": "2012",
            "authors": "Gow DJ, Garceau V, Kapetanovic R, Sester DP, Fici GJ, Shelly JA, Wilson TL, Hume DA",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22974529",
                    "url": "https://glygen.org/publication/PubMed/22974529"
                }
            ]
        },
        {
            "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.",
            "journal": "Molecular & cellular proteomics : MCP",
            "date": "2013",
            "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M",
            "evidence": [
                {
                    "database": "GlyGen",
                    "id": "GLY_000143",
                    "url": "https://data.glygen.org/GLY_000143"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23090970",
                    "url": "https://glygen.org/publication/PubMed/23090970"
                }
            ]
        },
        {
            "title": "A variant upstream of IFNL3 (IL28B) creating a new interferon gene IFNL4 is associated with impaired clearance of hepatitis C virus.",
            "journal": "Nature genetics",
            "date": "2013",
            "authors": "Prokunina-Olsson L, Muchmore B, Tang W, Pfeiffer RM, Park H, Dickensheets H, Hergott D, Porter-Gill P, Mumy A, Kohaar I, Chen S, Brand N, Tarway M, Liu L, Sheikh F, Astemborski J, Bonkovsky HL, Edlin BR, Howell CD, Morgan TR, Thomas DL, Rehermann B, Donnelly RP, O'Brien TR",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-449836",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23291588",
                    "url": "https://glygen.org/publication/PubMed/23291588"
                }
            ]
        },
        {
            "title": "CSF1R mutations link POLD and HDLS as a single disease entity.",
            "journal": "Neurology",
            "date": "2013",
            "authors": "Nicholson AM, Baker MC, Finch NA, Rutherford NJ, Wider C, Graff-Radford NR, Nelson PT, Clark HB, Wszolek ZK, Dickson DW, Knopman DS, Rademakers R",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23408870",
                    "url": "https://glygen.org/publication/PubMed/23408870"
                }
            ]
        },
        {
            "title": "Receptor-type protein-tyrosine phosphatase zeta is a functional receptor for interleukin-34.",
            "journal": "The Journal of biological chemistry",
            "date": "2013",
            "authors": "Nandi S, Cioce M, Yeung YG, Nieves E, Tesfa L, Lin H, Hsu AW, Halenbeck R, Cheng HY, Gokhan S, Mehler MF, Stanley ER",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-449836",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23744080",
                    "url": "https://glygen.org/publication/PubMed/23744080"
                }
            ]
        },
        {
            "title": "A unique anti-CD115 monoclonal antibody which inhibits osteolysis and skews human monocyte differentiation from M2-polarized macrophages toward dendritic cells.",
            "journal": "mAbs",
            "date": "2013",
            "authors": "Haegel H, Thioudellet C, Hallet R, Geist M, Menguy T, Le Pogam F, Marchand JB, Toh ML, Duong V, Calcei A, Settelen N, Preville X, Hennequi M, Grellier B, Ancian P, Rissanen J, Clayette P, Guillen C, Rooke R, Bonnefoy JY",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23924795",
                    "url": "https://glygen.org/publication/PubMed/23924795"
                }
            ]
        },
        {
            "title": "CSF1 is a novel p53 target gene whose protein product functions in a feed-forward manner to suppress apoptosis and enhance p53-mediated growth arrest.",
            "journal": "PloS one",
            "date": "2013",
            "authors": "Azzam G, Wang X, Bell D, Murphy ME",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24019961",
                    "url": "https://glygen.org/publication/PubMed/24019961"
                }
            ]
        },
        {
            "title": "Structural alteration of viral homologue of receptor proto-oncogene fms at carboxyl terminus.",
            "journal": "Nature",
            "date": "1986",
            "authors": "Coussens L, Van Beveren C, Smith D, Chen E, Mitchell R L, Isacke C M, Verma I M, Ullrich A",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "2421165",
                    "url": "https://glygen.org/publication/PubMed/2421165"
                }
            ]
        },
        {
            "title": "Haploinsufficiency of CSF-1R and clinicopathologic characterization in patients with HDLS.",
            "journal": "Neurology",
            "date": "2014",
            "authors": "Konno T, Tada M, Tada M, Koyama A, Nozaki H, Harigaya Y, Nishimiya J, Matsunaga A, Yoshikura N, Ishihara K, Arakawa M, Isami A, Okazaki K, Yokoo H, Itoh K, Yoneda M, Kawamura M, Inuzuka T, Takahashi H, Nishizawa M, Onodera O, Kakita A, Ikeuchi T",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                },
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24336230",
                    "url": "https://glygen.org/publication/PubMed/24336230"
                }
            ]
        },
        {
            "title": "Hereditary diffuse leukoencephalopathy with axonal spheroids: three patients with stroke-like presentation carrying new mutations in the CSF1R gene.",
            "journal": "Journal of neurology",
            "date": "2014",
            "authors": "Battisti C, Di Donato I, Bianchi S, Monti L, Formichi P, Rufa A, Taglia I, Cerase A, Dotti MT, Federico A",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24532199",
                    "url": "https://glygen.org/publication/PubMed/24532199"
                }
            ]
        },
        {
            "title": "Homeobox transcription factor VentX regulates differentiation and maturation of human dendritic cells.",
            "journal": "The Journal of biological chemistry",
            "date": "2014",
            "authors": "Wu X, Gao H, Bleday R, Zhu Z",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-8853884",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8853884"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24706756",
                    "url": "https://glygen.org/publication/PubMed/24706756"
                }
            ]
        },
        {
            "title": "CSF-1 receptor signaling in myeloid cells.",
            "journal": "Cold Spring Harbor perspectives in biology",
            "date": "2014",
            "authors": "Stanley ER, Chitu V",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9680350",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24890514",
                    "url": "https://glygen.org/publication/PubMed/24890514"
                }
            ]
        },
        {
            "title": "Nucleotide sequence and structural organization of the human FMS proto-oncogene.",
            "journal": "Oncogene Res.",
            "date": "1989",
            "authors": "Hampe A, Shamoon B M, Gobet M, Sherr C J, Galibert F",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "2524025",
                    "url": "https://glygen.org/publication/PubMed/2524025"
                }
            ]
        },
        {
            "title": "Differential transcription of exon 1 of the human c-fms gene in placental trophoblasts and monocytes.",
            "journal": "Mol. Cell. Biol.",
            "date": "1989",
            "authors": "Visvader J, Verma I M",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "2524648",
                    "url": "https://glygen.org/publication/PubMed/2524648"
                }
            ]
        },
        {
            "title": "Syndecan-1 regulates the biological activities of interleukin-34.",
            "journal": "Biochimica et biophysica acta",
            "date": "2015",
            "authors": "Segaliny AI, Brion R, Mortier E, Maillasson M, Cherel M, Jacques Y, Le Goff B, Heymann D",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-449836",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25662098",
                    "url": "https://glygen.org/publication/PubMed/25662098"
                }
            ]
        },
        {
            "title": "The PRKAA1/AMPKalpha1 pathway triggers autophagy during CSF1-induced human monocyte differentiation and is a potential target in CMML.",
            "journal": "Autophagy",
            "date": "2015",
            "authors": "Obba S, Hizir Z, Boyer L, Selimoglu-Buet D, Pfeifer A, Michel G, Hamouda MA, Goncalves D, Cerezo M, Marchetti S, Rocchi S, Droin N, Cluzeau T, Robert G, Luciano F, Robaye B, Foretz M, Viollet B, Legros L, Solary E, Auberger P, Jacquel A",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9680350",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "26029847",
                    "url": "https://glygen.org/publication/PubMed/26029847"
                }
            ]
        },
        {
            "title": "IL-34 and M-CSF form a novel heteromeric cytokine and regulate the M-CSF receptor activation and localization.",
            "journal": "Cytokine",
            "date": "2015",
            "authors": "Segaliny AI, Brion R, Brulin B, Maillasson M, Charrier C, Teletchea S, Heymann D",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-449836",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "26095744",
                    "url": "https://glygen.org/publication/PubMed/26095744"
                }
            ]
        },
        {
            "title": "Structure and Assembly Mechanism of the Signaling Complex Mediated by Human CSF-1.",
            "journal": "Structure (London, England : 1993)",
            "date": "2015",
            "authors": "Felix J, De Munck S, Verstraete K, Meuris L, Callewaert N, Elegheert J, Savvides SN",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9680350",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "26235028",
                    "url": "https://glygen.org/publication/PubMed/26235028"
                }
            ]
        },
        {
            "title": "Large-scale intact glycopeptide identification by Mascot database search.",
            "journal": "Scientific reports",
            "date": "2018",
            "authors": "Bollineni RC, Koehler CJ, Gislefoss RE, Anonsen JH, Thiede B",
            "evidence": [
                {
                    "database": "GlyConnect",
                    "id": "1955",
                    "url": "https://glyconnect.expasy.org/browser/proteins/1955"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29391424",
                    "url": "https://glygen.org/publication/PubMed/29391424"
                }
            ]
        },
        {
            "title": "Differential prognostic impact of interleukin-34 mRNA expression and infiltrating immune cell composition in intrinsic breast cancer subtypes.",
            "journal": "Oncotarget",
            "date": "2018-05-01",
            "authors": "Zins Karin, Heller Gerwin, Mayerhofer Mathias, Schreiber Martin, Abraham Dietmar",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29796177",
                    "url": "https://glygen.org/publication/PubMed/29796177"
                }
            ]
        },
        {
            "title": "Identification and functional characterization of novel mutations including frameshift mutation in exon 4 of CSF1R in patients with adult-onset leukoencephalopathy with axonal spheroids and pigmented glia.",
            "journal": "Journal of neurology",
            "date": "2018",
            "authors": "Miura T, Mezaki N, Konno T, Iwasaki A, Hara N, Miura M, Funayama M, Unai Y, Tashiro Y, Okita K, Kihara T, Ito N, Kanatsuka Y, Jones DT, Hara N, Ishiguro T, Tokutake T, Kasuga K, Nozaki H, Dickson DW, Onodera O, Wszolek ZK, Ikeuchi T",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "30136118",
                    "url": "https://glygen.org/publication/PubMed/30136118"
                }
            ]
        },
        {
            "title": "Homozygous Mutations in CSF1R Cause a Pediatric-Onset Leukoencephalopathy and Can Result in Congenital Absence of Microglia.",
            "journal": "American journal of human genetics",
            "date": "2019",
            "authors": "Oosterhof N, Chang IJ, Karimiani EG, Kuil LE, Jensen DM, Daza R, Young E, Astle L, van der Linde HC, Shivaram GM, Demmers J, Latimer CS, Keene CD, Loter E, Maroofian R, van Ham TJ, Hevner RF, Bennett JT",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "30982608",
                    "url": "https://glygen.org/publication/PubMed/30982608"
                }
            ]
        },
        {
            "title": "Bi-allelic CSF1R Mutations Cause Skeletal Dysplasia of Dysosteosclerosis-Pyle Disease Spectrum and Degenerative Encephalopathy with Brain Malformation.",
            "journal": "American journal of human genetics",
            "date": "2019",
            "authors": "Guo L, Bertola DR, Takanohashi A, Saito A, Segawa Y, Yokota T, Ishibashi S, Nishida Y, Yamamoto GL, Franco JFDS, Honjo RS, Kim CA, Musso CM, Timmons M, Pizzino A, Taft RJ, Lajoie B, Knight MA, Fischbeck KH, Singleton AB, Ferreira CR, Wang Z, Yan L, Garbern JY, Simsek-Kiper PO, Ohashi H, Robey PG, Boyde A, Matsumoto N, Miyake N, Spranger J, Schiffmann R, Vanderver A, Nishimura G, Passos-Bueno MRDS, Simons C, Ishikawa K, Ikegawa S",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "30982609",
                    "url": "https://glygen.org/publication/PubMed/30982609"
                }
            ]
        },
        {
            "title": "Clinicopathologic characterization and abnormal autophagy of CSF1R-related leukoencephalopathy.",
            "journal": "Translational neurodegeneration",
            "date": "2019",
            "authors": "Tian Wo-Tu, Zhan Fei-Xia, Liu Qing, Luan Xing-Hua, Zhang Chao, Shang Liang, Zhang Ben-Yan, Pan Si-Jian, Miao Fei, Hu Jiong, Zhong Ping, Liu Shi-Hua, Zhu Ze-Yu, Zhou Hai-Yan, Sun Suya, Liu Xiao-Li, Huang Xiao-Jun, Jiang Jing-Wen, Ma Jian-Fang, Wang Ying, Chen Shu-Fen, Tang Hui-Dong, Chen Sheng-Di, Cao Li",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "31827782",
                    "url": "https://glygen.org/publication/PubMed/31827782"
                }
            ]
        },
        {
            "title": "The amino-terminal domain of the v-fms oncogene product includes a functional signal peptide that directs synthesis of a transforming glycoprotein in the absence of feline leukemia virus gag sequences.",
            "journal": "J. Virol.",
            "date": "1986",
            "authors": "Wheeler E F, Roussel M F, Hampe A, Walker M H, Fried V A, Look A T, Rettenmier C W, Sherr C J",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "3525854",
                    "url": "https://glygen.org/publication/PubMed/3525854"
                }
            ]
        },
        {
            "title": "'Replacement' of COOH-terminal truncation of v-fms with c-fms sequences markedly reduces transformation potential.",
            "journal": "Proc. Natl. Acad. Sci. U.S.A.",
            "date": "1986",
            "authors": "Browning P J, Bunn H F, Cline A, Shuman M, Nienhuis A W",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "3532121",
                    "url": "https://glygen.org/publication/PubMed/3532121"
                }
            ]
        },
        {
            "title": "Upregulation of APAF1 and CSF1R in Peripheral Blood Mononuclear Cells of Parkinson's Disease.",
            "journal": "International journal of molecular sciences",
            "date": "2023-04-12",
            "authors": "Chang Kuo-Hsuan, Liu Chia-Hsin, Wang Yi-Ru, Lo Yen-Shi, Chang Chun-Wei, Wu Hsiu-Chuan, Chen Chiung-Mei",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001275634",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001275634"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "37108258",
                    "url": "https://glygen.org/publication/PubMed/37108258"
                }
            ]
        },
        {
            "title": "CSF1R regulates schizophrenia-related stress response and vascular association of microglia/macrophages.",
            "journal": "BMC medicine",
            "date": "2023-08-04",
            "authors": "Yan Ling, Li Yanli, Fan Fengmei, Gou Mengzhuang, Xuan Fangling, Feng Wei, Chithanathan Keerthana, Li Wei, Huang Junchao, Li Hongna, Chen Wenjin, Tian Baopeng, Wang Zhiren, Tan Shuping, Zharkovsky Alexander, Hong L Elliot, Tan Yunlong, Tian Li",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001275634",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001275634"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "37542262",
                    "url": "https://glygen.org/publication/PubMed/37542262"
                }
            ]
        },
        {
            "title": "The role of CD14 and CSF1R in osteoarthritis and gastritis.",
            "journal": "Medicine",
            "date": "2023-10-27",
            "authors": "Zheng Meiliang, Li Zheng, Feng Yingfa, Hou Shiyang, Zhang Jie, Kang Chunbo",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001275634",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001275634"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "37904379",
                    "url": "https://glygen.org/publication/PubMed/37904379"
                }
            ]
        },
        {
            "title": "CSF1R-dependent macrophages in the salivary gland are essential for epithelial regeneration after radiation-induced injury.",
            "journal": "Science immunology",
            "date": "2023-11-03",
            "authors": "McKendrick John G, Jones Gareth-Rhys, Elder Sonia S, Watson Erin, T'Jonck Wouter, Mercer Ella, Magalhaes Marlene S, Rocchi Cecilia, Hegarty Lizi M, Johnson Amanda L, Schneider Christoph, Becher Burkhard, Pridans Clare, Mabbott Neil, Liu Zhaoyuan, Ginhoux Florent, Bajenoff Marc, Gentek Rebecca, Bain Calum C, Emmerson Elaine",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001275634",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001275634"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "37922341",
                    "url": "https://glygen.org/publication/PubMed/37922341"
                }
            ]
        },
        {
            "title": "Expression of the human c-fms proto-oncogene in hematopoietic cells and its deletion in the 5q- syndrome.",
            "journal": "Cell",
            "date": "1985",
            "authors": "Nienhuis A W, Bunn H F, Turner P H, Gopal T V, Nash W G, O'Brien S J, Sherr C J",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "4028159",
                    "url": "https://glygen.org/publication/PubMed/4028159"
                }
            ]
        },
        {
            "title": "Colony-stimulating factor 1-induced STAT1 and STAT3 activation is accompanied by phosphorylation of Tyk2 in macrophages and Tyk2 and JAK1 in fibroblasts.",
            "journal": "Blood",
            "date": "1995",
            "authors": "Novak U, Harpur AG, Paradiso L, Kanagasundaram V, Jaworowski A, Wilks AF, Hamilton JA",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7579387",
                    "url": "https://glygen.org/publication/PubMed/7579387"
                }
            ]
        },
        {
            "title": "Stimulation of human monocytes with macrophage colony-stimulating factor induces a Grb2-mediated association of the focal adhesion kinase pp125FAK and dynamin.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "1995",
            "authors": "Kharbanda S, Saleem A, Yuan Z, Emoto Y, Prasad KV, Kufe D",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9680350",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7597091",
                    "url": "https://glygen.org/publication/PubMed/7597091"
                }
            ]
        },
        {
            "title": "The CD4-associated tyrosine kinase p56lck is required for lymphocyte chemoattractant factor-induced T lymphocyte migration.",
            "journal": "The Journal of biological chemistry",
            "date": "1995",
            "authors": "Ryan TC, Cruikshank WW, Kornfeld H, Collins TL, Center DM",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-449836",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7615501",
                    "url": "https://glygen.org/publication/PubMed/7615501"
                }
            ]
        },
        {
            "title": "Activation of Src family kinases by colony stimulating factor-1, and their association with its receptor.",
            "journal": "The EMBO journal",
            "date": "1993",
            "authors": "Courtneidge SA, Dhand R, Pilat D, Twamley GM, Waterfield MD, Roussel MF",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-9680350",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350"
                },
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7681396",
                    "url": "https://glygen.org/publication/PubMed/7681396"
                }
            ]
        },
        {
            "title": "Expression of human colony-stimulating factor-1 (CSF-1) receptor in murine pluripotent hematopoietic NFS-60 cells induces long-term proliferation in response to CSF-1 without loss of erythroid differentiation potential.",
            "journal": "Blood",
            "date": "1993-05-15",
            "authors": "Bourette R P, Mouchiroud G, Ouazana R, Morl\u00e9 F, Godet J, Blanchet J P",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7683918",
                    "url": "https://glygen.org/publication/PubMed/7683918"
                }
            ]
        },
        {
            "title": "Sequence requirements for binding of Src family tyrosine kinases to activated growth factor receptors.",
            "journal": "The Journal of biological chemistry",
            "date": "1995",
            "authors": "Alonso G, Koegl M, Mazurenko N, Courtneidge SA",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7730365",
                    "url": "https://glygen.org/publication/PubMed/7730365"
                }
            ]
        },
        {
            "title": "Monocyte colony-stimulating factor stimulates binding of phosphatidylinositol 3-kinase to Grb2.Sos complexes in human monocytes.",
            "journal": "The Journal of biological chemistry",
            "date": "1995",
            "authors": "Saleem A, Kharbanda S, Yuan ZM, Kufe D",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9680350",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7737969",
                    "url": "https://glygen.org/publication/PubMed/7737969"
                }
            ]
        },
        {
            "title": "Evidence for the ligand-induced conversion from a dimer to a tetramer of the granulocyte colony-stimulating factor receptor.",
            "journal": "FEBS letters",
            "date": "1994",
            "authors": "Hiraoka O, Anaguchi H, Ota Y",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-449836",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7805849",
                    "url": "https://glygen.org/publication/PubMed/7805849"
                }
            ]
        },
        {
            "title": "Transcriptional regulation of the c-fms (CSF-1R) proto-oncogene in human breast carcinoma cells by glucocorticoids.",
            "journal": "Oncogene",
            "date": "1995",
            "authors": "Sapi E, Flick M B, Gilmore-Hebert M, Rodov S, Kacinski B M",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7845678",
                    "url": "https://glygen.org/publication/PubMed/7845678"
                }
            ]
        },
        {
            "title": "Identification of the ligand-binding regions in the macrophage colony-stimulating factor receptor extracellular domain.",
            "journal": "Molecular and cellular biology",
            "date": "1993",
            "authors": "Wang ZE, Myles GM, Brandt CS, Lioubin MN, Rohrschneider L",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9680350",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8355686",
                    "url": "https://glygen.org/publication/PubMed/8355686"
                }
            ]
        },
        {
            "title": "Growth and differentiation signals regulated by the M-CSF receptor.",
            "journal": "Molecular reproduction and development",
            "date": "1997",
            "authors": "Rohrschneider LR, Bourette RP, Lioubin MN, Algate PA, Myles GM, Carlberg K",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9680350",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8981370",
                    "url": "https://glygen.org/publication/PubMed/8981370"
                }
            ]
        },
        {
            "title": "Sequence analysis of two genomic regions containing the KIT and the FMS receptor tyrosine kinase genes.",
            "journal": "Genomics",
            "date": "1997",
            "authors": "Andre C, Hampe A, Lachaume P, Martin E, Wang X P, Manus V, Hu W X, Galibert F",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9027509",
                    "url": "https://glygen.org/publication/PubMed/9027509"
                }
            ]
        },
        {
            "title": "Recognition of activated CSF-1 receptor in breast carcinomas by a tyrosine 723 phosphospecific antibody.",
            "journal": "Oncogene",
            "date": "1997",
            "authors": "Flick MB, Sapi E, Perrotta PL, Maher MG, Halaban R, Carter D, Kacinski BM",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P07333-1",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333-1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9191055",
                    "url": "https://glygen.org/publication/PubMed/9191055"
                }
            ]
        },
        {
            "title": "Bryostatin 1 (bryo1)-induced monocytic differentiation in THP-1 human leukemia cells is associated with enhanced c-fyn tyrosine kinase and M-CSF receptors.",
            "journal": "Leukemia research",
            "date": "1997",
            "authors": "Li Y, Mohammad RM, al-Katib A, Varterasian ML, Chen B",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9680350",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9225065",
                    "url": "https://glygen.org/publication/PubMed/9225065"
                }
            ]
        },
        {
            "title": "Sequential activation of phoshatidylinositol 3-kinase and phospholipase C-gamma2 by the M-CSF receptor is necessary for differentiation signaling.",
            "journal": "The EMBO journal",
            "date": "1997",
            "authors": "Bourette RP, Myles GM, Choi JL, Rohrschneider LR",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P07333",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07333"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9312046",
                    "url": "https://glygen.org/publication/PubMed/9312046"
                }
            ]
        },
        {
            "title": "Processing and activation of pro-interleukin-16 by caspase-3.",
            "journal": "The Journal of biological chemistry",
            "date": "1998",
            "authors": "Zhang Y, Center DM, Wu DM, Cruikshank WW, Yuan J, Andrews DW, Kornfeld H",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-449836",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9422780",
                    "url": "https://glygen.org/publication/PubMed/9422780"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "hsa:1436",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1436",
            "resource": "KEGG Pathway"
        },
        {
            "id": "R-HSA-449836",
            "name": "Other interleukin signaling",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836",
            "resource": "Reactome",
            "description": "Other interleukin signaling"
        },
        {
            "id": "R-HSA-8853884",
            "name": "Transcriptional Regulation by VENTX",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8853884",
            "resource": "Reactome",
            "description": "Transcriptional Regulation by VENTX"
        },
        {
            "id": "R-HSA-9680350",
            "name": "Signaling by CSF1 (M-CSF) in myeloid cells",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680350",
            "resource": "Reactome",
            "description": "Signaling by CSF1 (M-CSF) in myeloid cells"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "P09581-1",
            "protein_name": "Macrophage colony-stimulating factor 1 receptor",
            "gene_name": "Csf1r",
            "tax_id": 10090,
            "organism": "Mus musculus",
            "sequence": {
                "sequence": "MELGPPLVLLLATVWHGQGAPVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDESLFTPVVVACMSVMSLLVLLLLLLLYKYKQKPKYQVRWKIIERYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDSEGDSSYKNIHLEKKYVRRDSGFSSQGVDTYVEMRPVSTSSSDSFFKQDLDKEASRPLELWDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTSGHVAKIGDFGLARDIMNDSNYVVKGNARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNNKFYKLVKDGYQMAQPVFAPKNIYSIMQSCWDLEPTRRPTFQQICFLLQEQARLERRDQDYANLPSSGGSSGSDSGGGSSGGSSSEPEEESSSEHLACCEPGDIAQPLLQPNNYQFC",
                "length": 977
            },
            "evidence": [
                {
                    "id": "45917390",
                    "url": "http://www.informatics.jax.org/homology/45917390",
                    "database": "MGI"
                },
                {
                    "id": "P07333",
                    "url": "https://omabrowser.org/oma/group/P07333/",
                    "database": "OMA"
                }
            ],
            "common_name": "Mouse"
        },
        {
            "uniprot_canonical_ac": "Q00495-1",
            "protein_name": "Macrophage colony-stimulating factor 1 receptor",
            "gene_name": "Csf1r",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MELGPPLVLLLATVWHGQGAPVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSAWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDESLFTPVVVACMSVMSLLVLLLLLLLYKYKQKPKYQVRWKIIERYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDSEGDSSYKNIHLEKKYVRRDSGFSSQGVDTYVEMRPVSTSSSDSFFKQDLDKEPSRPLELWDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTSGHVAKIGDFGLARDIMNDSNYVVKGNARLPVKWMAPESILYCVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNNKFYKLVKDGYQMAQPVFAPKNIYSIMQSCWDLEPTRRPTFQQICFLLQEQARLERRDQDYANLPSSGGSSGSDSGGGSSGGSSSEPEEESSSEHLACCEPGDIAQPLLQPNNYQFAC",
                "length": 978
            },
            "evidence": [
                {
                    "id": "45917390",
                    "url": "http://www.informatics.jax.org/homology/45917390",
                    "database": "MGI"
                }
            ],
            "common_name": "Rat"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Molecular Function",
                "total": 8,
                "go_terms": [
                    {
                        "name": "ATP binding",
                        "id": "GO:0005524",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "transmembrane receptor protein tyrosine kinase activity",
                        "id": "GO:0004714",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004714",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cytokine binding",
                        "id": "GO:0019955",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019955",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "macrophage colony-stimulating factor receptor activity",
                        "id": "GO:0005011",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005011",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "protein tyrosine kinase activity",
                        "id": "GO:0004713",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004713",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "growth factor binding",
                        "id": "GO:0019838",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019838",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "protein homodimerization activity",
                        "id": "GO:0042803",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "protein phosphatase binding",
                        "id": "GO:0019903",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019903",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 6,
                "go_terms": [
                    {
                        "name": "plasma membrane",
                        "id": "GO:0005886",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "CSF1-CSF1R complex",
                        "id": "GO:1990682",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990682",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "nucleoplasm",
                        "id": "GO:0005654",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cell surface",
                        "id": "GO:0009986",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "intracellular membrane-bounded organelle",
                        "id": "GO:0043231",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "receptor complex",
                        "id": "GO:0043235",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043235",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 46,
                "go_terms": [
                    {
                        "name": "transmembrane receptor protein tyrosine kinase signaling pathway",
                        "id": "GO:0007169",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007169",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cytokine-mediated signaling pathway",
                        "id": "GO:0019221",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019221",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of macromolecule metabolic process",
                        "id": "GO:0010604",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010604",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of nitrogen compound metabolic process",
                        "id": "GO:0051173",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051173",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of primary metabolic process",
                        "id": "GO:0080090",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0080090",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of response to stimulus",
                        "id": "GO:0048584",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048584",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "forebrain neuron differentiation",
                        "id": "GO:0021879",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021879",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "osteoclast differentiation",
                        "id": "GO:0030316",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030316",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "macrophage colony-stimulating factor signaling pathway",
                        "id": "GO:0038145",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038145",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of bone resorption",
                        "id": "GO:0045124",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045124",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "mammary gland duct morphogenesis",
                        "id": "GO:0060603",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060603",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of protein phosphorylation",
                        "id": "GO:0001934",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001934",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "response to ischemia",
                        "id": "GO:0002931",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002931",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "inflammatory response",
                        "id": "GO:0006954",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "signal transduction",
                        "id": "GO:0007165",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cell population proliferation",
                        "id": "GO:0008283",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008283",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of cell population proliferation",
                        "id": "GO:0008284",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "negative regulation of cell population proliferation",
                        "id": "GO:0008285",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008285",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "peptidyl-tyrosine phosphorylation",
                        "id": "GO:0018108",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018108",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of cell migration",
                        "id": "GO:0030335",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030335",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of actin cytoskeleton organization",
                        "id": "GO:0032956",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032956",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "negative regulation of apoptotic process",
                        "id": "GO:0043066",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "innate immune response",
                        "id": "GO:0045087",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction",
                        "id": "GO:0051897",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051897",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of protein tyrosine kinase activity",
                        "id": "GO:0061098",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061098",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of ERK1 and ERK2 cascade",
                        "id": "GO:0070374",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070374",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of chemokine production",
                        "id": "GO:0032722",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032722",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "protein autophosphorylation",
                        "id": "GO:0046777",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046777",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "hemopoiesis",
                        "id": "GO:0030097",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030097",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of cell shape",
                        "id": "GO:0008360",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008360",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "ruffle organization",
                        "id": "GO:0031529",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031529",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cellular response to cytokine stimulus",
                        "id": "GO:0071345",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071345",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of cell motility",
                        "id": "GO:2000147",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000147",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "axon guidance",
                        "id": "GO:0007411",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007411",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of tyrosine phosphorylation of STAT protein",
                        "id": "GO:0042531",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042531",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation by host of viral process",
                        "id": "GO:0044794",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044794",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of MAPK cascade",
                        "id": "GO:0043408",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043408",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "monocyte differentiation",
                        "id": "GO:0030224",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030224",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "macrophage differentiation",
                        "id": "GO:0030225",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030225",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of macrophage chemotaxis",
                        "id": "GO:0010759",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010759",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "olfactory bulb development",
                        "id": "GO:0021772",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021772",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cellular response to macrophage colony-stimulating factor stimulus",
                        "id": "GO:0036006",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036006",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cell-cell junction maintenance",
                        "id": "GO:0045217",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045217",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "microglial cell proliferation",
                        "id": "GO:0061518",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061518",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of macrophage migration",
                        "id": "GO:1905521",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905521",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of macrophage proliferation",
                        "id": "GO:0120041",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0120041",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P07333",
                                "url": "https://www.uniprot.org/uniprot/P07333"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 153,
            "end_pos": 155,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 240,
            "end_pos": 242,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 275,
            "end_pos": 277,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 302,
            "end_pos": 304,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 335,
            "end_pos": 337,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 353,
            "end_pos": 355,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 412,
            "end_pos": 414,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 428,
            "end_pos": 430,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 45,
            "end_pos": 47,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 480,
            "end_pos": 482,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 734,
            "end_pos": 736,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 73,
            "end_pos": 75,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 805,
            "end_pos": 807,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [
        {
            "annotation": "Autophosphorylated in response to CSF1 or IL34 binding (PubMed:24336230, PubMed:20489731, PubMed:23408870). Phosphorylation at Tyr-561 is important for normal down-regulation of signaling by ubiquitination, internalization and degradation. Phosphorylation at Tyr-561 and Tyr-809 is important for interaction with SRC family members, including FYN, YES1 and SRC, and for subsequent activation of these protein kinases. Phosphorylation at Tyr-699 and Tyr-923 is important for interaction with GRB2. Phosphorylation at Tyr-723 is important for interaction with PIK3R1. Phosphorylation at Tyr-708 is important for normal receptor degradation. Phosphorylation at Tyr-723 and Tyr-809 is important for interaction with PLCG2. Phosphorylation at Tyr-969 is important for interaction with CBL. Dephosphorylation by PTPN2 negatively regulates downstream signaling and macrophage differentiation.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                },
                {
                    "database": "PubMed",
                    "id": "20489731",
                    "url": "https://glygen.org/publication/PubMed/20489731"
                },
                {
                    "database": "PubMed",
                    "id": "16170366",
                    "url": "https://glygen.org/publication/PubMed/16170366"
                },
                {
                    "database": "PubMed",
                    "id": "23408870",
                    "url": "https://glygen.org/publication/PubMed/23408870"
                },
                {
                    "database": "PubMed",
                    "id": "24336230",
                    "url": "https://glygen.org/publication/PubMed/24336230"
                }
            ]
        },
        {
            "annotation": "Ubiquitinated. Becomes rapidly polyubiquitinated after autophosphorylation, leading to its degradation.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P07333",
                    "url": "https://www.uniprot.org/uniprot/P07333"
                },
                {
                    "database": "PubMed",
                    "id": "16170366",
                    "url": "https://glygen.org/publication/PubMed/16170366"
                }
            ]
        }
    ],
    "interactions": [],
    "reactions": [
        {
            "id": "10596",
            "name": "",
            "equation": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]",
            "summary": "",
            "cellular_location": "",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9WUD9-1",
                "P57760-1",
                "P35739-1",
                "F1LYY7-1",
                "A0A8I6GCV6-1",
                "Q63132-1",
                "Q63117-1",
                "Q5U2X5-1",
                "Q63474-1",
                "Q4V8A3-1",
                "O08680-1",
                "O35346-1",
                "P54757-1",
                "P54758-1",
                "P54759-1",
                "P70600-1",
                "Q00495-1",
                "Q03351-1",
                "Q04589-1",
                "P06494-1",
                "P09759-1",
                "P29321-1",
                "P32577-1",
                "Q6XUX2-1",
                "Q62662-1",
                "Q62799-1",
                "Q62844-1",
                "Q62956-1",
                "Q63184-1",
                "Q63470-1",
                "Q498D6-1",
                "Q01621-1",
                "Q6P6U0-1",
                "Q63604-1",
                "P09760-1",
                "Q01986-1",
                "Q62862-1",
                "Q63572-1",
                "Q07014-1",
                "Q4KSH7-1",
                "G3V9H8-1",
                "P15127-1",
                "O08775-1",
                "P53767-1",
                "Q05030-1",
                "P55146-1",
                "Q64725-1",
                "Q63802-1",
                "Q64716-1",
                "P09215-1",
                "Q62689-1",
                "F1LM93-1",
                "P36506-1",
                "P20786-1",
                "P24062-1",
                "Q924U5-1",
                "Q63272-1",
                "B2RYC7-1",
                "P41243-1",
                "M0RDA4-1",
                "Q62838-1",
                "Q63116-1",
                "A0A8I6AM23-1",
                "P50545-1",
                "P57097-1",
                "P97523-1",
                "Q91ZT1-1",
                "D4A7W7-1",
                "F1LVI0-1",
                "E9PSY0-1",
                "A0A0G2K6M9-1",
                "F1LSN4-1",
                "F1MAJ0-1",
                "A0A0R4J8U1-1",
                "A0A8I6A5T6-1",
                "D3ZDS3-1",
                "D4ADZ5-1",
                "F1LSG7-1",
                "F1LRZ0-1",
                "D3ZBN3-1",
                "F1M0N1-1",
                "G3V6K6-1",
                "D3ZD03-1",
                "D3ZZK3-1",
                "E9PT20-1",
                "D4A584-1",
                "D3ZDH4-1",
                "A0A8I5ZVE3-1",
                "A0A8I6AWX7-1",
                "Q4KM97-1",
                "Q501W1-1",
                "B5DFD6-1",
                "Q5FVG7-1",
                "D3ZCD0-1",
                "A0A8I5ZP97-1",
                "A0A0G2JW59-1",
                "B1WC09-1",
                "Q01134-1",
                "P11980-1",
                "G3V783-1",
                "D3ZJI4-1",
                "Q4KSH6-1",
                "M0R7E7-1",
                "Q925D6-1",
                "Q9UM73-1",
                "O15146-1",
                "P42679-1",
                "P08922-1",
                "P07947-1",
                "Q12866-1",
                "P00519-1",
                "Q07912-1",
                "P42684-1",
                "Q9UF33-1",
                "P10721-1",
                "P08069-1",
                "P06239-1",
                "P04626-1",
                "P51451-1",
                "Q06187-1",
                "P51813-1",
                "Q9UIG0-1",
                "P49760-1",
                "P49761-4",
                "Q9HAZ1-1",
                "P49759-1",
                "P07333-1",
                "Q5JZY3-1",
                "Q6XUX3-1",
                "P00533-1",
                "Q9Y463-1",
                "P29317-1",
                "Q9NR20-1",
                "Q13627-1",
                "P54760-1",
                "P41240-1",
                "Q16832-1",
                "Q15375-1",
                "P29323-1",
                "P22455-1",
                "P16591-1",
                "P29322-1",
                "P54756-1",
                "P29320-1",
                "Q08345-1",
                "Q92630-1",
                "P54753-1",
                "Q15303-1",
                "P21860-1",
                "Q14289-1",
                "O43781-1",
                "P54764-1",
                "P19525-1",
                "P21709-1",
                "P54762-1",
                "P22607-1",
                "P21802-1",
                "P52333-1",
                "P11362-1",
                "P42685-1",
                "P06213-1",
                "P14616-1",
                "Q05655-1",
                "Q08881-1",
                "P07332-1",
                "P08631-1",
                "P29376-1",
                "Q05397-1",
                "O60674-1",
                "P23458-1",
                "P36888-1",
                "P09769-1",
                "P06241-1",
                "P43405-1",
                "P07948-1",
                "P46734-1",
                "P45985-1",
                "Q02750-1",
                "P52564-1",
                "O14733-1",
                "Q13163-1",
                "Q16288-1",
                "P36507-1",
                "Q16620-1",
                "P08581-1",
                "P04629-1",
                "Q14680-1",
                "Q01974-1",
                "P09619-1",
                "P07949-1",
                "Q504Y2-1",
                "P34925-1",
                "P16234-1",
                "Q13882-1",
                "Q04912-1",
                "O43353-1",
                "Q06418-1",
                "P30530-1",
                "Q96KB5-1",
                "Q15569-1",
                "Q96S53-1",
                "Q6J9G0-1",
                "P42680-1",
                "P35916-2",
                "P0C1S8-1",
                "P17948-1",
                "P29597-1",
                "P42681-1",
                "P35590-1",
                "Q13470-1",
                "P33981-1",
                "P30291-1",
                "P12931-1",
                "P35968-1",
                "P43403-1",
                "O75716-1",
                "Q02763-1",
                "Q9H3Y6-1",
                "P35790-1",
                "P14618-1",
                "P24604-1",
                "Q9Z188-1",
                "P35969-1",
                "P52332-1",
                "P08923-1",
                "Q00342-1",
                "Q62120-1",
                "Q4JIM5-1",
                "P97504-1",
                "P42682-1",
                "Q60629-1",
                "O54967-1",
                "P00520-1",
                "P97793-1",
                "P16277-1",
                "O35491-1",
                "O35492-1",
                "O35493-1",
                "Q9Z277-1",
                "P35991-1",
                "P22518-1",
                "Q8BYG9-1",
                "P54754-1",
                "P54761-1",
                "Q6XUX1-1",
                "Q62371-1",
                "Q60750-1",
                "Q61527-1",
                "Q62413-1",
                "Q61214-1",
                "Q61772-1",
                "Q61851-1",
                "Q922Y0-1",
                "Q922K9-1",
                "O09127-1",
                "P16092-1",
                "Q03142-1",
                "P29319-1",
                "Q01279-1",
                "P70424-1",
                "P21803-1",
                "Q8CBF3-1",
                "P41241-1",
                "Q03963-1",
                "Q8BI55-1",
                "P54763-3",
                "P16879-1",
                "P09581-1",
                "P34152-3",
                "P14234-1",
                "P39688-1",
                "Q03146-1",
                "Q03145-1",
                "Q61526-1",
                "P70451-1",
                "Q5U4C9-1",
                "Q9QVP9-1",
                "Q03137-1",
                "Q60751-1",
                "Q62137-1",
                "P28867-1",
                "P25911-1",
                "P48025-1",
                "Q9WTL4-1",
                "P41242-1",
                "P05532-1",
                "P06240-1",
                "P08103-1",
                "P15208-1",
                "Q03526-1",
                "Q9WVS7-1",
                "P70236-1",
                "P31938-1",
                "P47809-1",
                "Q61846-1",
                "Q60805-1",
                "Q63932-1",
                "O09110-1",
                "P26618-1",
                "Q8CE90-1",
                "P16056-1",
                "P05622-1",
                "P15209-1",
                "Q6VNS1-1",
                "Q61006-1",
                "Q3UFB7-1",
                "Q5RJI4-1",
                "Q9JJ78-1",
                "P58801-1",
                "Q8VCT9-1",
                "O70146-1",
                "Q62190-1",
                "Q62270-1",
                "P35546-1",
                "P35761-1",
                "Q9Z138-1",
                "Q9R117-1",
                "O88697-1",
                "P05480-2",
                "Q01887-1",
                "Q02858-1",
                "Q06806-1",
                "Q00993-1",
                "Q64434-1",
                "Q6J9G1-1",
                "Q99ML2-1",
                "Q78DX7-1",
                "P55144-1",
                "P43404-1",
                "P35917-1",
                "P47810-1",
                "P35918-1",
                "Q04736-1",
                "Q66JT0-1",
                "O54804-1",
                "P52480-1",
                "P14680-1",
                "P21965-1",
                "P22216-1",
                "P32490-1",
                "P06784-1",
                "P08018-1",
                "P32350-1",
                "P32491-1",
                "P54199-1",
                "Q54G28-1",
                "Q54N73-1",
                "Q54R58-1",
                "P18160-1",
                "P18161-1",
                "Q54BC9-1",
                "Q54I36-1",
                "Q54QV3-1",
                "Q552C6-1",
                "Q55CL6-1",
                "Q75JK0-1",
                "Q76NV1-1",
                "Q23977-1",
                "P18475-1",
                "P13368-1",
                "Q24145-1",
                "Q24488-1",
                "Q27324-1",
                "P08630-1",
                "P00522-1",
                "P00528-1",
                "P04412-1",
                "Q9V422-1",
                "Q9V6K3-1",
                "Q9V9J3-1",
                "Q9VBW3-1",
                "P09208-1",
                "P49762-1",
                "P83102-1",
                "Q24324-1",
                "Q9VPC0-1",
                "P49657-1",
                "P54350-1",
                "P18106-4",
                "Q07407-1",
                "Q09147-1",
                "Q24592-1",
                "Q9I7F7-1",
                "Q9V3D5-1",
                "Q9VZI2-1",
                "Q8INJ8-1",
                "Q7KJ08-1",
                "Q9VJ04-1",
                "E1JHB7-1",
                "Q9VE06-1",
                "O61444-1",
                "O62602-1",
                "Q9VZA8-1",
                "Q7KT06-1"
            ],
            "evidence": [
                {
                    "id": "10596",
                    "database": "Rhea",
                    "url": "https://www.rhea-db.org/rhea/10596"
                }
            ]
        },
        {
            "id": "R-HSA-389156",
            "name": "CSF1 dimer binds CSF1R or IL34",
            "equation": "",
            "summary": "Colony-stimulating factor 1 receptor (CSF1R, CSF-1R) is a protein tyrosine kinase transmembrane receptor for colony-stimulating factor-1 (CSF1, macrophage CSF, M-CSF) and for interleukin-34 (IL-34) (Wang et al. 1993, Lin et al. 2008, Chihara et al. 2010, Ma et al. 2012, Felix et al. 2015). Responses of CSF1R to CSF1 and IL34 are qualitatively similar but quantitatively different (Chihara et al. 2010). CSF1R is a transmembrane glycoprotein and contains five extracellular ligand binding immunoglobulin-like domains, a single transmembrane segment, and a split intracellular kinase domain. CSF1 is a disulfide linked homodimer and either expressed as a transmembrane molecule or proteolytically processed to produce soluble glycoprotein or proteoglycan forms (Stanley and Chitu, 2014). IL-34 is a non-covalently linked homodimer that is secreted (Lin et al. 2008).<br>CSF1R binds with its extracellular D2 and D3 domains to CSF1 or IL-34. One CSF1 subunit binds to one CSF1R molecule, the second CSF1 subunit binds another CSF1R molecule, resulting in dimerization of CSF1R through the interaction of its D4 and D5 domains (Wang et al. 1993, Chihara et al. 2010, Ma et al. 2012, Felix et al. 2012).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P07333-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-389156",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389156"
                }
            ]
        },
        {
            "id": "R-HSA-389159",
            "name": "CSF1R trans-autophosphorylates on multiple tyrosine and serine residues",
            "equation": "",
            "summary": "Following dimerization of the CSF-1 receptor (CSF1R), it undergoes trans-autophosphorylation on  multiple tyrosine residues by its intrinsic kinase activity (Rohrschneider et al. 1997, Chihara et al. 2010). Tyrosine-561 (tyrosine-559 in the mouse homolog) in the juxtamembrane domain inhibits the kinase activity of CSF1R and is phosphorylated first, thus activating the kinase activity of CSF1R (inferred from the mouse homolog). Other tyrosine residues that are autophosphorylated are tyrosine-546 in the juxtamembrane domain, tyrosines-699,708,723 in the kinase insert domain, tyrosine-809 in the kinase domain, and tyrosines-923,969 in the C-terminal domain (Chihara et al. 2010, reviewed in Hamilton 1997, and inferred from the mouse homolog).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P07333-1",
                "P06241-1",
                "P12931-1",
                "P22681-1",
                "P07947-1",
                "P08631-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-389159",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389159"
                }
            ]
        },
        {
            "id": "R-HSA-6787820",
            "name": "IL34 dimer binds CSF1R",
            "equation": "",
            "summary": "The receptor for Interleukin-34 (IL34) is colony stimulating factor 1 receptor (CSF1R), also called macrophage colony stimulating factor receptor (M-CSF-R). Dimeric IL34 and CSF1 bind the same general region of CSF1R, interacting with overlapping but distinct epitopes. Ligand binding leads to receptor dimerisation (Ma et al. 2012, Liu et al. 2012). Like CSF1, IL34 stimulation of CSF1R leads to phosphorylation of extracellular signal-regulated kinase (ERK) 1 and 2 in human monocytes (Lin et al. 2008). ; ; CSF1R activates several signaling pathways including JAK-STAT3, 5A/B, phosphorylation of PIK3R1, PLCG2, GRB2, SLA2 and CBL. PLCG2 phosphorylation leads to increassed production of the cellular signaling molecules diacylglycerol (DAG) and inositol 1,4,5 trisphosphate (IP3), which activate protein kinase C family members, especially PRKCD. Phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3 kinase, leads to activation of the AKT1 signaling pathway. Activated CSF1R also mediates activation of MAPK1 (ERK2) or MAPK3 (ERK1) and the SRC family kinases SRC, FYN and YES1. Activated CSF1R binds GRB2 and promotes tyrosine phosphorylation of SHC1 and INPP5D (SHIP1). Signaling is down regulated by protein phosphatases such as INPP5D that can dephosphorylate the receptor and its downstream effectors.",
            "cellular_location": "extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P07333-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-6787820",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6787820"
                }
            ]
        },
        {
            "id": "R-HSA-8853908",
            "name": "VENTX stimulates CSF1R (M-CSF-R) expression",
            "equation": "",
            "summary": "Binding of VENTX to the homeobox domain binding (HDB) site in the promoter of the macrophage colony stimulating factor receptor (M-CSFR, CSF1R) gene results in up-regulation of CSF1R transcription. Expression of CSF1R is necessary for differentiation of monocytes into macrophages (Wu et al. 2011).",
            "cellular_location": "nucleoplasm, plasma membrane",
            "input_participant_list": [
                "R-HSA-8853905"
            ],
            "output_participant_list": [
                "R-HSA-197667"
            ],
            "enzyme_list": [
                "P07333-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-8853908",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8853908"
                }
            ]
        },
        {
            "id": "R-HSA-9009485",
            "name": "IL34:CSF1 binds CSF1R",
            "equation": "",
            "summary": "Interleukin-34 (IL34) can bind Macrophage colony-stimulating factor 1 (CSF1). The IL34:CSF1 heteromer may bind Macrophage colony-stimulating factor 1 receptor (CSF1R) facilitating receptor maturation and cellular trafficking. Consequently, downstream signaling pathways are activated (Segaliny et al. 2015). Ultimately, these events lead to the release of pro-inflammatory chemokines regulating the innate immunity and inflammation. The exact binding mechanism of IL34:CSF1 to CSF1R is unclear. Hence, this interaction is represented as a black box event.",
            "cellular_location": "extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P07333-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9009485",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009485"
                }
            ]
        },
        {
            "id": "R-HSA-9009554",
            "name": "IL34 dimer:SDC1 binds CSF1R",
            "equation": "",
            "summary": "Interleukin-34 (IL34) can bind Syndecan-1 (SDC1), a cell surface proteoglycan. Low levels of SDC1 may sequester IL34 at the cell surface and prevent it from binding Macrophage colony-stimulating factor 1 receptor (CSF1R), while high SDC1 levels may facilitate IL34-CSF1R signaling (Segaliny et al. 2015). Ultimately, these events lead to the release of pro-inflammatory chemokines regulating the innate immunity and inflammation. The precise interaction between IL34:SDC1 and CSF1R is unknown. Hence, this interaction is represented as an uncertain black box event.",
            "cellular_location": "extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P07333-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9009554",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009554"
                }
            ]
        },
        {
            "id": "R-HSA-9680348",
            "name": "PIK3R1:PIK3CA,B,G (PI3K), PLCG2 (PLCgamma2), SHC1 (SHC), PTPN11 (SHP2), GRB2:GAB2, GRB2:GAB3, GRAP2 (MONA), CBL:GRB2, INPP5D (SHIP1), INPPL1 (SHIP2) bind PolyUb,p-8Y-CSF1R and are activated",
            "equation": "",
            "summary": "The PIK3R1 (p85alpha) subunit of phosphatidylinositol 3-kinase (PI3K) is phosphorylated and binds CBL and CSF1R (inferred from mouse homologs). CBL also directly binds phosphorylated CSF1R (inferred from mouse homologs). GRB2:SOS1 transiently interacts with CSF1R (inferred from mouse homologs) and PI3K (Saleem et al. 1995) in response to CSF1. SHC1 (SHC) interacts with CBL and CSF1R (inferred from mouse homologs). CBL is constitutively bound to GRB2, CBL is phosphorylated, and phosphorylated CBL binds phosphorylated SHC (inferred from mouse homologs). PLCG2 (PLC-gamma2), expressed in the myeloid lineage, binds phosphorylated tyrosine-723 of CSF1R and PLCG2 is phosphorylated in a process that requires the activity of PI3K (inferred from mouse homologs). GRAP2 (MONA) binds phosphorylated tyrosine-699 of CSF1R. GRB2 also interacts with CSF1R (Kharbanda et al. 1995) via phosphotyrosine-699 ( inferred from mouse homologs). GRAP2 binds GAB3, which is then phosphorylated (inferred from mouse homologs). In response to CSF1, the scaffolding protein GAB2 associates with INPP5D (SHIP1) and other proteins involved in CSF1 signaling and GAB2 is phosphorylated directly or indirectly by CSF1R (inferred from mouse homologs). INPPD5D also interacts with the kinase LYN (Baran et al. 2003). INPPL1 (SHIP2), a homolog of INPPD5,  binds CSF1R in response to CSF1 (inferred from mouse homologs). GAB3, a homolog of GAB2, associates with CSF1R, is phosphorylated, and interacts with PI3K and PTPN11 (SHP2) (inferred from mouse homologs). The SRC family kinases SRC, FYN, and YES1 (YES) bind phosphorylated CSF1R (Courtneidge et al. 1993, Li et al. 1997, also inferred from mouse homologs). STAT proteins STAT1 and STAT3 bind CSF1R and are phosphorylated (inferred from mouse homologs). STAT5 also appears to be phosphorylated in response to CSF1 (Knowlton et al. 2010). THOC5 (FMIP) binds CSF1R and is phosphorylated (inferred from mouse homologs). The order of binding and phosphorylation of the interactors of CSF1R is unknown. Different subpopulations of CSF1R may be bound to different sets of interactors (inferred from mouse homologs).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [
                "R-HSA-197940",
                "R-HSA-202367",
                "R-HSA-354251",
                "R-HSA-200917",
                "R-HSA-9628701",
                "R-HSA-373640",
                "R-HSA-913354",
                "R-HSA-9682751"
            ],
            "output_participant_list": [],
            "enzyme_list": [
                "P07333-1",
                "P42336-1",
                "P48736-1",
                "P06241-1",
                "P12931-1",
                "P22681-1",
                "O15357-1",
                "P07947-1",
                "P07948-1",
                "P16885-1",
                "Q06124-2",
                "P08631-1",
                "P42338-1",
                "Q92835-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9680348",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680348"
                }
            ]
        },
        {
            "id": "R-HSA-9680349",
            "name": "CSF1R dimerizes",
            "equation": "",
            "summary": "After the CSF1 dimer or IL34 dimer binds a CSF1R monomer, a second molecule of CSF1R binds CSF1 and the two molecules of CSF1R dimerize by interaction of their D4 and D5 domains, resulting in a conformational change in CSF1R that activates its kinase activity (Elegheert et al. 2011, Felix et al. 2015, and inferred from mouse homologs). Disulfide bonds between the CSF1R monomers appear to be artifacts of immunoprecipitation, reflecting a conformational change following CSF1R dimerization (inferred from mouse homologs).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P07333-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9680349",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680349"
                }
            ]
        },
        {
            "id": "R-HSA-9680385",
            "name": "CSF1R-associated SOS1 mediates exchange of GTP for GDP bound to RAS",
            "equation": "",
            "summary": "SOS1 (SOS) is stably bound to GRB2, which transiently associates with phosphorylated CSF1R. In response to the activation of CSF1R by CSF1, SOS1 promotes RAS to exchange of GDP for GTP (inferred from mouse homologs) and thereby activates the RAS-RAF-MEK-ERK1,2 signaling pathway. Myeloid cells contain the KRAS isoform of RAS. KRAS:GTP enhances proliferation of macrophages (inferred from mouse homologs). <br>GRB2 has been shown to bind phosphotyrosine-699 of CSF1R (phosphotyrosine-697 of mouse Csf1r), however phosphorylation of tyrosines 544, 559, and 807 of mouse Csf1r are together sufficient for the full proliferative response mediated via the RS-RAF-MEK-ERK1,2 pathway (Yu et al. 2012) and mouse Csf1r lacking phosophotyrosine-697 can still activate ERK (Lee and States 2000), Csf1r phosphotyrosine-697 (human CSF1R phosphotyrosine-699) is likely not the only GRB2:SOS binding site",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P07333-1",
                "P06241-1",
                "P12931-1",
                "P07947-1",
                "P08631-1",
                "P01116-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9680385",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680385"
                }
            ]
        },
        {
            "id": "R-HSA-9680388",
            "name": "CSF1R-associated PLCG2 hydrolyzes phosphatidylcholine",
            "equation": "",
            "summary": "In response to CSF1, PLCG2 (phospholipase C gamma2) associates with CSF1R, is activated by phosphorylation, and hydrolyzes phosphatidylcholine to yield choline phosphate (ChoP, phosphocholine) and 1,2-diacylglycerol (Imamura et al. 1990, Nakamura et al. 1992, Obba et al. 2015, also inferred from mouse homologs). PLCG2 activates pathways that enhance differentiation of macrophages (inferred from mouse homologs).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P07333-1",
                "P42336-1",
                "P48736-1",
                "P06241-1",
                "P12931-1",
                "P22681-1",
                "O15357-1",
                "P07947-1",
                "P07948-1",
                "P16885-1",
                "Q06124-2",
                "P08631-1",
                "P42338-1",
                "Q92835-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9680388",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680388"
                }
            ]
        },
        {
            "id": "R-HSA-9680389",
            "name": "CSF1R-associated phosphatidylinositol 3-kinase (PI3K) phosphorylates PI(4,5)P2",
            "equation": "",
            "summary": "Phosphatidylinositol 3-kinase (PI3K) associated with the activated receptor for CSF1, CSF1R (M-CSFR), phosphorylates phosphatidylinositol 4,5-bisphosphate (PIP2) to yield phosphatidylinositol 3,4,5-trisphosphate (PIP3) (Saleem et al. 1995, also inferred from mouse homologs). The regulatory subunit of PI3K, PIK3R1 (p85alpha), binds phosphotyrosine-723 (721 in the mouse homologs) of CSF1R (inferred from mouse homologs). PI3K is important for proliferation, migration, and anti-inflammatory activity of macrophages (inferred from mouse homologs).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P07333-1",
                "P42336-1",
                "P48736-1",
                "P06241-1",
                "P12931-1",
                "P22681-1",
                "O15357-1",
                "P07947-1",
                "P07948-1",
                "P16885-1",
                "Q06124-2",
                "P08631-1",
                "P42338-1",
                "Q92835-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9680389",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680389"
                }
            ]
        },
        {
            "id": "R-HSA-9733314",
            "name": "CSF1R trans-autophosphorylates on tyrosine-561",
            "equation": "",
            "summary": "Immediately after dimerization of CSF1R, tyrosine-561 is the first CSF1R tyrosine residue to be phosphorylated during a first wave of phosphorylation (inferred from the mouse homolog). The phosphorylation is catalyzed by CSF1R itself as one subunit of the CSF1R dimer phosphorylates the other subunit (inferred from the mouse homolog). Unphosphorylated tyrosine-561 inhibits the kinase activity of CSF1R. Phosphorylation causes a conformational change that relieves the inhibition and allows CSF1R to phosphorylate further targets (inferred from mouse homologs). Phosphorylated tyrosine-561 is also required for subsequent binding of Src family kinases to CSF1R and activation of the CBL ubiquitin ligase (inferred from mouse homologs). GRB2 subsequently binds phosphotyrosine-699 and CBL subsequently binds phosphotyrosine-969 so these tyrosine residues may also be phosphorylated at this time (inferred from mouse homologs). However, the CSF1R-mediated activation of CBL is not dependent on phosphorylation of tyrosine-969, suggesting that phosphotyrosine-969 binding of CBL may mediate other, ubiquitin ligase-independent effects of CBL (inferred from mouse homologs).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P07333-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9733314",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9733314"
                }
            ]
        },
        {
            "id": "R-HSA-9733316",
            "name": "p-Y-CBL autoubiquitinates and multiubiquitinates p-Y561-CSF1R in CSF1 dimer:p-Y561-CSF1R dimer:p-Y-CBL",
            "equation": "",
            "summary": "After CBL is phosphorylated and binds CSF1R, CBL autopolyubiquitinates and polyubiquitinates CSF1R (inferred from mouse homologs). The ubiquitination of CSF1R results in a subsequent wave of phosphorylation by CSF1R and the internalization and proteolysis of CSF1R (inferred from mouse homologs). Thus multiubiquitination of CSF1R is required for full activity of CSF1R and for termination of signaling by CSF1R.",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P07333-1",
                "P06241-1",
                "P12931-1",
                "P22681-1",
                "P07947-1",
                "P08631-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9733316",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9733316"
                }
            ]
        },
        {
            "id": "R-HSA-9733323",
            "name": "Src family kinases phosphorylate CBL in CSF1 dimer:p-Y561-CSF1R dimer:CBL",
            "equation": "",
            "summary": "CBL binds the phosphorylated CSF1R and is phosphorylated (inferred from mouse homologs). CBL is observed to bind phosphotyrosine-969 but mutation of tyrosine-561 has a greater effect on phosphoryation of CBL and multiubiquitination of CSF1R by CBL (inferred from mouse homologs). Based on response to inhibitors, the phosphorylation of CBL is catalyzed by SRC family kinases (inferred from mouse homologs).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P07333-1",
                "P06241-1",
                "P12931-1",
                "P22681-1",
                "P07947-1",
                "P08631-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9733323",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9733323"
                }
            ]
        },
        {
            "id": "R-HSA-9733330",
            "name": "CSF1 dimer,IL34 dimer:p-Y561-CSF1R dimer:SFK binds GRB2:SOS1",
            "equation": "",
            "summary": "After an initial wave of phosphorylation of CSF1R, the stable GRB2:SOS1 complex transiently binds phospho-CSF1R (inferred from mouse homologs). GRB2 has been shown to bind phosphotyrosine-699, though another phosphotyrosine residue may be involved in transient binding of GRB2 (inferred from mouse homologs).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P07333-1",
                "P06241-1",
                "P12931-1",
                "P07947-1",
                "P08631-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9733330",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9733330"
                }
            ]
        },
        {
            "id": "R-HSA-9733331",
            "name": "CSF1 dimer,IL34 dimer:p-Y561-CSF1R:GRB2:SOS1 dissociates yielding CSF1 dimer,IL34 dimer:p-Y561-CSF1R:SFK and GRB2:SOS1",
            "equation": "",
            "summary": "GRB2:SOS1 transiently associates with phosphorylated CSF1R after CSF1R undergoes an initial wave of autophosphorylation (Wang et al. 1999). GRB2:SOS1 then dissociates from CSF1R.",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P07333-1",
                "P06241-1",
                "P12931-1",
                "P07947-1",
                "P08631-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9733331",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9733331"
                }
            ]
        },
        {
            "id": "R-HSA-9817983",
            "name": "CSF1 dimer,IL34 dimer:p-Y561-CSF1R dimer:SFK binds CBL",
            "equation": "",
            "summary": "The ubiquitin E3 ligase CBL associates with the phosphorylated CSF1R.",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P07333-1",
                "P06241-1",
                "P12931-1",
                "P22681-1",
                "P07947-1",
                "P08631-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9817983",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9817983"
                }
            ]
        },
        {
            "id": "R-HSA-9818010",
            "name": "CSF1 dimer,IL34 dimer:p-Y561-CSF1R dimer binds SRC family kinases FYN,HCK,SRC,YES1",
            "equation": "",
            "summary": "After phosphorylation of CSF-1R tyrosine-Y561, SFKs bind the phosphotyrosine-561 site (inferred from mouse homologs).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P07333-1",
                "P06241-1",
                "P12931-1",
                "P07947-1",
                "P08631-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9818010",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9818010"
                }
            ]
        }
    ],
    "reaction_participants": [
        {
            "participant_id": "R-HSA-197667",
            "participant_name": "CSF1R [plasma membrane]",
            "crossref": [
                {
                    "id": "P07333",
                    "database": "PRO",
                    "url": ""
                },
                {
                    "id": "P07333",
                    "database": "GeneCards",
                    "url": ""
                },
                {
                    "id": "4HW7",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSG00000182578",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "NP_005202.2",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "4R7I",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "3KRJ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSP00000286301",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "CSF1R_HUMAN",
                    "database": "ZINC - Biogenic",
                    "url": ""
                },
                {
                    "id": "CSF1R_HUMAN",
                    "database": "ZINC - World Drugs",
                    "url": ""
                },
                {
                    "id": "P07333",
                    "database": "Pharos - Targets",
                    "url": ""
                },
                {
                    "id": "HMDBP01314",
                    "database": "HMDB Protein",
                    "url": ""
                },
                {
                    "id": "3LCD",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENST00000543093",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "2I0Y",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2OGV",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "P07333",
                    "database": "ZINC target",
                    "url": ""
                },
                {
                    "id": "ENSP00000501699",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "3BEA",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "3KRL",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4WRM",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2I0V",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "NP_001275634.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "3DPK",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "P07333",
                    "database": "UniProt",
                    "url": ""
                },
                {
                    "id": "ENSG00000182578",
                    "database": "OpenTargets",
                    "url": ""
                },
                {
                    "id": "6WXJ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1806",
                    "database": "Guide to Pharmacology - Targets",
                    "url": ""
                },
                {
                    "id": "CSF1R_HUMAN",
                    "database": "ZINC - Substances",
                    "url": ""
                },
                {
                    "id": "ENST00000675795",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "CSF1R_HUMAN",
                    "database": "ZINC - FDA approved",
                    "url": ""
                },
                {
                    "id": "2.7.10.1",
                    "database": "IntEnz",
                    "url": ""
                },
                {
                    "id": "ENST00000286301",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "4R7H",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "6IG8",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "7MFC",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "21593",
                    "database": "Orphanet",
                    "url": ""
                },
                {
                    "id": "6N33",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "CSF1R_HUMAN",
                    "database": "ZINC - Predictions - Purchasable",
                    "url": ""
                },
                {
                    "id": "4WRL",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "CSF1R_HUMAN",
                    "database": "ZINC - Investigational",
                    "url": ""
                },
                {
                    "id": "6T2W",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "8CGC",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4LIQ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSP00000445282",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "4DKD",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2I1M",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSG00000182578-CSF1R",
                    "database": "HPA",
                    "url": ""
                },
                {
                    "id": "3LCO",
                    "database": "PDB",
                    "url": ""
                }
            ]
        },
        {
            "participant_id": "R-HSA-197940",
            "participant_name": "INPP5D [cytosol]",
            "crossref": [
                {
                    "id": "Q92835",
                    "database": "UniProt",
                    "url": ""
                },
                {
                    "id": "6IBD",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "NP_005532.2",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "NP_001017915.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "5RXI",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RWF",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RYL",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RYK",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RXJ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RXH",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RWE",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RXM",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RXO",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "8PDG",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "Q92835",
                    "database": "Pharos - Targets",
                    "url": ""
                },
                {
                    "id": "6XY7",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RWG",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RXK",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RWH",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RXL",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RXQ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RWK",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RXP",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "8PDH",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "8PDJ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSG00000168918-INPP5D",
                    "database": "HPA",
                    "url": ""
                },
                {
                    "id": "5RWI",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RWJ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RWM",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RXR",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RXS",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RWL",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RX8",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RYB",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RYC",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RW5",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RW6",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RX7",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RXA",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RXC",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RXB",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RYE",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RW7",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "Q92835",
                    "database": "PRO",
                    "url": ""
                },
                {
                    "id": "5RYD",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RW8",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RX9",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RXE",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSG00000168918",
                    "database": "OpenTargets",
                    "url": ""
                },
                {
                    "id": "5RYH",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RXD",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RYF",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RWA",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RW9",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RWB",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RYG",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RYJ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RXG",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RWD",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RYI",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RXF",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RWC",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1455",
                    "database": "Guide to Pharmacology - Targets",
                    "url": ""
                },
                {
                    "id": "5RY3",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RWY",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RY1",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RWW",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RY2",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RWX",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RY5",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RX1",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "HMDBP03787",
                    "database": "HMDB Protein",
                    "url": ""
                },
                {
                    "id": "5RY6",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RX0",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "3.1.3.86",
                    "database": "IntEnz",
                    "url": ""
                },
                {
                    "id": "5RY4",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RWZ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RY8",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RX3",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RW2",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RY7",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RX2",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2YSX",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RYA",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RWU",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RXZ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RWV",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RY0",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RWS",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RXY",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RXX",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RWT",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RXV",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RWQ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RXW",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RWR",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENST00000445964",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSG00000168918",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENST00000629761",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "5RWN",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSP00000405338",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENST00000630854",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000486669",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000487191",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "Q92835",
                    "database": "GeneCards",
                    "url": ""
                },
                {
                    "id": "5RXU",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RXT",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RWP",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSP00000352575",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSG00000281614",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "5RWO",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENST00000359570",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "5RX4",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RW3",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RX5",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RY9",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RW4",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5RX6",
                    "database": "PDB",
                    "url": ""
                }
            ]
        },
        {
            "participant_id": "R-HSA-200917",
            "participant_name": "FYN [cytosol]",
            "crossref": [
                {
                    "id": "P06241",
                    "database": "UniProt",
                    "url": ""
                },
                {
                    "id": "P06241",
                    "database": "PRO",
                    "url": ""
                },
                {
                    "id": "FYN_HUMAN",
                    "database": "ZINC - World Drugs",
                    "url": ""
                },
                {
                    "id": "3H0H",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "FYN_HUMAN",
                    "database": "ZINC - Investigational",
                    "url": ""
                },
                {
                    "id": "2026",
                    "database": "Guide to Pharmacology - Targets",
                    "url": ""
                },
                {
                    "id": "7A2N",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1AOT",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1A0N",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "XP_016866139.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "3H0F",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "FYN_HUMAN",
                    "database": "ZINC - FDA approved",
                    "url": ""
                },
                {
                    "id": "7A2M",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "7A2P",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "XP_016866141.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "3UA6",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1AVZ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "7A2O",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "3H0I",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1AOU",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "XP_016866140.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "FYN_HUMAN",
                    "database": "ZINC - Predictions - Purchasable",
                    "url": ""
                },
                {
                    "id": "7A2R",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1FYN",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4D8D",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1EFN",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "FYN_HUMAN",
                    "database": "ZINC - Metabolites",
                    "url": ""
                },
                {
                    "id": "XP_016866142.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "7A2Q",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "3UA7",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1AZG",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "7A2T",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1M27",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4U17",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "7A2S",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1G83",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "XP_016866143.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "4EIK",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSP00000357667",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "1NYG",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENST00000368667",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "NP_694592.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "P06241",
                    "database": "Pharos - Targets",
                    "url": ""
                },
                {
                    "id": "ENSG00000010810",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "7A2V",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSP00000357656",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000229471",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENST00000368678",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "4ZNX",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENST00000354650",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "1NYF",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "7A2U",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSP00000357671",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000346671",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENST00000229471",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "4U1P",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "NP_002028.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "ENSG00000010810",
                    "database": "OpenTargets",
                    "url": ""
                },
                {
                    "id": "7A2K",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "7A2Z",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2MRJ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2MRK",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "XP_005266949.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "7A2L",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2DQ7",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "6IPY",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "7A2X",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "FYN_HUMAN",
                    "database": "ZINC - Substances",
                    "url": ""
                },
                {
                    "id": "6IPZ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "7A2J",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "XP_005266947.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "7A2Y",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2MQI",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "P06241",
                    "database": "ZINC target",
                    "url": ""
                },
                {
                    "id": "1SHF",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5ZAU",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "P06241",
                    "database": "GeneCards",
                    "url": ""
                },
                {
                    "id": "ENSG00000010810-FYN",
                    "database": "HPA",
                    "url": ""
                },
                {
                    "id": "FYN_HUMAN",
                    "database": "ZINC - Biogenic",
                    "url": ""
                },
                {
                    "id": "1ZBJ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "6EDF",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "7A2W",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "NP_694593.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "ENST00000368682",
                    "database": "Ensembl",
                    "url": ""
                }
            ]
        },
        {
            "participant_id": "R-HSA-202367",
            "participant_name": "GRAP2 [cytosol]",
            "crossref": [
                {
                    "id": "O75791",
                    "database": "UniProt",
                    "url": ""
                },
                {
                    "id": "NP_004801.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "5GJH",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSG00000100351",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSG00000100351",
                    "database": "OpenTargets",
                    "url": ""
                },
                {
                    "id": "ENST00000344138",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000385607",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "O75791",
                    "database": "PRO",
                    "url": ""
                },
                {
                    "id": "ENST00000407075",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000339186",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "O75791",
                    "database": "GeneCards",
                    "url": ""
                },
                {
                    "id": "NP_001278753.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "O75791",
                    "database": "Pharos - Targets",
                    "url": ""
                },
                {
                    "id": "ENSG00000100351-GRAP2",
                    "database": "HPA",
                    "url": ""
                },
                {
                    "id": "NP_001278754.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "NP_001278757.1",
                    "database": "RefSeq",
                    "url": ""
                }
            ]
        },
        {
            "participant_id": "R-HSA-354251",
            "participant_name": "LYN [cytosol]",
            "crossref": [
                {
                    "id": "P07948",
                    "database": "UniProt",
                    "url": ""
                },
                {
                    "id": "ENSP00000428424",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "XP_016868905.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "ENSG00000254087",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "P07948",
                    "database": "GeneCards",
                    "url": ""
                },
                {
                    "id": "ENST00000519728",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "LYN_HUMAN",
                    "database": "ZINC - Predictions - Purchasable",
                    "url": ""
                },
                {
                    "id": "LYN_HUMAN",
                    "database": "ZINC - World Drugs",
                    "url": ""
                },
                {
                    "id": "ENST00000520220",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000428924",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "NP_001104567.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "LYN_HUMAN",
                    "database": "ZINC - Biogenic",
                    "url": ""
                },
                {
                    "id": "NP_002341.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "ENSG00000254087",
                    "database": "OpenTargets",
                    "url": ""
                },
                {
                    "id": "HMDBP13811",
                    "database": "HMDB Protein",
                    "url": ""
                },
                {
                    "id": "2.7.10.2",
                    "database": "IntEnz",
                    "url": ""
                },
                {
                    "id": "LYN_HUMAN",
                    "database": "ZINC - Substances",
                    "url": ""
                },
                {
                    "id": "P07948",
                    "database": "ZINC target",
                    "url": ""
                },
                {
                    "id": "2060",
                    "database": "Guide to Pharmacology - Targets",
                    "url": ""
                },
                {
                    "id": "P07948",
                    "database": "PRO",
                    "url": ""
                },
                {
                    "id": "ENSG00000254087-LYN",
                    "database": "HPA",
                    "url": ""
                },
                {
                    "id": "LYN_HUMAN",
                    "database": "ZINC - Investigational",
                    "url": ""
                },
                {
                    "id": "LYN_HUMAN",
                    "database": "ZINC - FDA approved",
                    "url": ""
                },
                {
                    "id": "3A4O",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1WA7",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1W1F",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "6NMW",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "P07948",
                    "database": "Pharos - Targets",
                    "url": ""
                },
                {
                    "id": "5XY1",
                    "database": "PDB",
                    "url": ""
                }
            ]
        },
        {
            "participant_id": "R-HSA-373640",
            "participant_name": "YES1 [cytosol]",
            "crossref": [
                {
                    "id": "P07947",
                    "database": "UniProt",
                    "url": ""
                },
                {
                    "id": "P07947",
                    "database": "PRO",
                    "url": ""
                },
                {
                    "id": "2284",
                    "database": "Guide to Pharmacology - Targets",
                    "url": ""
                },
                {
                    "id": "XP_016881449.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "2HDA",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSP00000462468",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "HMDBP01230",
                    "database": "HMDB Protein",
                    "url": ""
                },
                {
                    "id": "ENSG00000176105",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENST00000584307",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSG00000176105",
                    "database": "OpenTargets",
                    "url": ""
                },
                {
                    "id": "P07947",
                    "database": "GeneCards",
                    "url": ""
                },
                {
                    "id": "ENST00000314574",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "YES_HUMAN",
                    "database": "ZINC - Substances",
                    "url": ""
                },
                {
                    "id": "ENSP00000324740",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "YES_HUMAN",
                    "database": "ZINC - Investigational",
                    "url": ""
                },
                {
                    "id": "YES_HUMAN",
                    "database": "ZINC - World Drugs",
                    "url": ""
                },
                {
                    "id": "YES_HUMAN",
                    "database": "ZINC - Predictions - Purchasable",
                    "url": ""
                },
                {
                    "id": "YES_HUMAN",
                    "database": "ZINC - FDA approved",
                    "url": ""
                },
                {
                    "id": "YES_HUMAN",
                    "database": "ZINC - Biogenic",
                    "url": ""
                },
                {
                    "id": "NP_005424.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "P07947",
                    "database": "ZINC target",
                    "url": ""
                },
                {
                    "id": "P07947",
                    "database": "Pharos - Targets",
                    "url": ""
                },
                {
                    "id": "ENSG00000176105-YES1",
                    "database": "HPA",
                    "url": ""
                }
            ]
        },
        {
            "participant_id": "R-HSA-8853905",
            "participant_name": "CSF1R Gene [nucleoplasm]",
            "crossref": [
                {
                    "id": "ENSG00000182578",
                    "database": "ENSEMBL",
                    "url": ""
                }
            ]
        },
        {
            "participant_id": "R-HSA-913354",
            "participant_name": "INPPL1 [cytosol]",
            "crossref": [
                {
                    "id": "O15357",
                    "database": "UniProt",
                    "url": ""
                },
                {
                    "id": "O15357",
                    "database": "GeneCards",
                    "url": ""
                },
                {
                    "id": "5OKO",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5OKP",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "5OKN",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "O15357",
                    "database": "Pharos - Targets",
                    "url": ""
                },
                {
                    "id": "6SQU",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSP00000444619",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "3NR8",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "XP_011543301.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "4A9C",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1459",
                    "database": "Guide to Pharmacology - Targets",
                    "url": ""
                },
                {
                    "id": "ENST00000538751",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSG00000165458",
                    "database": "OpenTargets",
                    "url": ""
                },
                {
                    "id": "ENSG00000165458",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "5OKM",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENST00000298229",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000298229",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSG00000165458-INPPL1",
                    "database": "HPA",
                    "url": ""
                },
                {
                    "id": "2KSO",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2K4P",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2MK2",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "NP_001558.3",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "6SRR",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "HMDBP03264",
                    "database": "HMDB Protein",
                    "url": ""
                },
                {
                    "id": "O15357",
                    "database": "ZINC target",
                    "url": ""
                },
                {
                    "id": "O15357",
                    "database": "PRO",
                    "url": ""
                },
                {
                    "id": "21752",
                    "database": "Orphanet",
                    "url": ""
                }
            ]
        },
        {
            "participant_id": "R-HSA-9628701",
            "participant_name": "SRC [cytosol]",
            "crossref": [
                {
                    "id": "P12931",
                    "database": "UniProt",
                    "url": ""
                },
                {
                    "id": "2BDJ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "NP_938033.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "4MXO",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1O4C",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "XP_011527315.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "4MXX",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1O4D",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1O42",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1O4O",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1A07",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1O43",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "P12931",
                    "database": "ZINC target",
                    "url": ""
                },
                {
                    "id": "4MXY",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1O4E",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1A08",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "XP_016883513.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "1O4P",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2H8H",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "25273",
                    "database": "Orphanet",
                    "url": ""
                },
                {
                    "id": "1A09",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "SRC_HUMAN",
                    "database": "ZINC - FDA approved",
                    "url": ""
                },
                {
                    "id": "2206",
                    "database": "Guide to Pharmacology - Targets",
                    "url": ""
                },
                {
                    "id": "2SRC",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "XP_016883514.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "1O4L",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1YOL",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "7OTE",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4F5B",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "7T1U",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1YOM",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4HXJ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "SRC_HUMAN",
                    "database": "ZINC - Investigational",
                    "url": ""
                },
                {
                    "id": "1O4A",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1HCT",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4K11",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1O4B",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1KSW",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1O4M",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "SRC_HUMAN",
                    "database": "ZINC - Metabolites",
                    "url": ""
                },
                {
                    "id": "NP_005408.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "1O41",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1O4N",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2BDF",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "P12931",
                    "database": "GeneCards",
                    "url": ""
                },
                {
                    "id": "1O47",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1O4I",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1A1E",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "6E6E",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1Y57",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "6EHJ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1YI6",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "P12931",
                    "database": "PRO",
                    "url": ""
                },
                {
                    "id": "4F59",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1YOJ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSG00000197122",
                    "database": "OpenTargets",
                    "url": ""
                },
                {
                    "id": "4F5A",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1O48",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1O4J",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1FMK",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1O49",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1O4K",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1HCS",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "SRC_HUMAN",
                    "database": "ZINC - Predictions - Purchasable",
                    "url": ""
                },
                {
                    "id": "7NG7",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "3VRO",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1A1A",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1O4F",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "XP_016883515.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "1O44",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "P12931",
                    "database": "Pharos - Targets",
                    "url": ""
                },
                {
                    "id": "1O4Q",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "SRC_HUMAN",
                    "database": "ZINC - Biogenic",
                    "url": ""
                },
                {
                    "id": "ENST00000373578",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "1O4H",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENST00000373567",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000508666",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000509325",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000362680",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "1O46",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSG00000197122",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "1A1C",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSP00000362668",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000362659",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENST00000692423",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENST00000692112",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000350941",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENST00000373558",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "3ZMQ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENST00000358208",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "3ZMP",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1A1B",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSG00000197122-SRC",
                    "database": "HPA",
                    "url": ""
                },
                {
                    "id": "SRC_HUMAN",
                    "database": "ZINC - World Drugs",
                    "url": ""
                },
                {
                    "id": "6C4S",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1SHD",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1O4R",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "6ATE",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "XP_016883516.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "1O4G",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "SRC_HUMAN",
                    "database": "ZINC - Substances",
                    "url": ""
                },
                {
                    "id": "1O45",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4MXZ",
                    "database": "PDB",
                    "url": ""
                }
            ]
        },
        {
            "participant_id": "R-HSA-9682751",
            "participant_name": "THOC5 [cytosol]",
            "crossref": [
                {
                    "id": "Q13769",
                    "database": "UniProt",
                    "url": ""
                },
                {
                    "id": "ENSP00000380970",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "7ZNL",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "Q13769",
                    "database": "GeneCards",
                    "url": ""
                },
                {
                    "id": "ENST00000397873",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000380971",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "Q13769",
                    "database": "Pharos - Targets",
                    "url": ""
                },
                {
                    "id": "ENSG00000100296-THOC5",
                    "database": "HPA",
                    "url": ""
                },
                {
                    "id": "ENST00000490103",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSG00000100296",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000420306",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "NP_003669.4",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "ENSP00000380969",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENST00000397872",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENST00000397871",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "NP_001002877.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "7APK",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "Q13769",
                    "database": "PRO",
                    "url": ""
                },
                {
                    "id": "ENSG00000100296",
                    "database": "OpenTargets",
                    "url": ""
                },
                {
                    "id": "HMDBP14137",
                    "database": "HMDB Protein",
                    "url": ""
                },
                {
                    "id": "7ZNK",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "NP_001002878.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "NP_001002879.1",
                    "database": "RefSeq",
                    "url": ""
                }
            ]
        }
    ],
    "reaction_enzymes": [
        {
            "uniprot_ac": "A0A0G2JW59",
            "gene_name": "Flt3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "A0A0G2JW59",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A0G2JW59"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A0G2JW59",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A0G2JW59"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A0G2K6M9",
            "gene_name": "Btk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "A0A0G2K6M9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A0G2K6M9"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A0G2K6M9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A0G2K6M9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A0R4J8U1",
            "gene_name": "Zap70",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "A0A0R4J8U1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A0R4J8U1"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A0R4J8U1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A0R4J8U1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A8I5ZP97",
            "gene_name": "Dyrk1b",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "A0A8I5ZP97",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I5ZP97"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A8I5ZP97",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I5ZP97"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A8I5ZVE3",
            "gene_name": "Ephb3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "A0A8I5ZVE3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I5ZVE3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A8I5ZVE3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I5ZVE3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A8I6A5T6",
            "gene_name": "Mst1r",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "A0A8I6A5T6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6A5T6"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A8I6A5T6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6A5T6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A8I6AM23",
            "gene_name": "Jak1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "A0A8I6AM23",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6AM23"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A8I6AM23",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6AM23"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A8I6AWX7",
            "gene_name": "Dyrk4",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "A0A8I6AWX7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6AWX7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A8I6AWX7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6AWX7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A8I6GCV6",
            "gene_name": "Ltk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "A0A8I6GCV6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6GCV6"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A8I6GCV6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6GCV6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "B1WC09",
            "gene_name": "Ddr2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "B1WC09",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/B1WC09"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "B1WC09",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/B1WC09"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "B2RYC7",
            "gene_name": "Tec",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "B2RYC7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/B2RYC7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "B2RYC7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/B2RYC7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "B5DFD6",
            "gene_name": "Tie1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "B5DFD6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/B5DFD6"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "B5DFD6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/B5DFD6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZBN3",
            "gene_name": "Epha2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "D3ZBN3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZBN3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZBN3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZBN3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZCD0",
            "gene_name": "Tek",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "D3ZCD0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZCD0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZCD0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZCD0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZD03",
            "gene_name": "Tyk2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "D3ZD03",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZD03"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZD03",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZD03"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZDH4",
            "gene_name": "Epha1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "D3ZDH4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZDH4"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZDH4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZDH4"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZDS3",
            "gene_name": "Ptk6",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "D3ZDS3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZDS3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZDS3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZDS3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZJI4",
            "gene_name": "Tnk1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "D3ZJI4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZJI4"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZJI4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZJI4"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZZK3",
            "gene_name": "Epha4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "D3ZZK3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZZK3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZZK3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZZK3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D4A584",
            "gene_name": "Fes",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "D4A584",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4A584"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D4A584",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4A584"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D4A7W7",
            "gene_name": "Itk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "D4A7W7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4A7W7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D4A7W7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4A7W7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D4ADZ5",
            "gene_name": "Wee2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "D4ADZ5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4ADZ5"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D4ADZ5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4ADZ5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "E1JHB7",
            "gene_name": "Pvr",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "E1JHB7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/E1JHB7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "E9PSY0",
            "gene_name": "Axl",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "E9PSY0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/E9PSY0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "E9PSY0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/E9PSY0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "E9PT20",
            "gene_name": "Abl1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "E9PT20",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/E9PT20"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "E9PT20",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/E9PT20"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1LM93",
            "gene_name": "Yes1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "F1LM93",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LM93"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1LM93",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LM93"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1LRZ0",
            "gene_name": "Alk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "F1LRZ0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LRZ0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1LRZ0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LRZ0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1LSG7",
            "gene_name": "Fgfr2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "F1LSG7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LSG7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1LSG7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LSG7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1LSN4",
            "gene_name": "Fgfr3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "F1LSN4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LSN4"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1LSN4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LSN4"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1LVI0",
            "gene_name": "Bmx",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "F1LVI0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LVI0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1LVI0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LVI0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1LYY7",
            "gene_name": "Dyrk2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "F1LYY7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LYY7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1LYY7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LYY7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1M0N1",
            "gene_name": "Abl2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "F1M0N1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1M0N1"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1M0N1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1M0N1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1MAJ0",
            "gene_name": "Ephb2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "F1MAJ0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1MAJ0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1MAJ0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1MAJ0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "G3V6K6",
            "gene_name": "Egfr",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "G3V6K6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V6K6"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "G3V6K6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V6K6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "G3V783",
            "gene_name": "Ripk2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "G3V783",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V783"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "G3V783",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V783"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "G3V783",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V783"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "G3V783",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V783"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "G3V9H8",
            "gene_name": "Ret",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "G3V9H8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V9H8"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "G3V9H8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V9H8"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "M0R7E7",
            "gene_name": "Map2k3",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "M0R7E7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/M0R7E7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "M0R7E7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/M0R7E7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "M0RDA4",
            "gene_name": "Ephb4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "M0RDA4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/M0RDA4"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "M0RDA4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/M0RDA4"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O08680",
            "gene_name": "Epha3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O08680",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O08680"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O08680",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O08680"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O08775",
            "gene_name": "Kdr",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O08775",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O08775"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O08775",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O08775"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O09110",
            "gene_name": "Map2k3",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O09110",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O09110"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O09110",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O09110"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O09127",
            "gene_name": "Epha8",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O09127",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O09127"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O09127",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O09127"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O14733",
            "gene_name": "MAP2K7",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O14733",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O14733"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O14733",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O14733"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O15146",
            "gene_name": "MUSK",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O15146",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O15146"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O15146",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O15146"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O15357",
            "gene_name": "INPPL1",
            "activity": [
                {
                    "ec_number": "3.1.3.86",
                    "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + H2O = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4-bisphosphate) + phosphate.",
                    "evidence": [
                        {
                            "id": "O15357",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O15357"
                        }
                    ]
                },
                {
                    "ec_number": "3.1.3.86",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O15357",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O15357"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O35346",
            "gene_name": "Ptk2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O35346",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O35346"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O35346",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O35346"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O35491",
            "gene_name": "Clk2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O35491",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O35491"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O35491",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O35491"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O35492",
            "gene_name": "Clk3",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O35492",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O35492"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O35492",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O35492"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O35493",
            "gene_name": "Clk4",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O35493",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O35493"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O35493",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O35493"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O43353",
            "gene_name": "RIPK2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O43353",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O43353"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O43353",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O43353"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O43353",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O43353"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O43781",
            "gene_name": "DYRK3",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O43781",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O43781"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O43781",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O43781"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O54804",
            "gene_name": "Chka",
            "activity": [
                {
                    "ec_number": "2.7.1.32",
                    "activity": "ATP + choline = ADP + H(+) + phosphocholine.",
                    "evidence": [
                        {
                            "id": "O54804",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O54804"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.82",
                    "activity": "ATP + ethanolamine = ADP + H(+) + phosphoethanolamine.",
                    "evidence": [
                        {
                            "id": "O54804",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O54804"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.32",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O54804",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O54804"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.82",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O54804",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O54804"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O54967",
            "gene_name": "Tnk2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O54967",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O54967"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O54967",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O54967"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O54967",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O54967"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O54967",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O54967"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O60674",
            "gene_name": "JAK2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O60674",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O60674"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O60674",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O60674"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O61444",
            "gene_name": "Mkk4",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O61444",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O61444"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O61444",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O61444"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O62602",
            "gene_name": "lic",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O62602",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O62602"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O62602",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O62602"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O70146",
            "gene_name": "Tesk1",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O70146",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O70146"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O70146",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O70146"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O75716",
            "gene_name": "STK16",
            "activity": [
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O75716",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O75716"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O75716",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O75716"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O75716",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O75716"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O88697",
            "gene_name": "Stk16",
            "activity": [
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O88697",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O88697"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O88697",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O88697"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O88697",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O88697"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P00519",
            "gene_name": "ABL1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P00519",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00519"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P00519",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00519"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P00520",
            "gene_name": "Abl1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P00520",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00520"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P00520",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00520"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P00522",
            "gene_name": "Abl",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P00522",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00522"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P00522",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00522"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P00528",
            "gene_name": "Src64B",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P00528",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00528"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P00528",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00528"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P00533",
            "gene_name": "EGFR",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P00533",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00533"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P00533",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00533"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P01116",
            "gene_name": "KRAS",
            "activity": [
                {
                    "ec_number": "3.6.5.2",
                    "activity": "GTP + H2O = GDP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "P01116",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P01116"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.5.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P01116",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P01116"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P04412",
            "gene_name": "Egfr",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P04412",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P04412"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P04412",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P04412"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P04626",
            "gene_name": "ERBB2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P04626",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P04626"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P04626",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P04626"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P04629",
            "gene_name": "NTRK1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P04629",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P04629"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P04629",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P04629"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P05480",
            "gene_name": "Src",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P05480",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P05480"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P05480",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P05480"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P05532",
            "gene_name": "Kit",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P05532",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P05532"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P05532",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P05532"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P05622",
            "gene_name": "Pdgfrb",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P05622",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P05622"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P05622",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P05622"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P06213",
            "gene_name": "INSR",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P06213",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06213"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P06213",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06213"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P06239",
            "gene_name": "LCK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P06239",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06239"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P06239",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06239"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P06240",
            "gene_name": "Lck",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P06240",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06240"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P06240",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06240"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P06241",
            "gene_name": "FYN",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P06241",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06241"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P06241",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06241"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P06494",
            "gene_name": "Erbb2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P06494",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06494"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P06494",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06494"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P06784",
            "gene_name": "STE7",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P06784",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06784"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P06784",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06784"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P07332",
            "gene_name": "FES",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P07332",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07332"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P07332",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07332"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P07333",
            "gene_name": "CSF1R",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P07333",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07333"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P07333",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07333"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P07947",
            "gene_name": "YES1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P07947",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07947"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P07947",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07947"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P07948",
            "gene_name": "LYN",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P07948",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07948"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P07948",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07948"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P07949",
            "gene_name": "RET",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P07949",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07949"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P07949",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07949"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P08018",
            "gene_name": "PBS2",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P08018",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08018"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P08018",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08018"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P08069",
            "gene_name": "IGF1R",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P08069",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08069"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P08069",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08069"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P08103",
            "gene_name": "Hck",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P08103",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08103"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P08103",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08103"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P08581",
            "gene_name": "MET",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P08581",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08581"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P08581",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08581"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P08630",
            "gene_name": "Btk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P08630",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08630"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P08630",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08630"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P08631",
            "gene_name": "HCK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P08631",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08631"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P08631",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08631"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P08922",
            "gene_name": "ROS1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P08922",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08922"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P08922",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08922"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P08923",
            "gene_name": "Ltk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P08923",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08923"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P08923",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08923"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P09208",
            "gene_name": "InR",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P09208",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09208"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P09208",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09208"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P09215",
            "gene_name": "Prkcd",
            "activity": [
                {
                    "ec_number": "2.7.11.13",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P09215",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09215"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P09215",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09215"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P09581",
            "gene_name": "Csf1r",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P09581",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09581"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P09619",
            "gene_name": "PDGFRB",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P09619",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09619"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P09619",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09619"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P09759",
            "gene_name": "Ephb1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P09759",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09759"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P09759",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09759"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P09760",
            "gene_name": "Fer",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P09760",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09760"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P09760",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09760"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P09769",
            "gene_name": "FGR",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P09769",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09769"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P09769",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09769"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P0C1S8",
            "gene_name": "WEE2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P0C1S8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P0C1S8"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P0C1S8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P0C1S8"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P10721",
            "gene_name": "KIT",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P10721",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P10721"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P10721",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P10721"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P11362",
            "gene_name": "FGFR1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P11362",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P11362"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P11362",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P11362"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P11980",
            "gene_name": "Pkm",
            "activity": [
                {
                    "ec_number": "2.7.1.40",
                    "activity": "CTP + pyruvate = CDP + H(+) + phosphoenolpyruvate.",
                    "evidence": [
                        {
                            "id": "P11980",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P11980"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.40",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P11980",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P11980"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P11980",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P11980"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P11980",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P11980"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P12931",
            "gene_name": "SRC",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P12931",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P12931"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P12931",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P12931"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P13368",
            "gene_name": "sev",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P13368",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P13368"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P13368",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P13368"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P14234",
            "gene_name": "Fgr",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P14234",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14234"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P14234",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14234"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P14616",
            "gene_name": "INSRR",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P14616",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14616"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P14616",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14616"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P14618",
            "gene_name": "PKM",
            "activity": [
                {
                    "ec_number": "2.7.1.40",
                    "activity": "CTP + pyruvate = CDP + H(+) + phosphoenolpyruvate.",
                    "evidence": [
                        {
                            "id": "P14618",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14618"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.40",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P14618",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14618"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P14618",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14618"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P14618",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14618"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P14680",
            "gene_name": "YAK1",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P14680",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14680"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P14680",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14680"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P15127",
            "gene_name": "Insr",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P15127",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P15127"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P15127",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P15127"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P15208",
            "gene_name": "Insr",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P15208",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P15208"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P15208",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P15208"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P15209",
            "gene_name": "Ntrk2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P15209",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P15209"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P15209",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P15209"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P16056",
            "gene_name": "Met",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P16056",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16056"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P16056",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16056"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P16092",
            "gene_name": "Fgfr1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P16092",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16092"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P16092",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16092"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P16234",
            "gene_name": "PDGFRA",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P16234",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16234"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P16234",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16234"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P16277",
            "gene_name": "Blk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P16277",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16277"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P16277",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16277"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P16591",
            "gene_name": "FER",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P16591",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16591"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P16591",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16591"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P16879",
            "gene_name": "Fes",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P16879",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16879"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P16879",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16879"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P16885",
            "gene_name": "PLCG2",
            "activity": [
                {
                    "ec_number": "3.1.4.11",
                    "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).",
                    "evidence": [
                        {
                            "id": "P16885",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16885"
                        }
                    ]
                },
                {
                    "ec_number": "3.1.4.11",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P16885",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16885"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P17948",
            "gene_name": "FLT1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P17948",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P17948"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P17948",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P17948"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P18106",
            "gene_name": "FER",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P18106",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P18106"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P18106",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P18106"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P18160",
            "gene_name": "splA",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P18160",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P18160"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P18160",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P18160"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P18161",
            "gene_name": "splB",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P18161",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P18161"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P18161",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P18161"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P18475",
            "gene_name": "tor",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P18475",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P18475"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P18475",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P18475"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P19525",
            "gene_name": "EIF2AK2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P19525",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P19525"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P19525",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P19525"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P19525",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P19525"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P20786",
            "gene_name": "Pdgfra",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P20786",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P20786"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P20786",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P20786"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P21709",
            "gene_name": "EPHA1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P21709",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21709"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P21709",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21709"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P21802",
            "gene_name": "FGFR2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P21802",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21802"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P21802",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21802"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P21803",
            "gene_name": "Fgfr2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P21803",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21803"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P21803",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21803"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P21860",
            "gene_name": "ERBB3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P21860",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21860"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P21860",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21860"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P21965",
            "gene_name": "MCK1",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P21965",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21965"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P21965",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21965"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P22216",
            "gene_name": "RAD53",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P22216",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22216"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P22216",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22216"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P22455",
            "gene_name": "FGFR4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P22455",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22455"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P22455",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22455"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P22518",
            "gene_name": "Clk1",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P22518",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22518"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P22518",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22518"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P22607",
            "gene_name": "FGFR3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P22607",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22607"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P22607",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22607"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P22681",
            "gene_name": "CBL",
            "activity": [
                {
                    "ec_number": "2.3.2.27",
                    "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
                    "evidence": [
                        {
                            "id": "P22681",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22681"
                        }
                    ]
                },
                {
                    "ec_number": "2.3.2.27",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P22681",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22681"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P23458",
            "gene_name": "JAK1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P23458",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P23458"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P23458",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P23458"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P24062",
            "gene_name": "Igf1r",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P24062",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P24062"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P24062",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P24062"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P24604",
            "gene_name": "Tec",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P24604",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P24604"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P24604",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P24604"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P25911",
            "gene_name": "Lyn",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P25911",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P25911"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P25911",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P25911"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P26618",
            "gene_name": "Pdgfra",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P26618",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P26618"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P26618",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P26618"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P28867",
            "gene_name": "Prkcd",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P28867",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P28867"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.13",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P28867",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P28867"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P28867",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P28867"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P29317",
            "gene_name": "EPHA2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P29317",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29317"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P29317",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29317"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P29319",
            "gene_name": "Epha3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P29319",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29319"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P29319",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29319"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P29320",
            "gene_name": "EPHA3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P29320",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29320"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P29320",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29320"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P29321",
            "gene_name": "Epha8",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P29321",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29321"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P29321",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29321"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P29322",
            "gene_name": "EPHA8",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P29322",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29322"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P29322",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29322"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P29323",
            "gene_name": "EPHB2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P29323",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29323"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P29323",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29323"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P29376",
            "gene_name": "LTK",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P29376",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29376"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P29376",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29376"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P29597",
            "gene_name": "TYK2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P29597",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29597"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P29597",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29597"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P30291",
            "gene_name": "WEE1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P30291",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P30291"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P30291",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P30291"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P30530",
            "gene_name": "AXL",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P30530",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P30530"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P30530",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P30530"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P31938",
            "gene_name": "Map2k1",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P31938",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P31938"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P31938",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P31938"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P32350",
            "gene_name": "KNS1",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P32350",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P32350"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P32350",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P32350"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P32490",
            "gene_name": "MKK1",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P32490",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P32490"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P32490",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P32490"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P32491",
            "gene_name": "MKK2",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P32491",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P32491"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P32491",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P32491"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P32577",
            "gene_name": "Csk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P32577",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P32577"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P32577",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P32577"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P33981",
            "gene_name": "TTK",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P33981",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P33981"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P33981",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P33981"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P34152",
            "gene_name": "Ptk2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P34152",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P34152"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P34152",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P34152"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P34925",
            "gene_name": "RYK",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P34925",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P34925"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P34925",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P34925"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35546",
            "gene_name": "Ret",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P35546",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35546"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35546",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35546"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35590",
            "gene_name": "TIE1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P35590",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35590"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35590",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35590"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35739",
            "gene_name": "Ntrk1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P35739",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35739"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35739",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35739"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35761",
            "gene_name": "Ttk",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P35761",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35761"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35761",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35761"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35790",
            "gene_name": "CHKA",
            "activity": [
                {
                    "ec_number": "2.7.1.82",
                    "activity": "ATP + ethanolamine = ADP + H(+) + phosphoethanolamine.",
                    "evidence": [
                        {
                            "id": "P35790",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35790"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.82",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35790",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35790"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.32",
                    "activity": "ATP + choline = ADP + H(+) + phosphocholine.",
                    "evidence": [
                        {
                            "id": "P35790",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35790"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.32",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35790",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35790"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35916",
            "gene_name": "FLT4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P35916",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35916"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35916",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35916"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35917",
            "gene_name": "Flt4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P35917",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35917"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35917",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35917"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35918",
            "gene_name": "Kdr",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P35918",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35918"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35918",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35918"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35968",
            "gene_name": "KDR",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P35968",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35968"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35968",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35968"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35969",
            "gene_name": "Flt1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P35969",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35969"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35969",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35969"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35991",
            "gene_name": "Btk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P35991",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35991"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35991",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35991"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P36506",
            "gene_name": "Map2k2",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P36506",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P36506"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P36506",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P36506"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P36507",
            "gene_name": "MAP2K2",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P36507",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P36507"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P36507",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P36507"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P36888",
            "gene_name": "FLT3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P36888",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P36888"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P36888",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P36888"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P39688",
            "gene_name": "Fyn",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P39688",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P39688"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P39688",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P39688"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P41240",
            "gene_name": "CSK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P41240",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P41240"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P41240",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P41240"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P41241",
            "gene_name": "Csk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P41241",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P41241"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P41241",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P41241"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P41242",
            "gene_name": "Matk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P41242",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P41242"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P41242",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P41242"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P41243",
            "gene_name": "Matk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P41243",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P41243"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P41243",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P41243"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P42336",
            "gene_name": "PIK3CA",
            "activity": [
                {
                    "ec_number": "2.7.1.153",
                    "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).",
                    "evidence": [
                        {
                            "id": "P42336",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42336"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.153",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42336",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42336"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P42336",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42336"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.137",
                    "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).",
                    "evidence": [
                        {
                            "id": "P42336",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42336"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.137",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42336",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42336"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P42338",
            "gene_name": "PIK3CB",
            "activity": [
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P42338",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42338"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.153",
                    "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).",
                    "evidence": [
                        {
                            "id": "P42338",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42338"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.153",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42338",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42338"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.137",
                    "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).",
                    "evidence": [
                        {
                            "id": "P42338",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42338"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.137",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42338",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42338"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P42679",
            "gene_name": "MATK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P42679",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42679"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42679",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42679"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P42680",
            "gene_name": "TEC",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P42680",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42680"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42680",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42680"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P42681",
            "gene_name": "TXK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P42681",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42681"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42681",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42681"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P42682",
            "gene_name": "Txk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P42682",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42682"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42682",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42682"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P42684",
            "gene_name": "ABL2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P42684",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42684"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42684",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42684"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P42685",
            "gene_name": "FRK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P42685",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42685"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42685",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42685"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P43403",
            "gene_name": "ZAP70",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P43403",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P43403"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P43403",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P43403"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P43404",
            "gene_name": "Zap70",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P43404",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P43404"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P43404",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P43404"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P43405",
            "gene_name": "SYK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P43405",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P43405"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P43405",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P43405"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P45985",
            "gene_name": "MAP2K4",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P45985",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P45985"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P45985",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P45985"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P46734",
            "gene_name": "MAP2K3",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P46734",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P46734"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P46734",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P46734"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P47809",
            "gene_name": "Map2k4",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P47809",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P47809"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P47809",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P47809"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P47810",
            "gene_name": "Wee1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P47810",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P47810"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P47810",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P47810"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P48025",
            "gene_name": "Syk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P48025",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P48025"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P48025",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P48025"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P48736",
            "gene_name": "PIK3CG",
            "activity": [
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P48736",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P48736"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.153",
                    "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).",
                    "evidence": [
                        {
                            "id": "P48736",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P48736"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.137",
                    "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).",
                    "evidence": [
                        {
                            "id": "P48736",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P48736"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.154",
                    "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4-bisphosphate) + ADP + H(+).",
                    "evidence": [
                        {
                            "id": "P48736",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P48736"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.153",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P48736",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P48736"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.137",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P48736",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P48736"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.154",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P48736",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P48736"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P49657",
            "gene_name": "mnb",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P49657",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49657"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P49657",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49657"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P49759",
            "gene_name": "CLK1",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P49759",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49759"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P49759",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49759"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P49760",
            "gene_name": "CLK2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P49760",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49760"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P49760",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49760"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P49761",
            "gene_name": "CLK3",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P49761",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49761"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P49761",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49761"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P49762",
            "gene_name": "Doa",
            "activity": [
                {
                    "ec_number": "2.7.11.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P49762",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49762"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P49762",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49762"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P49762",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49762"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P50545",
            "gene_name": "Hck",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P50545",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P50545"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P50545",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P50545"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P51451",
            "gene_name": "BLK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P51451",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P51451"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P51451",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P51451"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P51813",
            "gene_name": "BMX",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P51813",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P51813"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P51813",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P51813"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P52332",
            "gene_name": "Jak1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P52332",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52332"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P52332",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52332"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P52333",
            "gene_name": "JAK3",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P52333",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52333"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P52333",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52333"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P52480",
            "gene_name": "Pkm",
            "activity": [
                {
                    "ec_number": "2.7.1.40",
                    "activity": "CTP + pyruvate = CDP + H(+) + phosphoenolpyruvate.",
                    "evidence": [
                        {
                            "id": "P52480",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52480"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.40",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P52480",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52480"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P52480",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52480"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P52480",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52480"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P52564",
            "gene_name": "MAP2K6",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P52564",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52564"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P52564",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52564"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P53767",
            "gene_name": "Flt1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P53767",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P53767"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P53767",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P53767"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54199",
            "gene_name": "MPS1",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P54199",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54199"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54199",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54199"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54350",
            "gene_name": "Wee1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54350",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54350"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54350",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54350"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54753",
            "gene_name": "EPHB3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54753",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54753"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54753",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54753"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54754",
            "gene_name": "Ephb3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54754",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54754"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54754",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54754"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54756",
            "gene_name": "EPHA5",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54756",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54756"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54756",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54756"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54757",
            "gene_name": "Epha5",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54757",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54757"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54757",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54757"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54758",
            "gene_name": "Epha6",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54758",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54758"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54758",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54758"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54759",
            "gene_name": "Epha7",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54759",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54759"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54759",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54759"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54760",
            "gene_name": "EPHB4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54760",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54760"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54760",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54760"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54761",
            "gene_name": "Ephb4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54761",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54761"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54761",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54761"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54762",
            "gene_name": "EPHB1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54762",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54762"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54762",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54762"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54763",
            "gene_name": "Ephb2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54763",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54763"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54763",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54763"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54764",
            "gene_name": "EPHA4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54764",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54764"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54764",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54764"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P55144",
            "gene_name": "Tyro3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P55144",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P55144"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P55144",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P55144"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P55146",
            "gene_name": "Tyro3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P55146",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P55146"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P55146",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P55146"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P57097",
            "gene_name": "Mertk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P57097",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P57097"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P57097",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P57097"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P57760",
            "gene_name": "Stk16",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P57760",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P57760"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P57760",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P57760"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P57760",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P57760"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P58801",
            "gene_name": "Ripk2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P58801",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P58801"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P58801",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P58801"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P58801",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P58801"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P70236",
            "gene_name": "Map2k6",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P70236",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P70236"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P70236",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P70236"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P70424",
            "gene_name": "Erbb2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P70424",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P70424"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P70424",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P70424"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P70451",
            "gene_name": "Fer",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P70451",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P70451"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P70451",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P70451"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P70600",
            "gene_name": "Ptk2b",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P70600",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P70600"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P70600",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P70600"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P83102",
            "gene_name": "Dyrk3",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P83102",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P83102"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P83102",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P83102"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P97504",
            "gene_name": "Bmx",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P97504",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P97504"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P97504",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P97504"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P97523",
            "gene_name": "Met",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P97523",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P97523"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P97523",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P97523"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P97793",
            "gene_name": "Alk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P97793",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P97793"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P97793",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P97793"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q00342",
            "gene_name": "Flt3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q00342",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q00342"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q00342",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q00342"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q00495",
            "gene_name": "Csf1r",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q00495",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q00495"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q00495",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q00495"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q00993",
            "gene_name": "Axl",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q00993",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q00993"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q00993",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q00993"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q01134",
            "gene_name": "Chka",
            "activity": [
                {
                    "ec_number": "2.7.1.82",
                    "activity": "ATP + ethanolamine = ADP + H(+) + phosphoethanolamine.",
                    "evidence": [
                        {
                            "id": "Q01134",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01134"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.82",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q01134",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01134"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.32",
                    "activity": "ATP + choline = ADP + H(+) + phosphocholine.",
                    "evidence": [
                        {
                            "id": "Q01134",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01134"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.32",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q01134",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01134"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q01279",
            "gene_name": "Egfr",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q01279",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01279"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q01279",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01279"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q01621",
            "gene_name": "Lck",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q01621",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01621"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q01621",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01621"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q01887",
            "gene_name": "Ryk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q01887",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01887"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q01887",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01887"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q01974",
            "gene_name": "ROR2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q01974",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01974"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q01974",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01974"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q01986",
            "gene_name": "Map2k1",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q01986",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01986"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q01986",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01986"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q02750",
            "gene_name": "MAP2K1",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q02750",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q02750"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q02750",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q02750"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q02763",
            "gene_name": "TEK",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q02763",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q02763"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q02763",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q02763"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q02858",
            "gene_name": "Tek",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q02858",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q02858"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q02858",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q02858"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q03137",
            "gene_name": "Epha4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q03137",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03137"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q03137",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03137"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q03142",
            "gene_name": "Fgfr4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q03142",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03142"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q03142",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03142"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q03145",
            "gene_name": "Epha2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q03145",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03145"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q03145",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03145"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q03146",
            "gene_name": "Ddr1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q03146",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03146"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q03146",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03146"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q03351",
            "gene_name": "Ntrk3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q03351",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03351"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q03351",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03351"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q03526",
            "gene_name": "Itk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q03526",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03526"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q03526",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03526"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q03963",
            "gene_name": "Eif2ak2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q03963",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03963"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q03963",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03963"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q03963",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03963"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q04589",
            "gene_name": "Fgfr1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q04589",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q04589"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q04589",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q04589"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q04736",
            "gene_name": "Yes1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q04736",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q04736"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q04736",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q04736"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q04912",
            "gene_name": "MST1R",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q04912",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q04912"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q04912",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q04912"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q05030",
            "gene_name": "Pdgfrb",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q05030",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q05030"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q05030",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q05030"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q05397",
            "gene_name": "PTK2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q05397",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q05397"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q05397",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q05397"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q05655",
            "gene_name": "PRKCD",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q05655",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q05655"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.13",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q05655",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q05655"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q05655",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q05655"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q06124",
            "gene_name": "PTPN11",
            "activity": [
                {
                    "ec_number": "3.1.3.48",
                    "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.",
                    "evidence": [
                        {
                            "id": "Q06124",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q06124"
                        }
                    ]
                },
                {
                    "ec_number": "3.1.3.48",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q06124",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q06124"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q06187",
            "gene_name": "BTK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q06187",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q06187"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q06187",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q06187"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q06418",
            "gene_name": "TYRO3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q06418",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q06418"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q06418",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q06418"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q06806",
            "gene_name": "Tie1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q06806",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q06806"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q06806",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q06806"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q07014",
            "gene_name": "Lyn",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q07014",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q07014"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q07014",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q07014"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q07407",
            "gene_name": "htl",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q07407",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q07407"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q07407",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q07407"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q07912",
            "gene_name": "TNK2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q07912",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q07912"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q07912",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q07912"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q07912",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q07912"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q07912",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q07912"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q08345",
            "gene_name": "DDR1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q08345",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q08345"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q08345",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q08345"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q08881",
            "gene_name": "ITK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q08881",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q08881"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q08881",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q08881"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q09147",
            "gene_name": "btl",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q09147",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q09147"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q09147",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q09147"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q12866",
            "gene_name": "MERTK",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q12866",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q12866"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q12866",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q12866"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q13163",
            "gene_name": "MAP2K5",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q13163",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13163"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q13163",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13163"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q13470",
            "gene_name": "TNK1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q13470",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13470"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q13470",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13470"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q13627",
            "gene_name": "DYRK1A",
            "activity": [
                {
                    "ec_number": "2.7.11.23",
                    "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].",
                    "evidence": [
                        {
                            "id": "Q13627",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13627"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q13627",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13627"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.23",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q13627",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13627"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q13627",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13627"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q13882",
            "gene_name": "PTK6",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q13882",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13882"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q13882",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13882"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q14289",
            "gene_name": "PTK2B",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q14289",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q14289"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q14289",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q14289"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q14680",
            "gene_name": "MELK",
            "activity": [
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q14680",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q14680"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q14680",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q14680"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q14680",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q14680"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q15303",
            "gene_name": "ERBB4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q15303",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q15303"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q15303",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q15303"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q15375",
            "gene_name": "EPHA7",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q15375",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q15375"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q15375",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q15375"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q15569",
            "gene_name": "TESK1",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q15569",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q15569"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q15569",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q15569"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q16288",
            "gene_name": "NTRK3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q16288",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q16288"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q16288",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q16288"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q16620",
            "gene_name": "NTRK2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q16620",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q16620"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q16620",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q16620"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q16832",
            "gene_name": "DDR2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q16832",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q16832"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q16832",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q16832"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q23977",
            "gene_name": "hep",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q23977",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q23977"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q23977",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q23977"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q24145",
            "gene_name": "Shark",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q24145",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q24145"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q24145",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q24145"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q24324",
            "gene_name": "Dsor1",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q24324",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q24324"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q24324",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q24324"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q24488",
            "gene_name": "Ror",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q24488",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q24488"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q24488",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q24488"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q24592",
            "gene_name": "hop",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q24592",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q24592"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q24592",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q24592"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q27324",
            "gene_name": "drl",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q27324",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q27324"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q27324",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q27324"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q3UFB7",
            "gene_name": "Ntrk1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q3UFB7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q3UFB7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q3UFB7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q3UFB7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q498D6",
            "gene_name": "Fgfr4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q498D6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q498D6"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q498D6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q498D6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q4JIM5",
            "gene_name": "Abl2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q4JIM5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4JIM5"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q4JIM5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4JIM5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q4KM97",
            "gene_name": "Blk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q4KM97",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4KM97"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q4KM97",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4KM97"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q4KSH6",
            "gene_name": "Map2k4",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q4KSH6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4KSH6"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q4KSH6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4KSH6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q4KSH7",
            "gene_name": "Map2k7",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q4KSH7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4KSH7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q4KSH7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4KSH7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q4V8A3",
            "gene_name": "Dyrk3",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q4V8A3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4V8A3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q4V8A3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4V8A3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q501W1",
            "gene_name": "Txk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q501W1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q501W1"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q501W1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q501W1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q504Y2",
            "gene_name": "PKDCC",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q504Y2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q504Y2"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q504Y2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q504Y2"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q54BC9",
            "gene_name": "dyrk2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q54BC9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54BC9"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q54BC9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54BC9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q54G28",
            "gene_name": "",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q54G28",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54G28"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q54G28",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54G28"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q54I36",
            "gene_name": "pyk3",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q54I36",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54I36"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q54I36",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54I36"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q54N73",
            "gene_name": "7tmk1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q54N73",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54N73"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q54N73",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54N73"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q54QV3",
            "gene_name": "yakA",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q54QV3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54QV3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q54QV3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54QV3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q54R58",
            "gene_name": "",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q54R58",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54R58"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q54R58",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54R58"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q552C6",
            "gene_name": "zak2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q552C6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q552C6"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q552C6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q552C6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q55CL6",
            "gene_name": "mekA",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q55CL6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q55CL6"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q55CL6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q55CL6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q5FVG7",
            "gene_name": "Srms",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q5FVG7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5FVG7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q5FVG7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5FVG7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q5JZY3",
            "gene_name": "EPHA10",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q5JZY3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5JZY3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q5JZY3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5JZY3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q5RJI4",
            "gene_name": "Pkdcc",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q5RJI4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5RJI4"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q5RJI4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5RJI4"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q5U2X5",
            "gene_name": "Tnk2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q5U2X5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5U2X5"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q5U2X5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5U2X5"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q5U2X5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5U2X5"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q5U2X5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5U2X5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q5U4C9",
            "gene_name": "Dyrk2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q5U4C9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5U4C9"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q5U4C9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5U4C9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q60629",
            "gene_name": "Epha5",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q60629",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q60629"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q60629",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q60629"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q60750",
            "gene_name": "Epha1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q60750",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q60750"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q60750",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q60750"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q60751",
            "gene_name": "Igf1r",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q60751",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q60751"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q60751",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q60751"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q60805",
            "gene_name": "Mertk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q60805",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q60805"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q60805",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q60805"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q61006",
            "gene_name": "Musk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q61006",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61006"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q61006",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61006"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q61214",
            "gene_name": "Dyrk1a",
            "activity": [
                {
                    "ec_number": "2.7.11.23",
                    "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].",
                    "evidence": [
                        {
                            "id": "Q61214",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61214"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q61214",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61214"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q61214",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61214"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.23",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q61214",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61214"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q61526",
            "gene_name": "Erbb3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q61526",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61526"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q61526",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61526"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q61527",
            "gene_name": "Erbb4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q61527",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61527"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q61527",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61527"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q61772",
            "gene_name": "Epha7",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q61772",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61772"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q61772",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61772"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q61846",
            "gene_name": "Melk",
            "activity": [
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q61846",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61846"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q61846",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61846"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q61846",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61846"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q61851",
            "gene_name": "Fgfr3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q61851",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61851"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q61851",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61851"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62120",
            "gene_name": "Jak2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62120",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62120"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62120",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62120"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62137",
            "gene_name": "Jak3",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62137",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62137"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62137",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62137"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62190",
            "gene_name": "Mst1r",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62190",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62190"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62190",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62190"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62270",
            "gene_name": "Srms",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62270",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62270"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62270",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62270"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62371",
            "gene_name": "Ddr2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62371",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62371"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62371",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62371"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62413",
            "gene_name": "Epha6",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62413",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62413"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62413",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62413"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62662",
            "gene_name": "Frk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62662",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62662"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62662",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62662"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62689",
            "gene_name": "Jak2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62689",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62689"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62689",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62689"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62799",
            "gene_name": "Erbb3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62799",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62799"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62799",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62799"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62838",
            "gene_name": "Musk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62838",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62838"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62838",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62838"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62844",
            "gene_name": "Fyn",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62844",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62844"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62844",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62844"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62862",
            "gene_name": "Map2k5",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62862",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62862"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62862",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62862"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62956",
            "gene_name": "Erbb4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62956",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62956"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62956",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62956"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63116",
            "gene_name": "Kit",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63116",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63116"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63116",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63116"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63117",
            "gene_name": "Clk3",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63117",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63117"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63117",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63117"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63132",
            "gene_name": "Ros1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63132",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63132"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63132",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63132"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63184",
            "gene_name": "Eif2ak2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63184",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63184"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63184",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63184"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63184",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63184"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63272",
            "gene_name": "Jak3",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63272",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63272"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63272",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63272"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63470",
            "gene_name": "Dyrk1a",
            "activity": [
                {
                    "ec_number": "2.7.11.23",
                    "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].",
                    "evidence": [
                        {
                            "id": "Q63470",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63470"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63470",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63470"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.23",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63470",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63470"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63470",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63470"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63474",
            "gene_name": "Ddr1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63474",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63474"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63474",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63474"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63572",
            "gene_name": "Tesk1",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63572",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63572"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63572",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63572"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63604",
            "gene_name": "Ntrk2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63604",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63604"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63604",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63604"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63802",
            "gene_name": "Wee1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63802",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63802"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63802",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63802"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63932",
            "gene_name": "Map2k2",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63932",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63932"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63932",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63932"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q64434",
            "gene_name": "Ptk6",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q64434",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q64434"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q64434",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q64434"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q64716",
            "gene_name": "Insrr",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q64716",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q64716"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q64716",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q64716"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q64725",
            "gene_name": "Syk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q64725",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q64725"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q64725",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q64725"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q66JT0",
            "gene_name": "Wee2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q66JT0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q66JT0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q66JT0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q66JT0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q6J9G0",
            "gene_name": "STYK1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q6J9G0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6J9G0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q6J9G0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6J9G0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q6J9G1",
            "gene_name": "Styk1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q6J9G1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6J9G1"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q6J9G1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6J9G1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q6P6U0",
            "gene_name": "Fgr",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q6P6U0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6P6U0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q6P6U0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6P6U0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q6VNS1",
            "gene_name": "Ntrk3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q6VNS1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6VNS1"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q6VNS1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6VNS1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q6XUX1",
            "gene_name": "Dstyk",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q6XUX1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6XUX1"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q6XUX1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6XUX1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q6XUX2",
            "gene_name": "Dstyk",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q6XUX2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6XUX2"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q6XUX2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6XUX2"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q6XUX3",
            "gene_name": "DSTYK",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q6XUX3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6XUX3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q6XUX3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6XUX3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q75JK0",
            "gene_name": "zakA",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q75JK0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q75JK0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q75JK0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q75JK0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q76NV1",
            "gene_name": "dyrk1",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q76NV1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q76NV1"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q76NV1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q76NV1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q78DX7",
            "gene_name": "Ros1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q78DX7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q78DX7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q78DX7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q78DX7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q7KJ08",
            "gene_name": "Alk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q7KJ08",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q7KJ08"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q7KT06",
            "gene_name": "Ret",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q7KT06",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q7KT06"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q8BI55",
            "gene_name": "Dyrk4",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q8BI55",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8BI55"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q8BI55",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8BI55"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q8BYG9",
            "gene_name": "Epha10",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q8BYG9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8BYG9"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q8BYG9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8BYG9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q8CBF3",
            "gene_name": "Ephb1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q8CBF3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8CBF3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q8CBF3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8CBF3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q8CE90",
            "gene_name": "Map2k7",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q8CE90",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8CE90"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q8CE90",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8CE90"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q8INJ8",
            "gene_name": "Csk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q8INJ8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8INJ8"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q8INJ8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8INJ8"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q8VCT9",
            "gene_name": "Tesk2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q8VCT9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8VCT9"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q8VCT9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8VCT9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q91ZT1",
            "gene_name": "Flt4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q91ZT1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q91ZT1"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q91ZT1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q91ZT1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q922K9",
            "gene_name": "Frk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q922K9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q922K9"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q922K9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q922K9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q922Y0",
            "gene_name": "Dyrk3",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q922Y0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q922Y0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q922Y0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q922Y0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q924U5",
            "gene_name": "Tesk2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q924U5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q924U5"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q924U5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q924U5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q925D6",
            "gene_name": "Map2k6",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q925D6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q925D6"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q925D6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q925D6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q92630",
            "gene_name": "DYRK2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q92630",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q92630"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q92630",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q92630"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q92835",
            "gene_name": "INPP5D",
            "activity": [
                {
                    "ec_number": "3.1.3.86",
                    "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + H2O = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4-bisphosphate) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q92835",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q92835"
                        }
                    ]
                },
                {
                    "ec_number": "3.1.3.56",
                    "activity": "1D-myo-inositol 1,4,5-trisphosphate + H2O = 1D-myo-inositol 1,4-bisphosphate + phosphate.",
                    "evidence": [
                        {
                            "id": "Q92835",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q92835"
                        }
                    ]
                },
                {
                    "ec_number": "3.1.3.36",
                    "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + phosphate.",
                    "evidence": [
                        {
                            "id": "Q92835",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q92835"
                        }
                    ]
                },
                {
                    "ec_number": "3.1.3.86",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q92835",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q92835"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q96KB5",
            "gene_name": "PBK",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q96KB5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q96KB5"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q96KB5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q96KB5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q96S53",
            "gene_name": "TESK2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q96S53",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q96S53"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q96S53",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q96S53"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q99ML2",
            "gene_name": "Tnk1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q99ML2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q99ML2"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q99ML2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q99ML2"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9H3Y6",
            "gene_name": "SRMS",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9H3Y6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9H3Y6"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9H3Y6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9H3Y6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9HAZ1",
            "gene_name": "CLK4",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9HAZ1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9HAZ1"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9HAZ1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9HAZ1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9I7F7",
            "gene_name": "Ack-like",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9I7F7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9I7F7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9I7F7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9I7F7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9JJ78",
            "gene_name": "Pbk",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9JJ78",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9JJ78"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9JJ78",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9JJ78"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9NR20",
            "gene_name": "DYRK4",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9NR20",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9NR20"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9NR20",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9NR20"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9QVP9",
            "gene_name": "Ptk2b",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9QVP9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9QVP9"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9QVP9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9QVP9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9R117",
            "gene_name": "Tyk2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9R117",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9R117"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9R117",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9R117"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9UF33",
            "gene_name": "EPHA6",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9UF33",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9UF33"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9UF33",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9UF33"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9UIG0",
            "gene_name": "BAZ1B",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9UIG0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9UIG0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9UIG0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9UIG0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9UM73",
            "gene_name": "ALK",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9UM73",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9UM73"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9UM73",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9UM73"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9V3D5",
            "gene_name": "Dyrk2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9V3D5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9V3D5"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9V3D5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9V3D5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9V422",
            "gene_name": "dnt",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9V422",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9V422"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9V422",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9V422"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9V6K3",
            "gene_name": "Nrk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9V6K3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9V6K3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9V6K3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9V6K3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9V9J3",
            "gene_name": "Src42A",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9V9J3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9V9J3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9V9J3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9V9J3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9VBW3",
            "gene_name": "Cad96Ca",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9VBW3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VBW3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9VBW3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VBW3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9VE06",
            "gene_name": "cdi",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9VE06",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VE06"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9VE06",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VE06"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9VJ04",
            "gene_name": "Dmel\\CG10702",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9VJ04",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VJ04"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9VJ04",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VJ04"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9VPC0",
            "gene_name": "Pitslre",
            "activity": [
                {
                    "ec_number": "2.7.11.22",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9VPC0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VPC0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.22",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9VPC0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VPC0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9VZA8",
            "gene_name": "Tie",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9VZA8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VZA8"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9VZI2",
            "gene_name": "Ack",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9VZI2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VZI2"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9VZI2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VZI2"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9VZI2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VZI2"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9VZI2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VZI2"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9WTL4",
            "gene_name": "Insrr",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9WTL4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9WTL4"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9WTL4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9WTL4"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9WUD9",
            "gene_name": "Src",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9WUD9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9WUD9"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9WUD9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9WUD9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9WVS7",
            "gene_name": "Map2k5",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9WVS7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9WVS7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9WVS7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9WVS7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9Y463",
            "gene_name": "DYRK1B",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9Y463",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9Y463"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9Y463",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9Y463"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9Z138",
            "gene_name": "Ror2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9Z138",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9Z138"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9Z138",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9Z138"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9Z188",
            "gene_name": "Dyrk1b",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9Z188",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9Z188"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9Z188",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9Z188"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9Z277",
            "gene_name": "Baz1b",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9Z277",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9Z277"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9Z277",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9Z277"
                        }
                    ]
                }
            ]
        }
    ],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        },
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        },
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "sequence_features": {
        "n_linked_sites": [
            45,
            73,
            153,
            240,
            275,
            302,
            335,
            353,
            412,
            428,
            480,
            805
        ],
        "o_linked_sites": [],
        "snv_sites": [
            47,
            73,
            74,
            75,
            153,
            240,
            242,
            310,
            337,
            355,
            363,
            414,
            428,
            731,
            807,
            928
        ],
        "glycation_sites": [],
        "phosphorylation_sites": [
            546,
            561,
            699,
            708,
            713,
            723,
            809,
            923,
            969
        ],
        "sequon_annotation_sites": [
            {
                "start_pos": 153,
                "end_pos": 155
            },
            {
                "start_pos": 240,
                "end_pos": 242
            },
            {
                "start_pos": 275,
                "end_pos": 277
            },
            {
                "start_pos": 302,
                "end_pos": 304
            },
            {
                "start_pos": 335,
                "end_pos": 337
            },
            {
                "start_pos": 353,
                "end_pos": 355
            },
            {
                "start_pos": 412,
                "end_pos": 414
            },
            {
                "start_pos": 428,
                "end_pos": 430
            },
            {
                "start_pos": 45,
                "end_pos": 47
            },
            {
                "start_pos": 480,
                "end_pos": 482
            },
            {
                "start_pos": 734,
                "end_pos": 736
            },
            {
                "start_pos": 73,
                "end_pos": 75
            },
            {
                "start_pos": 805,
                "end_pos": 807
            }
        ]
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 29
                },
                {
                    "field": "total_sites",
                    "count": 12
                },
                {
                    "field": "n_linked_glycans",
                    "count": 14
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 14
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 4
                },
                {
                    "field": "total_sites",
                    "count": 4
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 4
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 18
                },
                {
                    "field": "total_sites",
                    "count": 3
                },
                {
                    "field": "n_linked_glycans",
                    "count": 14
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 3
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 7
                },
                {
                    "field": "total_sites",
                    "count": 7
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 7
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 16
                },
                {
                    "field": "total_sites",
                    "count": 9
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "kinase_uniprot_canonical_ac",
                "kinase_gene_name",
                "residue",
                "comment",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 22
                },
                {
                    "field": "total_sites",
                    "count": 16
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "sequence_org",
                "sequence_mut",
                "comment",
                "chr_id",
                "chr_pos",
                "ref_nt",
                "alt_nt",
                "minor_allelic_frequency",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 22
                },
                {
                    "field": "total_sites",
                    "count": 16
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "sequence_org",
                "sequence_mut",
                "comment",
                "chr_id",
                "chr_pos",
                "ref_nt",
                "alt_nt",
                "minor_allelic_frequency",
                "site_lbl"
            ]
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 98
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}