{ "uniprot_canonical_ac": "P07203-1", "uniprot_ac": "P07203", "uniprot_id": "GPX1_HUMAN", "mass": { "chemical_mass": 22088.0, "monoisotopic_mass": 22088.0 }, "refseq": { "ac": "NP_000572", "name": "glutathione peroxidase 1 isoform 1", "summary": "The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Other studies indicate that H2O2 is also essential for growth-factor mediated signal transduction, mitochondrial function, and maintenance of thiol redox-balance; therefore, by limiting H2O2 accumulation, glutathione peroxidases are also involved in modulating these processes. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme is the most abundant, is ubiquitously expressed and localized in the cytoplasm, and whose preferred substrate is hydrogen peroxide. It is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. This gene contains an in-frame GCG trinucleotide repeat in the coding region, and three alleles with 4, 5 or 6 repeats have been found in the human population. The allele with 4 GCG repeats has been significantly associated with breast cancer risk in premenopausal women. Alternatively spliced transcript variants have been found for this gene. Pseudogenes of this locus have been identified on chromosomes X and 21. [provided by RefSeq, Aug 2017].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000572" }, "gene_names": [ { "name": "GPX1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P07203", "id": "P07203" }, { "name": "GPX1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000572", "id": "NP_000572" }, { "name": "GPXD; GSHPX1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000572", "id": "NP_000572" } ], "protein_names": [ { "name": "Glutathione peroxidase 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P07203" }, { "name": "1.11.1.12", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07203" }, { "name": "1.11.1.9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07203" }, { "name": "Cellular glutathione peroxidase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07203" }, { "name": "GPx-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07203" }, { "name": "GSHPx-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07203" }, { "name": "Phospholipid-hydroperoxide glutathione peroxidase GPX1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07203" }, { "name": "cellular glutathione peroxidase; GSHPx-1; selenoprotein GPX1; phospholipid-hydroperoxide glutathione peroxidase GPX1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000572", "id": "NP_000572" }, { "name": "glutathione peroxidase 1 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000572", "id": "NP_000572" } ], "function": [ { "annotation": "Catalyzes the reduction of hydroperoxides in a glutathione-dependent manner thus regulating cellular redox homeostasis (PubMed:11115402, PubMed:36608588). Can reduce small soluble hydroperoxides such as H2O2, cumene hydroperoxide and tert-butyl hydroperoxide, as well as several fatty acid-derived hydroperoxides (PubMed:11115402, PubMed:36608588). In platelets catalyzes the reduction of 12-hydroperoxyeicosatetraenoic acid, the primary product of the arachidonate 12-lipoxygenase pathway (PubMed:11115402).", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203#function" }, { "database": "PubMed", "id": "11115402", "url": "https://glygen.org/publication/PubMed/11115402" }, { "database": "PubMed", "id": "36608588", "url": "https://glygen.org/publication/PubMed/36608588" } ] }, { "annotation": "Cellular and exosomal GPx1 are essential for controlling hydrogen peroxide balance and alleviating oxidative stress in hypoxic glioblastoma.", "evidence": [ { "database": "RefSeq", "id": "NP_000572", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000572" }, { "database": "PubMed", "id": "37572455", "url": "https://glygen.org/publication/PubMed/37572455" } ] }, { "annotation": "Observational study of gene-disease association. (HuGE Navigator)", "evidence": [ { "database": "RefSeq", "id": "NP_000572", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000572" }, { "database": "PubMed", "id": "14744747", "url": "https://glygen.org/publication/PubMed/14744747" } ] }, { "annotation": "Polyalanine polymorphism in the signal peptide of Glutathione peroxidase 1 (GPX1) gene & its association with osteoporosis.", "evidence": [ { "database": "RefSeq", "id": "NP_000572", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000572" }, { "database": "PubMed", "id": "36926781", "url": "https://glygen.org/publication/PubMed/36926781" } ] }, { "annotation": "The mRNA expression of genes encoding selected antioxidant enzymes and thioredoxin, and the concentrations of their protein products in gingival crevicular fluid and saliva during periodontitis.", "evidence": [ { "database": "RefSeq", "id": "NP_000572", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000572" }, { "database": "PubMed", "id": "37390459", "url": "https://glygen.org/publication/PubMed/37390459" } ] }, { "annotation": "The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Other studies indicate that H2O2 is also essential for growth-factor mediated signal transduction, mitochondrial function, and maintenance of thiol redox-balance; therefore, by limiting H2O2 accumulation, glutathione peroxidases are also involved in modulating these processes. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme is the most abundant, is ubiquitously expressed and localized in the cytoplasm, and whose preferred substrate is hydrogen peroxide. It is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. This gene contains an in-frame GCG trinucleotide repeat in the coding region, and three alleles with 4, 5 or 6 repeats have been found in the human population. The allele with 4 GCG repeats has been significantly associated with breast cancer risk in premenopausal women. Alternatively spliced transcript variants have been found for this gene. Pseudogenes of this locus have been identified on chromosomes X and 21. [provided by RefSeq, Aug 2017].", "evidence": [ { "database": "RefSeq", "id": "NP_000572", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000572" } ] }, { "annotation": "Variation of the genes encoding antioxidant enzymes SOD2 (rs4880), GPX1 (rs1050450), and CAT (rs1001179) and susceptibility to male infertility: a genetic association study and in silico analysis.", "evidence": [ { "database": "RefSeq", "id": "NP_000572", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000572" }, { "database": "PubMed", "id": "37405601", "url": "https://glygen.org/publication/PubMed/37405601" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "P07203", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07203" } ], "glycoeffect": [], "start_pos": 159, "end_pos": 159, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "3", "chr_pos": "49357525", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "D159", "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] }, { "disease_id": "DOID:4362", "recommended_name": { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervical cancer", "description": "A female reproductive organ cancer that is located_in the cervix." }, "synonyms": [ { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervical neoplasm", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervix cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervix uteri cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "neoplasm of uterine cervix", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "tumor of the Cervix Uteri", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer", "description": "A primary or metastatic malignant neoplasm involving the cervix." }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cancer of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer, somatic", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervix cancer", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervix uteri cancer", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervix cancer", "description": "" }, { "id": "MIM:603956", "resource": "MIM", "url": "https://www.omim.org/entry/603956", "name": "Cervical cancer", "description": "Cervical cancer" } ] }, { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "99.3", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000233276", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000233276" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "97.65", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000233276", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000233276" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.15", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000233276", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000233276" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "92.67", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000233276", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000233276" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "98.93", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000233276", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000233276" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "98.36", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000233276", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000233276" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "98.51", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000233276", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000233276" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "99.05", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000233276", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000233276" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "98.91", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000233276", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000233276" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P07203", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07203" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P07203", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07203" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P07203", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07203" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P07203", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07203" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P07203", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07203" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P07203", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07203" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P07203", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07203" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P07203", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07203" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P07203", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07203" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P07203", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07203" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P07203", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07203" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P07203", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07203" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "common_name": "Human" } ], "gene": [ { "name": "GPX1", "url": "https://www.uniprot.org/uniprot/P07203", "locus": { "chromosome": "3", "start_pos": 49357174, "end_pos": 49358605, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000233276", "url": "https://www.ensembl.org/id/ENSG00000233276" } ] } } ], "crossref": [ { "id": "ENSG00000233276", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000233276", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P07203", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07203", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "1.11.1.9", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=1.11.1.9&UniProtAcc=P07203", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd00340", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00340", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL2163186", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2163186", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "GPX1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=GPX1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "2876", "url": "https://www.ncbi.nlm.nih.gov/gene/2876", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "4553", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4553", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P07203", "url": "https://www.ebi.ac.uk/intact/interactors/id:P07203*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000889", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000889", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029759", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029759", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029760", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029760", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036249", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036249", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:2876", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2876", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "138320", "url": "http://www.omim.org/entry/138320", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P07203", "url": "https://www.nextprot.org/entry/NX_P07203", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P07203", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07203", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "RDYTEMN", "url": "https://omabrowser.org/oma/group/RDYTEMN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "67394at2759", "url": "http://www.orthodb.org/?query=67394at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11592", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11592", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11592:SF41", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11592:SF41", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2F8A", "url": "https://www.rcsb.org/structure/2F8A", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00255", "url": "http://pfam.xfam.org/family/PF00255", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P07203", "url": "https://pharos.nih.gov/targets/P07203", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P07203", "url": "http://purl.obolibrary.org/obo/PR_P07203", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-2142688", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142688", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2142712", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142712", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2142770", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142770", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000572", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000572", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "16833", "url": "https://www.rhea-db.org/rhea/16833", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "19057", "url": "https://www.rhea-db.org/rhea/19057", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "48620", "url": "https://www.rhea-db.org/rhea/48620", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "48888", "url": "https://www.rhea-db.org/rhea/48888", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "50708", "url": "https://www.rhea-db.org/rhea/50708", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "69412", "url": "https://www.rhea-db.org/rhea/69412", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "69651", "url": "https://www.rhea-db.org/rhea/69651", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "76687", "url": "https://www.rhea-db.org/rhea/76687", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "76691", "url": "https://www.rhea-db.org/rhea/76691", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "76695", "url": "https://www.rhea-db.org/rhea/76695", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "76699", "url": "https://www.rhea-db.org/rhea/76699", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "76703", "url": "https://www.rhea-db.org/rhea/76703", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "76707", "url": "https://www.rhea-db.org/rhea/76707", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "76711", "url": "https://www.rhea-db.org/rhea/76711", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "76715", "url": "https://www.rhea-db.org/rhea/76715", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A2R8Y6B6", "url": "https://www.uniprot.org/uniprot/A0A2R8Y6B6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8Y6B6-1", "url": "https://www.uniprot.org/uniprot/A0A2R8Y6B6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2UQ36", "url": "https://www.uniprot.org/uniprot/A0A7I2UQ36", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2UQ36-1", "url": "https://www.uniprot.org/uniprot/A0A7I2UQ36-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YMD7", "url": "https://www.uniprot.org/uniprot/A0A7I2YMD7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YMD7-1", "url": "https://www.uniprot.org/uniprot/A0A7I2YMD7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A994J430", "url": "https://www.uniprot.org/uniprot/A0A994J430", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A994J430-1", "url": "https://www.uniprot.org/uniprot/A0A994J430-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A994J4E2", "url": "https://www.uniprot.org/uniprot/A0A994J4E2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A994J4E2-1", "url": "https://www.uniprot.org/uniprot/A0A994J4E2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A994J4K6", "url": "https://www.uniprot.org/uniprot/A0A994J4K6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A994J4K6-1", "url": "https://www.uniprot.org/uniprot/A0A994J4K6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A994J4L4", "url": "https://www.uniprot.org/uniprot/A0A994J4L4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A994J4L4-1", "url": "https://www.uniprot.org/uniprot/A0A994J4L4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A994J702", "url": "https://www.uniprot.org/uniprot/A0A994J702", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A994J702-1", "url": "https://www.uniprot.org/uniprot/A0A994J702-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A994J707", "url": "https://www.uniprot.org/uniprot/A0A994J707", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A994J707-1", "url": "https://www.uniprot.org/uniprot/A0A994J707-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A994J7E8", "url": "https://www.uniprot.org/uniprot/A0A994J7E8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A994J7E8-1", "url": "https://www.uniprot.org/uniprot/A0A994J7E8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07203-1", "url": "https://www.uniprot.org/uniprot/P07203-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07203-2", "url": "https://www.uniprot.org/uniprot/P07203-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA", "length": 203, "header": "sp|P07203-1|GPX1_HUMAN Isoform 1 of Glutathione peroxidase 1 OS=Homo sapiens OX=9606 GN=GPX1 PE=1 SV=4 CANONICAL=P07203-1" }, "isoforms": [ { "isoform_ac": "A0A2R8Y6B6-1", "url": "", "sequence": { "sequence": "MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA", "length": 157, "header": "tr|A0A2R8Y6B6-1|A0A2R8Y6B6_HUMAN Computationally mapped isoform of Glutathione peroxidase 1 OS=Homo sapiens OX=9606 GN=GPX1 PE=1 SV=1 CANONICAL=P07203-1" }, "locus": { "chromosome": "3", "start_pos": 49358278, "end_pos": 49357391, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000643797.2", "url": "https://www.ensembl.org/id/ENST00000643797.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000495108.1", "url": "https://www.ensembl.org/id/ENSP00000495108.1" } ] } }, { "isoform_ac": "A0A7I2UQ36-1", "url": "", "sequence": { "sequence": "MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLCGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQLPFSPVGERQERRDSEFPQVRPAWWWVRAQLHALREVRGERCGGAPSLRLPAGGPASSQRRRHRAYDRPQAHHLVSGVSQRCCLEL", "length": 170, "header": "tr|A0A7I2UQ36-1|A0A7I2UQ36_HUMAN Computationally mapped isoform of Glutathione peroxidase OS=Homo sapiens OX=9606 GN=GPX1 PE=1 SV=1 CANONICAL=P07203-1" }, "locus": {} }, { "isoform_ac": "A0A7I2YMD7-1", "url": "", "sequence": { "sequence": "MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLCGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQLLKFLSALGIAHGGQNPGDS", "length": 104, "header": "tr|A0A7I2YMD7-1|A0A7I2YMD7_HUMAN Computationally mapped isoform of Glutathione peroxidase OS=Homo sapiens OX=9606 GN=GPX1 PE=1 SV=1 CANONICAL=P07203-1" }, "locus": {} }, { "isoform_ac": "A0A994J430-1", "url": "", "sequence": { "sequence": "MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLCGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQNAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA", "length": 202, "header": "tr|A0A994J430-1|A0A994J430_HUMAN Computationally mapped isoform of Glutathione peroxidase OS=Homo sapiens OX=9606 GN=GPX1 PE=1 SV=1 CANONICAL=P07203-1" }, "locus": {} }, { "isoform_ac": "A0A994J4E2-1", "url": "", "sequence": { "sequence": "MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVQPPLPDH", "length": 46, "header": "tr|A0A994J4E2-1|A0A994J4E2_HUMAN Computationally mapped isoform of Glutathione peroxidase 1 OS=Homo sapiens OX=9606 GN=GPX1 PE=1 SV=1 CANONICAL=P07203-1" }, "locus": { "chromosome": "3", "start_pos": 49358278, "end_pos": 49357443, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000704377.1", "url": "https://www.ensembl.org/id/ENST00000704377.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000515882.1", "url": "https://www.ensembl.org/id/ENSP00000515882.1" } ] } }, { "isoform_ac": "A0A994J4K6-1", "url": "", "sequence": { "sequence": "MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLCGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYSRRFQTIDIEPDIEALLSQGPSCA", "length": 122, "header": "tr|A0A994J4K6-1|GPX1_HUMAN Computationally mapped isoform of Glutathione peroxidase 1 OS=Homo sapiens OX=9606 GN=GPX1 PE=1 SV=1 CANONICAL=P07203-1" }, "locus": {} }, { "isoform_ac": "A0A994J4L4-1", "url": "", "sequence": { "sequence": "MCAARLAAAAAAAQSVYAFSARPLAGGEPENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA", "length": 148, "header": "tr|A0A994J4L4-1|GPX1_HUMAN Computationally mapped isoform of Glutathione peroxidase 1 OS=Homo sapiens OX=9606 GN=GPX1 PE=1 SV=1 CANONICAL=P07203-1" }, "locus": { "chromosome": "3", "start_pos": 49358278, "end_pos": 49357391, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000704374.1", "url": "https://www.ensembl.org/id/ENST00000704374.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000515879.1", "url": "https://www.ensembl.org/id/ENSP00000515879.1" } ] } }, { "isoform_ac": "A0A994J702-1", "url": "", "sequence": { "sequence": "MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLCGTTVRDYTQMNELQRRLGPRGLENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA", "length": 190, "header": "tr|A0A994J702-1|A0A994J702_HUMAN Computationally mapped isoform of Glutathione peroxidase OS=Homo sapiens OX=9606 GN=GPX1 PE=1 SV=1 CANONICAL=P07203-1" }, "locus": {} }, { "isoform_ac": "A0A994J707-1", "url": "", "sequence": { "sequence": "MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLCGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVQPPLPDH", "length": 124, "header": "tr|A0A994J707-1|GPX1_HUMAN Computationally mapped isoform of Glutathione peroxidase 1 OS=Homo sapiens OX=9606 GN=GPX1 PE=1 SV=1 CANONICAL=P07203-1" }, "locus": {} }, { "isoform_ac": "A0A994J7E8-1", "url": "", "sequence": { "sequence": "MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLCDH", "length": 51, "header": "tr|A0A994J7E8-1|A0A994J7E8_HUMAN Computationally mapped isoform of Glutathione peroxidase 1 OS=Homo sapiens OX=9606 GN=GPX1 PE=1 SV=1 CANONICAL=P07203-1" }, "locus": {} }, { "isoform_ac": "P07203-1", "url": "", "sequence": { "sequence": "MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA", "length": 203, "header": "sp|P07203-1|GPX1_HUMAN Isoform 1 of Glutathione peroxidase 1 OS=Homo sapiens OX=9606 GN=GPX1 PE=1 SV=4 CANONICAL=P07203-1" }, "locus": { "chromosome": "3", "start_pos": 49358278, "end_pos": 49357391, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000419783.3", "url": "https://www.ensembl.org/id/ENST00000419783.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000407375.1", "url": "https://www.ensembl.org/id/ENSP00000407375.1" } ] } }, { "isoform_ac": "P07203-2", "url": "", "sequence": { "sequence": "MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQVRRAERGGAGADVQ", "length": 98, "header": "sp|P07203-2|GPX1_HUMAN Isoform 2 of Glutathione peroxidase 1 OS=Homo sapiens OX=9606 GN=GPX1 PE=1 SV=4 CANONICAL=P07203-1" }, "locus": { "chromosome": "3", "start_pos": 49358278, "end_pos": 49357985, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000419349.3", "url": "https://www.ensembl.org/id/ENST00000419349.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000391316.1", "url": "https://www.ensembl.org/id/ENSP00000391316.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P07203", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07203" }, { "id": "19944066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19944066" } ] } ], "phosphorylation": [ { "start_pos": 197, "end_pos": 197, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "site_lbl": "Ser197" }, { "start_pos": 201, "end_pos": 201, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "P07203", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07203" } ], "site_lbl": "Ser201" }, { "start_pos": 34, "end_pos": 34, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "site_lbl": "Ser34" }, { "start_pos": 98, "end_pos": 98, "kinase_uniprot_canonical_ac": "P00519-1", "kinase_gene_name": "ABL1", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07203", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07203" }, { "database": "PubMed", "id": "12893824", "url": "https://glygen.org/publication/PubMed/12893824" } ], "site_lbl": "Tyr98" }, { "start_pos": 98, "end_pos": 98, "kinase_uniprot_canonical_ac": "P42684-1", "kinase_gene_name": "ABL2", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07203", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07203" }, { "database": "PubMed", "id": "12893824", "url": "https://glygen.org/publication/PubMed/12893824" } ], "site_lbl": "Tyr98" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "NADPH oxidase: an update.", "journal": "Blood", "date": "1999", "authors": "Babior BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "10029572", "url": "https://glygen.org/publication/PubMed/10029572" } ] }, { "title": "Low yield of polymorphisms from EST blast searching: analysis of genes related to oxidative stress and verification of the P197L polymorphism in GPX1.", "journal": "Hum. Mutat.", "date": "1999", "authors": "Forsberg L, de Faire U, Morgenstern R", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "reference": [ { "type": "PubMed", "id": "10220143", "url": "https://glygen.org/publication/PubMed/10220143" } ] }, { "title": "Characterization of human and murine PMP20 peroxisomal proteins that exhibit antioxidant activity in vitro.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Yamashita H, Avraham S, Jiang S, London R, Van Veldhoven PP, Subramani S, Rogers RA, Avraham H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "10514471", "url": "https://glygen.org/publication/PubMed/10514471" } ] }, { "title": "Cloning and characterization of AOEB166, a novel mammalian antioxidant enzyme of the peroxiredoxin family.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Knoops B, Clippe A, Bogard C, Arsalane K, Wattiez R, Hermans C, Duconseille E, Falmagne P, Bernard A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "10521424", "url": "https://glygen.org/publication/PubMed/10521424" } ] }, { "title": "Cellular glutathione peroxidase as a predominant scavenger of hydroperoxyeicosatetraenoic acids in rabbit alveolar macrophages.", "journal": "Biological & pharmaceutical bulletin", "date": "1999", "authors": "Chiba N, Imai H, Narashima K, Arai M, Oshima G, Kunimoto M, Nakagawa Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2142688", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142688" } ], "reference": [ { "type": "PubMed", "id": "10549853", "url": "https://glygen.org/publication/PubMed/10549853" } ] }, { "title": "Active and inhibited human catalase structures: ligand and NADPH binding and catalytic mechanism.", "journal": "Journal of molecular biology", "date": "2000", "authors": "Putnam CD, Arvai AS, Bourne Y, Tainer JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "10656833", "url": "https://glygen.org/publication/PubMed/10656833" } ] }, { "title": "Stereoselective biosynthesis of hepoxilin B3 in human epidermis.", "journal": "The Journal of investigative dermatology", "date": "2000", "authors": "Anton R, Vila L", "evidence": [ { "database": "Reactome", "id": "R-HSA-2142712", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142712" } ], "reference": [ { "type": "PubMed", "id": "10692117", "url": "https://glygen.org/publication/PubMed/10692117" } ] }, { "title": "Mitochondrial GPx1 decreases induced but not basal oxidative damage to mtDNA in T47D cells.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Legault J, Carrier C, Petrov P, Renard P, Remacle J, Mirault ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "10833429", "url": "https://glygen.org/publication/PubMed/10833429" } ] }, { "title": "The role of cellular glutathione peroxidase redox regulation in the suppression of tumor cell growth by manganese superoxide dismutase.", "journal": "Cancer research", "date": "2000", "authors": "Li S, Yan T, Yang JQ, Oberley TD, Oberley LW", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "10919671", "url": "https://glygen.org/publication/PubMed/10919671" } ] }, { "title": "The kinetics of the reduction of cytochrome c by the superoxide anion radical.", "journal": "Biochimica et biophysica acta", "date": "1976", "authors": "Koppenol WH, van Buuren KJ, Butler J, Braams R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "10982", "url": "https://glygen.org/publication/PubMed/10982" } ] }, { "title": "Mechanism of Cu,Zn-superoxide dismutase activation by the human metallochaperone hCCS.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Rae TD, Torres AS, Pufahl RA, O'Halloran TV", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "11018045", "url": "https://glygen.org/publication/PubMed/11018045" } ] }, { "title": "Evidence for the presence of phospholipid hydroperoxide glutathione peroxidase in human platelets: implications for its involvement in the regulatory network of the 12-lipoxygenase pathway of arachidonic acid metabolism.", "journal": "The Biochemical journal", "date": "2001", "authors": "Sutherland M, Shankaranarayanan P, Schewe T, Nigam S", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" }, { "database": "Reactome", "id": "R-HSA-2142688", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142688" } ], "reference": [ { "type": "PubMed", "id": "11115402", "url": "https://glygen.org/publication/PubMed/11115402" } ] }, { "title": "Mitochondrial respiratory chain-dependent generation of superoxide anion and its release into the intermembrane space.", "journal": "The Biochemical journal", "date": "2001", "authors": "Han D, Williams E, Cadenas E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "11139407", "url": "https://glygen.org/publication/PubMed/11139407" } ] }, { "title": "Subcellular distribution of superoxide dismutases (SOD) in rat liver: Cu,Zn-SOD in mitochondria.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Okado-Matsumoto A, Fridovich I", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "11507097", "url": "https://glygen.org/publication/PubMed/11507097" } ] }, { "title": "Crystal structure of human peroxiredoxin 5, a novel type of mammalian peroxiredoxin at 1.5 A resolution.", "journal": "Journal of molecular biology", "date": "2001", "authors": "Declercq JP, Evrard C, Clippe A, Stricht DV, Bernard A, Knoops B", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "11518528", "url": "https://glygen.org/publication/PubMed/11518528" } ] }, { "title": "Evidence that arachidonate 15-lipoxygenase 2 is a negative cell cycle regulator in normal prostate epithelial cells.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Tang S, Bhatia B, Maldonado CJ, Yang P, Newman RA, Liu J, Chandra D, Traag J, Klein RD, Fischer SM, Chopra D, Shen J, Zhau HE, Chung LW, Tang DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2142770", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142770" } ], "reference": [ { "type": "PubMed", "id": "11839751", "url": "https://glygen.org/publication/PubMed/11839751" } ] }, { "title": "Mutant Cu, Zn superoxide dismutase that causes motoneuron degeneration is present in mitochondria in the CNS.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2002", "authors": "Higgins CM, Jung C, Ding H, Xu Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "11886899", "url": "https://glygen.org/publication/PubMed/11886899" } ] }, { "title": "Catalytic pathway of manganese superoxide dismutase by direct observation of superoxide.", "journal": "Methods in enzymology", "date": "2002", "authors": "Silverman DN, Nick HS", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "11912930", "url": "https://glygen.org/publication/PubMed/11912930" } ] }, { "title": "Peroxynitrite reactions and formation in mitochondria.", "journal": "Free radical biology & medicine", "date": "2002", "authors": "Radi R, Cassina A, Hodara R, Quijano C, Castro L", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "12446202", "url": "https://glygen.org/publication/PubMed/12446202" } ] }, { "title": "Association between the GCG polymorphism of the selenium dependent GPX1 gene and the risk of young onset prostate cancer.", "journal": "Prostate Cancer Prostatic Dis.", "date": "2002", "authors": "Kote-Jarai Z, Durocher F, Edwards S M, Hamoudi R, Jackson R A, Ardern-Jones A, Murkin A, Dearnaley D P, Kirby R, Houlston R, Easton D F, Eeles R,", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "reference": [ { "type": "PubMed", "id": "12496980", "url": "https://glygen.org/publication/PubMed/12496980" } ] }, { "title": "Overexpression of cytosolic glutathione peroxidase (GPX1) delays endothelial cell growth and increases resistance to toxic challenges.", "journal": "Biochimie", "date": "2003", "authors": "Faucher K, Rabinovitch-Chable H, Barriere G, Cook-Moreau J, Rigaud M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "12829378", "url": "https://glygen.org/publication/PubMed/12829378" } ] }, { "title": "The lipoxygenase gene ALOXE3 implicated in skin differentiation encodes a hydroperoxide isomerase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Yu Z, Schneider C, Boeglin WE, Marnett LJ, Brash AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2142712", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142712" } ], "reference": [ { "type": "PubMed", "id": "12881489", "url": "https://glygen.org/publication/PubMed/12881489" } ] }, { "title": "Glutathione peroxidase 1 is regulated by the c-Abl and Arg tyrosine kinases.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Cao C, Leng Y, Huang W, Liu X, Kufe D", "evidence": [ { "database": "iPTMnet", "id": "P07203-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07203-1" } ], "reference": [ { "type": "PubMed", "id": "12893824", "url": "https://glygen.org/publication/PubMed/12893824" } ] }, { "title": "Genetic variants of GPX1 and SOD2 and breast cancer risk at the Ontario site of the Breast Cancer Family Registry.", "journal": "Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology", "date": "2004", "authors": "Knight JA, Onay UV, Wells S, Li H, Shi EJ, Andrulis IL, Ozcelik H", "evidence": [ { "database": "RefSeq", "id": "NP_000572", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000572" } ], "reference": [ { "type": "PubMed", "id": "14744747", "url": "https://glygen.org/publication/PubMed/14744747" } ] }, { "title": "The intracellular proteolytic processing of extracellular superoxide dismutase (EC-SOD) is a two-step event.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Olsen DA, Petersen SV, Oury TD, Valnickova Z, Thogersen IB, Kristensen T, Bowler RP, Crapo JD, Enghild JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "15044467", "url": "https://glygen.org/publication/PubMed/15044467" } ] }, { "title": "Crystal structure of a dimeric oxidized form of human peroxiredoxin 5.", "journal": "Journal of molecular biology", "date": "2004", "authors": "Evrard C, Capron A, Marchand C, Clippe A, Wattiez R, Soumillion P, Knoops B, Declercq JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "15046979", "url": "https://glygen.org/publication/PubMed/15046979" } ] }, { "title": "Oxygen and the copper chaperone CCS regulate posttranslational activation of Cu,Zn superoxide dismutase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Brown NM, Torres AS, Doan PE, O'Halloran TV", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "15064408", "url": "https://glygen.org/publication/PubMed/15064408" } ] }, { "title": "Increased risk of bladder cancer associated with a glutathione peroxidase 1 codon 198 variant.", "journal": "J. Urol.", "date": "2004", "authors": "Ichimura Yasushi, Habuchi Tomonori, Tsuchiya Norihiko, Wang Lizhong, Oyama Chikara, Sato Kazunari, Nishiyama Hiroyuki, Ogawa Osamu, Kato Tetsuro", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "reference": [ { "type": "PubMed", "id": "15247771", "url": "https://glygen.org/publication/PubMed/15247771" } ] }, { "title": "Human peroxiredoxin 5 is a peroxynitrite reductase.", "journal": "FEBS letters", "date": "2004", "authors": "Dubuisson M, Vander Stricht D, Clippe A, Etienne F, Nauser T, Kissner R, Koppenol WH, Rees JF, Knoops B", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "15280035", "url": "https://glygen.org/publication/PubMed/15280035" } ] }, { "title": "Complex III releases superoxide to both sides of the inner mitochondrial membrane.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Muller FL, Liu Y, Van Remmen H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "15317809", "url": "https://glygen.org/publication/PubMed/15317809" } ] }, { "title": "Functional variants in the glutathione peroxidase-1 (GPx-1) gene are associated with increased intima-media thickness of carotid arteries and risk of macrovascular diseases in Japanese type 2 diabetic patients.", "journal": "Diabetes", "date": "2004", "authors": "Hamanishi Tohru, Furuta Hiroto, Kato Hisako, Doi Asako, Tamai Masanori, Shimomura Hiroko, Sakagashira Setsuya, Nishi Masahiro, Sasaki Hideyuki, Sanke Tokio, Nanjo Kishio", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "reference": [ { "type": "PubMed", "id": "15331559", "url": "https://glygen.org/publication/PubMed/15331559" } ] }, { "title": "Structure and function of the 5'-flanking sequence of the human cytosolic selenium-dependent glutathione peroxidase gene (hgpx1).", "journal": "J. Biol. Chem.", "date": "1992", "authors": "Moscow J A, Morrow C S, He R, Mullenbach G T, Cowan K H", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "reference": [ { "type": "PubMed", "id": "1556108", "url": "https://glygen.org/publication/PubMed/1556108" } ] }, { "title": "Structure and substrate-binding mechanism of human Ap4A hydrolase.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Swarbrick JD, Buyya S, Gunawardana D, Gayler KR, McLennan AG, Gooley PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "15596429", "url": "https://glygen.org/publication/PubMed/15596429" } ] }, { "title": "Mutations associated with a congenital form of ichthyosis (NCIE) inactivate the epidermal lipoxygenases 12R-LOX and eLOX3.", "journal": "Biochimica et biophysica acta", "date": "2005", "authors": "Yu Z, Schneider C, Boeglin WE, Brash AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2142712", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142712" } ], "reference": [ { "type": "PubMed", "id": "15629692", "url": "https://glygen.org/publication/PubMed/15629692" } ] }, { "title": "Human paraoxonases (PON1, PON2, and PON3) are lactonases with overlapping and distinct substrate specificities.", "journal": "Journal of lipid research", "date": "2005", "authors": "Draganov DI, Teiber JF, Speelman A, Osawa Y, Sunahara R, La Du BN", "evidence": [ { "database": "Reactome", "id": "R-HSA-2142688", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142688" } ], "reference": [ { "type": "PubMed", "id": "15772423", "url": "https://glygen.org/publication/PubMed/15772423" } ] }, { "title": "Functional analysis of Nox4 reveals unique characteristics compared to other NADPH oxidases.", "journal": "Cellular signalling", "date": "2006", "authors": "Martyn KD, Frederick LM, von Loehneysen K, Dinauer MC, Knaus UG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "15927447", "url": "https://glygen.org/publication/PubMed/15927447" } ] }, { "title": "Direct evidence for the formation of a complex between 1-cysteine peroxiredoxin and glutathione S-transferase pi with activity changes in both enzymes.", "journal": "Biochemistry", "date": "2006", "authors": "Ralat LA, Manevich Y, Fisher AB, Colman RF", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "16401067", "url": "https://glygen.org/publication/PubMed/16401067" } ] }, { "title": "Mitochondrial metabolic states regulate nitric oxide and hydrogen peroxide diffusion to the cytosol.", "journal": "Biochimica et biophysica acta", "date": "2006", "authors": "Boveris A, Valdez LB, Zaobornyj T, Bustamante J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "16615992", "url": "https://glygen.org/publication/PubMed/16615992" } ] }, { "title": "Purification of two forms of arachidonate 15-lipoxygenase from human leukocytes.", "journal": "European journal of biochemistry", "date": "1991", "authors": "Izumi T, Radmark O, Jornvall H, Samuelsson B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2142770", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142770" } ], "reference": [ { "type": "PubMed", "id": "1662607", "url": "https://glygen.org/publication/PubMed/1662607" } ] }, { "title": "A three-step purification of manganese superoxide dismutase from human liver on both large and small scales.", "journal": "Protein expression and purification", "date": "1991", "authors": "Matsuda Y, Suzuki K, Ookawara T, Nakata T, Seo HG, Kawata S, Tarui S, Deutsch HF, Taniguchi N", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "1668270", "url": "https://glygen.org/publication/PubMed/1668270" } ] }, { "title": "Truncated mutants of human thioredoxin reductase 1 do not exhibit glutathione reductase activity.", "journal": "FEBS letters", "date": "2006", "authors": "Urig S, Lieske J, Fritz-Wolf K, Irmler A, Becker K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "16750198", "url": "https://glygen.org/publication/PubMed/16750198" } ] }, { "title": "The effects of glutaredoxin and copper activation pathways on the disulfide and stability of Cu,Zn superoxide dismutase.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Carroll MC, Outten CE, Proescher JB, Rosenfeld L, Watson WH, Whitson LJ, Hart PJ, Jensen LT, Cizewski Culotta V", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "16880213", "url": "https://glygen.org/publication/PubMed/16880213" } ] }, { "title": "NOX5 variants are functionally active in endothelial cells.", "journal": "Free radical biology & medicine", "date": "2007", "authors": "BelAiba RS, Djordjevic T, Petry A, Diemer K, Bonello S, Banfi B, Hess J, Pogrebniak A, Bickel C, Gorlach A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "17275676", "url": "https://glygen.org/publication/PubMed/17275676" } ] }, { "title": "Human peroxiredoxin 1 and 2 are not duplicate proteins: the unique presence of CYS83 in Prx1 underscores the structural and functional differences between Prx1 and Prx2.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Lee W, Choi KS, Riddell J, Ip C, Ghosh D, Park JH, Park YM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "17519234", "url": "https://glygen.org/publication/PubMed/17519234" } ] }, { "title": "Polymorphisms in oxidative stress-related genes are not associated with prostate cancer risk in heavy smokers.", "journal": "Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology", "date": "2007", "authors": "Choi JY, Neuhouser ML, Barnett M, Hudson M, Kristal AR, Thornquist M, King IB, Goodman GE, Ambrosone CB", "evidence": [ { "database": "Entrez", "id": "2876", "url": "https://www.ncbi.nlm.nih.gov/gene/2876" } ], "reference": [ { "type": "PubMed", "id": "17548672", "url": "https://glygen.org/publication/PubMed/17548672" } ] }, { "title": "Point mutation in the cytoplasmic domain of the neutrophil p22-phox cytochrome b subunit is associated with a nonfunctional NADPH oxidase and chronic granulomatous disease.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Dinauer MC, Pierce EA, Erickson RW, Muhlebach TJ, Messner H, Orkin SH, Seger RA, Curnutte JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "1763037", "url": "https://glygen.org/publication/PubMed/1763037" } ] }, { "title": "Expression of 15-lipoxygenase type-1 in human mast cells.", "journal": "Biochimica et biophysica acta", "date": "2007", "authors": "Gulliksson M, Brunnstrom A, Johannesson M, Backman L, Nilsson G, Harvima I, Dahlen B, Kumlin M, Claesson HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-2142770", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142770" } ], "reference": [ { "type": "PubMed", "id": "17662651", "url": "https://glygen.org/publication/PubMed/17662651" } ] }, { "title": "Reconstitution of the mitochondrial PrxIII antioxidant defence pathway: general properties and factors affecting PrxIII activity and oligomeric state.", "journal": "Journal of molecular biology", "date": "2007", "authors": "Cao Z, Bhella D, Lindsay JG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "17707404", "url": "https://glygen.org/publication/PubMed/17707404" } ] }, { "title": "Do genetic factors protect for early onset lung cancer? A case control study before the age of 50 years.", "journal": "BMC cancer", "date": "2008", "authors": "Rosenberger A, Illig T, Korb K, Klopp N, Zietemann V, Wolke G, Meese E, Sybrecht G, Kronenberg F, Cebulla M, Degen M, Drings P, Groschel A, Konietzko N, Kreymborg KG, Haussinger K, Hoffken G, Jilge B, Ko YD, Morr H, Schmidt C, Schmidt EW, Tauscher D, Bickeboller H, Wichmann HE", "evidence": [ { "database": "Entrez", "id": "2876", "url": "https://www.ncbi.nlm.nih.gov/gene/2876" } ], "reference": [ { "type": "PubMed", "id": "18298806", "url": "https://glygen.org/publication/PubMed/18298806" } ] }, { "title": "Characterization of the complex of glutathione S-transferase pi and 1-cysteine peroxiredoxin.", "journal": "Archives of biochemistry and biophysics", "date": "2008", "authors": "Ralat LA, Misquitta SA, Manevich Y, Fisher AB, Colman RF", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "18358825", "url": "https://glygen.org/publication/PubMed/18358825" } ] }, { "title": "Substrate specificity changes for human reticulocyte and epithelial 15-lipoxygenases reveal allosteric product regulation.", "journal": "Biochemistry", "date": "2008", "authors": "Wecksler AT, Kenyon V, Deschamps JD, Holman TR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2142770", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142770" } ], "reference": [ { "type": "PubMed", "id": "18570379", "url": "https://glygen.org/publication/PubMed/18570379" } ] }, { "title": "Different regulation of wild-type and mutant Cu,Zn superoxide dismutase localization in mammalian mitochondria.", "journal": "Human molecular genetics", "date": "2008", "authors": "Kawamata H, Manfredi G", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "18703498", "url": "https://glygen.org/publication/PubMed/18703498" } ] }, { "title": "Glutathione peroxidase 3 mediates the antioxidant effect of peroxisome proliferator-activated receptor gamma in human skeletal muscle cells.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Chung SS, Kim M, Youn BS, Lee NS, Park JW, Lee IK, Lee YS, Kim JB, Cho YM, Lee HK, Park KS", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "18936159", "url": "https://glygen.org/publication/PubMed/18936159" } ] }, { "title": "Paraoxonases (PON1, PON2, PON3) analyses in vitro and in vivo in relation to cardiovascular diseases.", "journal": "Methods in molecular biology (Clifton, N.J.)", "date": "2008", "authors": "Aviram M, Rosenblat M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2142688", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142688" } ], "reference": [ { "type": "PubMed", "id": "19082953", "url": "https://glygen.org/publication/PubMed/19082953" } ] }, { "title": "Regulation of the extracellular antioxidant selenoprotein plasma glutathione peroxidase (GPx-3) in mammalian cells.", "journal": "Molecular and cellular biochemistry", "date": "2009", "authors": "Ottaviano FG, Tang SS, Handy DE, Loscalzo J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "19219623", "url": "https://glygen.org/publication/PubMed/19219623" } ] }, { "title": "Activation of Cu,Zn-superoxide dismutase in the absence of oxygen and the copper chaperone CCS.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Leitch JM, Jensen LT, Bouldin SD, Outten CE, Hart PJ, Culotta VC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "19542232", "url": "https://glygen.org/publication/PubMed/19542232" } ] }, { "title": "O-GlcNAcylation regulates hyperglycemia-induced GPX1 activation.", "journal": "Biochemical and biophysical research communications", "date": "2010", "authors": "Yang WH, Park SY, Ji S, Kang JG, Kim JE, Song H, Mook-Jung I, Choe KM, Cho JW", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07203", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07203" } ], "reference": [ { "type": "PubMed", "id": "19944066", "url": "https://glygen.org/publication/PubMed/19944066" } ] }, { "title": "Acatalasemia.", "journal": "Human genetics", "date": "1991", "authors": "Ogata M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "1999334", "url": "https://glygen.org/publication/PubMed/1999334" } ] }, { "title": "Irreversible inactivation of glutathione peroxidase 1 and reversible inactivation of peroxiredoxin II by H2O2 in red blood cells.", "journal": "Antioxidants & redox signaling", "date": "2010", "authors": "Cho CS, Lee S, Lee GT, Woo HA, Choi EJ, Rhee SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "20070187", "url": "https://glygen.org/publication/PubMed/20070187" } ] }, { "title": "Import, maturation, and function of SOD1 and its copper chaperone CCS in the mitochondrial intermembrane space.", "journal": "Antioxidants & redox signaling", "date": "2010", "authors": "Kawamata H, Manfredi G", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "20367259", "url": "https://glygen.org/publication/PubMed/20367259" } ] }, { "title": "Does cellular hydrogen peroxide diffuse or act locally?", "journal": "Antioxidants & redox signaling", "date": "2011", "authors": "Mishina NM, Tyurin-Kuzmin PA, Markvicheva KN, Vorotnikov AV, Tkachuk VA, Laketa V, Schultz C, Lukyanov S, Belousov VV", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "20690882", "url": "https://glygen.org/publication/PubMed/20690882" } ] }, { "title": "Biochemical and stability properties of recombinant human MnSOD.", "journal": "Free radical research communications", "date": "1991", "authors": "Werber MM, Greenstein LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "2071038", "url": "https://glygen.org/publication/PubMed/2071038" } ] }, { "title": "Two endoplasmic reticulum PDI peroxidases increase the efficiency of the use of peroxide during disulfide bond formation.", "journal": "Journal of molecular biology", "date": "2011", "authors": "Nguyen VD, Saaranen MJ, Karala AR, Lappi AK, Wang L, Raykhel IB, Alanen HI, Salo KE, Wang CC, Ruddock LW", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "21215271", "url": "https://glygen.org/publication/PubMed/21215271" } ] }, { "title": "Model for the exceptional reactivity of peroxiredoxins 2 and 3 with hydrogen peroxide: a kinetic and computational study.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Nagy P, Karton A, Betz A, Peskin AV, Pace P, O'Reilly RJ, Hampton MB, Radom L, Winterbourn CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "21385867", "url": "https://glygen.org/publication/PubMed/21385867" } ] }, { "title": "Mitochondrial Cu,Zn-superoxide dismutase mediates pulmonary fibrosis by augmenting H2O2 generation.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "He C, Murthy S, McCormick ML, Spitz DR, Ryan AJ, Carter AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "21393238", "url": "https://glygen.org/publication/PubMed/21393238" } ] }, { "title": "Lipoxygenases mediate the effect of essential fatty acid in skin barrier formation: a proposed role in releasing omega-hydroxyceramide for construction of the corneocyte lipid envelope.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Zheng Y, Yin H, Boeglin WE, Elias PM, Crumrine D, Beier DR, Brash AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2142712", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142712" } ], "reference": [ { "type": "PubMed", "id": "21558561", "url": "https://glygen.org/publication/PubMed/21558561" } ] }, { "title": "Mitochondrial regulation of cell cycle and proliferation.", "journal": "Antioxidants & redox signaling", "date": "2012", "authors": "Antico Arciuch VG, Elguero ME, Poderoso JJ, Carreras MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "21967640", "url": "https://glygen.org/publication/PubMed/21967640" } ] }, { "title": "Cloning of the cDNA for human 12-lipoxygenase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Izumi T, Hoshiko S, Radmark O, Samuelsson B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2142712", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142712" } ], "reference": [ { "type": "PubMed", "id": "2217179", "url": "https://glygen.org/publication/PubMed/2217179" } ] }, { "title": "Site of mitochondrial reactive oxygen species production in skeletal muscle of chronic obstructive pulmonary disease and its relationship with exercise oxidative stress.", "journal": "American journal of respiratory cell and molecular biology", "date": "2012", "authors": "Puente-Maestu L, Tejedor A, Lazaro A, de Miguel J, Alvarez-Sala L, Gonzalez-Aragoneses F, Simon C, Agusti A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "22493009", "url": "https://glygen.org/publication/PubMed/22493009" } ] }, { "title": "Human superoxide dismutase 1 (hSOD1) maturation through interaction with human copper chaperone for SOD1 (hCCS).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Banci L, Bertini I, Cantini F, Kozyreva T, Massagni C, Palumaa P, Rubino JT, Zovo K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "22869735", "url": "https://glygen.org/publication/PubMed/22869735" } ] }, { "title": "Mitochondrial aquaporin-8 knockdown in human hepatoma HepG2 cells causes ROS-induced mitochondrial depolarization and loss of viability.", "journal": "Toxicology and applied pharmacology", "date": "2012", "authors": "Marchissio MJ, Frances DE, Carnovale CE, Marinelli RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "22910329", "url": "https://glygen.org/publication/PubMed/22910329" } ] }, { "title": "Isolation and chromosomal localization of the human glutathione peroxidase gene.", "journal": "Genomics", "date": "1990", "authors": "Chada S, Le Beau M M, Casey L, Newburger P E", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "reference": [ { "type": "PubMed", "id": "2307470", "url": "https://glygen.org/publication/PubMed/2307470" } ] }, { "title": "ZNF143 transcription factor mediates cell survival through upregulation of the GPX1 activity in the mitochondrial respiratory dysfunction.", "journal": "Cell death & disease", "date": "2012", "authors": "Lu W, Chen Z, Zhang H, Wang Y, Luo Y, Huang P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "23152058", "url": "https://glygen.org/publication/PubMed/23152058" } ] }, { "title": "Functional interaction of glutathione S-transferase pi and peroxiredoxin 6 in intact cells.", "journal": "The international journal of biochemistry & cell biology", "date": "2013", "authors": "Zhou S, Lien YC, Shuvaeva T, DeBolt K, Feinstein SI, Fisher AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "23164639", "url": "https://glygen.org/publication/PubMed/23164639" } ] }, { "title": "Expression of cloned human reticulocyte 15-lipoxygenase and immunological evidence that 15-lipoxygenases of different cell types are related.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Sigal E, Grunberger D, Highland E, Gross C, Dixon RA, Craik CS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2142712", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142712" } ], "reference": [ { "type": "PubMed", "id": "2318885", "url": "https://glygen.org/publication/PubMed/2318885" } ] }, { "title": "Protein disulfide isomerase and glutathione are alternative substrates in the one Cys catalytic cycle of glutathione peroxidase 7.", "journal": "Biochimica et biophysica acta", "date": "2013", "authors": "Bosello-Travain V, Conrad M, Cozza G, Negro A, Quartesan S, Rossetto M, Roveri A, Toppo S, Ursini F, Zaccarin M, Maiorino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "23454490", "url": "https://glygen.org/publication/PubMed/23454490" } ] }, { "title": "Mechanistic insights into the superoxide-cytochrome c reaction by lysine surface scanning.", "journal": "Journal of biological inorganic chemistry : JBIC : a publication of the Society of Biological Inorganic Chemistry", "date": "2013", "authors": "Wegerich F, Giachetti A, Allegrozzi M, Lisdat F, Turano P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "23455484", "url": "https://glygen.org/publication/PubMed/23455484" } ] }, { "title": "Molecular cloning, primary structure, and expression of the human platelet/erythroleukemia cell 12-lipoxygenase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Funk CD, Furci L, FitzGerald GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2142712", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142712" } ], "reference": [ { "type": "PubMed", "id": "2377602", "url": "https://glygen.org/publication/PubMed/2377602" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" }, { "database": "iPTMnet", "id": "P07203", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07203" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "Role of glutathione and glutathione peroxidase in human platelet arachidonic acid metabolism.", "journal": "Prostaglandins", "date": "1989", "authors": "Hill TD, White JG, Rao GH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2142770", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142770" } ], "reference": [ { "type": "PubMed", "id": "2501828", "url": "https://glygen.org/publication/PubMed/2501828" } ] }, { "title": "Natural allelic variations in glutathione peroxidase-1 affect its subcellular localization and function.", "journal": "Cancer research", "date": "2014", "authors": "Bera S, Weinberg F, Ekoue DN, Ansenberger-Fricano K, Mao M, Bonini MG, Diamond AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "25047527", "url": "https://glygen.org/publication/PubMed/25047527" } ] }, { "title": "Homozygous ALOXE3 Nonsense Variant Identified in a Patient with Non-Bullous Congenital Ichthyosiform Erythroderma Complicated by Superimposed Bullous Majocchi's Granuloma: The Consequences of Skin Barrier Dysfunction.", "journal": "International journal of molecular sciences", "date": "2015", "authors": "Wang T, Xu C, Zhou X, Li C, Zhang H, Lian BQ, Lee JJ, Shen J, Liu Y, Lian CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2142712", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142712" } ], "reference": [ { "type": "PubMed", "id": "26370990", "url": "https://glygen.org/publication/PubMed/26370990" } ] }, { "title": "Sequence of a cDNA coding for human glutathione peroxidase confirms TGA encodes active site selenocysteine.", "journal": "Nucleic Acids Res.", "date": "1987", "authors": "Mullenbach GT, Tabrizi A, Irvine BD, Bell GI, Hallewell RA", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "reference": [ { "type": "PubMed", "id": "2955287", "url": "https://glygen.org/publication/PubMed/2955287" } ] }, { "title": "Single protein from human leukocytes possesses 5-lipoxygenase and leukotriene A4 synthase activities.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1986", "authors": "Rouzer CA, Matsumoto T, Samuelsson B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2142688", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142688" } ], "reference": [ { "type": "PubMed", "id": "3006030", "url": "https://glygen.org/publication/PubMed/3006030" } ] }, { "title": "Reversible, calcium-dependent membrane association of human leukocyte 5-lipoxygenase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1987", "authors": "Rouzer CA, Samuelsson B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2142688", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142688" } ], "reference": [ { "type": "PubMed", "id": "3118366", "url": "https://glygen.org/publication/PubMed/3118366" } ] }, { "title": "Characterization of cloned human leukocyte 5-lipoxygenase expressed in mammalian cells.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Rouzer CA, Rands E, Kargman S, Jones RE, Register RB, Dixon RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2142688", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142688" } ], "reference": [ { "type": "PubMed", "id": "3164719", "url": "https://glygen.org/publication/PubMed/3164719" } ] }, { "title": "GPX1, a biomarker for the diagnosis and prognosis of kidney cancer, promotes the progression of kidney cancer.", "journal": "Aging", "date": "2019", "authors": "Cheng Y, Xu T, Li S, Ruan H", "evidence": [ { "database": "GlyGen", "id": "A0382", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "31844035", "url": "https://glygen.org/publication/PubMed/31844035" } ] }, { "title": "Glutathione peroxidase protein. Absence in selenium deficiency states and correlation with enzymatic activity.", "journal": "The Journal of clinical investigation", "date": "1986", "authors": "Takahashi K, Newburger PE, Cohen HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "3457020", "url": "https://glygen.org/publication/PubMed/3457020" } ] }, { "title": "High-level expression of enzymatically active human Cu/Zn superoxide dismutase in Escherichia coli.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1986", "authors": "Hartman JR, Geller T, Yavin Z, Bartfeld D, Kanner D, Aviv H, Gorecki M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "3532102", "url": "https://glygen.org/publication/PubMed/3532102" } ] }, { "title": "Purification and characterization of human plasma glutathione peroxidase: a selenoglycoprotein distinct from the known cellular enzyme.", "journal": "Archives of biochemistry and biophysics", "date": "1987", "authors": "Takahashi K, Avissar N, Whitin J, Cohen H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "3619451", "url": "https://glygen.org/publication/PubMed/3619451" } ] }, { "title": "cDNA sequence coding for human glutathione peroxidase.", "journal": "Nucleic Acids Res.", "date": "1987", "authors": "Sukenaga Y, Ishida K, Takeda T, Takagi K", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "reference": [ { "type": "PubMed", "id": "3658677", "url": "https://glygen.org/publication/PubMed/3658677" } ] }, { "title": "Side-by-side comparison of recombinant human glutathione peroxidases identifies overlapping substrate specificities for soluble hydroperoxides.", "journal": "Redox biology", "date": "2023-02", "authors": "Schwarz Maria, L\u00f6ser Alina, Cheng Qing, Wichmann-Costaganna Mareike, Sch\u00e4del Patrick, Werz Oliver, Arn\u00e9r Elias Sj, Kipp Anna P", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "reference": [ { "type": "PubMed", "id": "36608588", "url": "https://glygen.org/publication/PubMed/36608588" } ] }, { "title": "Polyalanine polymorphism in the signal peptide of Glutathione peroxidase 1 (GPX1) gene & its association with osteoporosis.", "journal": "The Indian journal of medical research", "date": "2022", "authors": "Ahuja Soni Ghumnani, Shahu Arjun, Rath Subrata, Adkar Neeraj, Shouche Yogesh, Ghaskadbi Saroj, Ashma Richa", "evidence": [ { "database": "RefSeq", "id": "NP_000572", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000572" } ], "reference": [ { "type": "PubMed", "id": "36926781", "url": "https://glygen.org/publication/PubMed/36926781" } ] }, { "title": "Characterization of the major hydroperoxide-reducing activity of human plasma. Purification and properties of a selenium-dependent glutathione peroxidase.", "journal": "The Journal of biological chemistry", "date": "1987", "authors": "Maddipati KR, Marnett LJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "3693360", "url": "https://glygen.org/publication/PubMed/3693360" } ] }, { "title": "Nucleotide sequence of a human gene for glutathione peroxidase.", "journal": "Nucleic Acids Res.", "date": "1987", "authors": "Ishida K, Morino T, Takagi K, Sukenaga Y", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "reference": [ { "type": "PubMed", "id": "3697069", "url": "https://glygen.org/publication/PubMed/3697069" } ] }, { "title": "The mRNA expression of genes encoding selected antioxidant enzymes and thioredoxin, and the concentrations of their protein products in gingival crevicular fluid and saliva during periodontitis.", "journal": "Dental and medical problems", "date": "2023", "authors": "Toczewska Joanna, Baczy\u0144ska Dagmara, Zalewska Anna, Maciejczyk Mateusz, Konopka Tomasz", "evidence": [ { "database": "RefSeq", "id": "NP_000572", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000572" } ], "reference": [ { "type": "PubMed", "id": "37390459", "url": "https://glygen.org/publication/PubMed/37390459" } ] }, { "title": "Variation of the genes encoding antioxidant enzymes SOD2 (rs4880), GPX1 (rs1050450), and CAT (rs1001179) and susceptibility to male infertility: a genetic association study and in silico analysis.", "journal": "Environmental science and pollution research international", "date": "2023-08", "authors": "Fallah Fatemeh, Colagar Abasalt Hosseinzadeh, Saleh Hayder Abdulhadi, Ranjbar Mojtaba", "evidence": [ { "database": "RefSeq", "id": "NP_000572", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000572" } ], "reference": [ { "type": "PubMed", "id": "37405601", "url": "https://glygen.org/publication/PubMed/37405601" } ] }, { "title": "Cellular and exosomal GPx1 are essential for controlling hydrogen peroxide balance and alleviating oxidative stress in hypoxic glioblastoma.", "journal": "Redox biology", "date": "2023-09", "authors": "Lei Fu-Ju, Chiang Jung-Ying, Chang Huan-Jui, Chen Der-Cherng, Wang Hwai-Lee, Yang Hsi-An, Wei Kai-Yu, Huang Yen-Chih, Wang Chi-Chung, Wei Sung-Tai, Hsieh Chia-Hung", "evidence": [ { "database": "RefSeq", "id": "NP_000572", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000572" } ], "reference": [ { "type": "PubMed", "id": "37572455", "url": "https://glygen.org/publication/PubMed/37572455" } ] }, { "title": "Superoxide dismutase. An enzymic function for erythrocuprein (hemocuprein).", "journal": "The Journal of biological chemistry", "date": "1969", "authors": "McCord JM, Fridovich I", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "5389100", "url": "https://glygen.org/publication/PubMed/5389100" } ] }, { "title": "The reaction between the superoxide anion radical and cytochrome c.", "journal": "Biochimica et biophysica acta", "date": "1975", "authors": "Butler J, Jayson GG, Swallow AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "60", "url": "https://glygen.org/publication/PubMed/60" } ] }, { "title": "Kinetics and mechanism of the reduction of ferricytochrome c by the superoxide anion.", "journal": "The Journal of biological chemistry", "date": "1982", "authors": "Butler J, Koppenol WH, Margoliash E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "6286671", "url": "https://glygen.org/publication/PubMed/6286671" } ] }, { "title": "Role of glutathione peroxidase and hexose monophosphate shunt in the platelet lipoxygenase pathway.", "journal": "The Journal of biological chemistry", "date": "1982", "authors": "Bryant RW, Simon TC, Bailey JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2142688", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142688" } ], "reference": [ { "type": "PubMed", "id": "6816802", "url": "https://glygen.org/publication/PubMed/6816802" } ] }, { "title": "Human copper-containing superoxide dismutase of high molecular weight.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1982", "authors": "Marklund SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "6961438", "url": "https://glygen.org/publication/PubMed/6961438" } ] }, { "title": "Purification of superoxide dismutases from human placenta using immunoadsorbent columns.", "journal": "Journal of pharmacobio-dynamics", "date": "1981", "authors": "Sugiura M, Adachi T, Inoue H, Ito Y, Hirano K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "7021796", "url": "https://glygen.org/publication/PubMed/7021796" } ] }, { "title": "Superoxide dismutase in extracellular fluids.", "journal": "Clinica chimica acta; international journal of clinical chemistry", "date": "1982", "authors": "Marklund SL, Holme E, Hellner L", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "7172448", "url": "https://glygen.org/publication/PubMed/7172448" } ] }, { "title": "Human diadenosine 5',5`'-P1,P4-tetraphosphate pyrophosphohydrolase is a member of the MutT family of nucleotide pyrophosphatases.", "journal": "The Biochemical journal", "date": "1995", "authors": "Thorne NM, Hankin S, Wilkinson MC, Nunez C, Barraclough R, McLennan AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "7487923", "url": "https://glygen.org/publication/PubMed/7487923" } ] }, { "title": "Aspirin triggers previously undescribed bioactive eicosanoids by human endothelial cell-leukocyte interactions.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Claria J, Serhan CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-2142770", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142770" } ], "reference": [ { "type": "PubMed", "id": "7568157", "url": "https://glygen.org/publication/PubMed/7568157" } ] }, { "title": "Purification and properties of human erythrocyte glutathione peroxidase.", "journal": "The Journal of biological chemistry", "date": "1975", "authors": "Awasthi YC, Beutler E, Srivastava SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "807573", "url": "https://glygen.org/publication/PubMed/807573" } ] }, { "title": "Overexpression, purification and characterization of human recombinant 15-lipoxygenase.", "journal": "Biochimica et biophysica acta", "date": "1993", "authors": "Kuhn H, Barnett J, Grunberger D, Baecker P, Chow J, Nguyen B, Bursztyn-Pettegrew H, Chan H, Sigal E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2142712", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142712" } ], "reference": [ { "type": "PubMed", "id": "8334154", "url": "https://glygen.org/publication/PubMed/8334154" } ] }, { "title": "Heparin-affinity patterns and composition of extracellular superoxide dismutase in human plasma and tissues.", "journal": "The Biochemical journal", "date": "1993", "authors": "Sandstrom J, Karlsson K, Edlund T, Marklund SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "8379940", "url": "https://glygen.org/publication/PubMed/8379940" } ] }, { "title": "Expression, characterization, and tissue distribution of a new cellular selenium-dependent glutathione peroxidase, GSHPx-GI.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Chu FF, Doroshow JH, Esworthy RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "8428933", "url": "https://glygen.org/publication/PubMed/8428933" } ] }, { "title": "Proteolytic modification of the heparin-binding affinity of extracellular superoxide dismutase.", "journal": "The Biochemical journal", "date": "1993", "authors": "Karlsson K, Edlund A, Sandstrom J, Marklund SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "8452552", "url": "https://glygen.org/publication/PubMed/8452552" } ] }, { "title": "Catalytic properties of human manganese superoxide dismutase.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Hsu JL, Hsieh Y, Tu C, O'Connor D, Nick HS, Silverman DN", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "8663465", "url": "https://glygen.org/publication/PubMed/8663465" } ] }, { "title": "The copper chaperone for superoxide dismutase.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Culotta VC, Klomp LW, Strain J, Casareno RL, Krems B, Gitlin JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "9295278", "url": "https://glygen.org/publication/PubMed/9295278" } ] }, { "title": "High protonic potential actuates a mechanism of production of reactive oxygen species in mitochondria.", "journal": "FEBS letters", "date": "1997", "authors": "Korshunov SS, Skulachev VP, Starkov AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "9369223", "url": "https://glygen.org/publication/PubMed/9369223" } ] }, { "title": "A 12R-lipoxygenase in human skin: mechanistic evidence, molecular cloning, and expression.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Boeglin WE, Kim RB, Brash AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2142712", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142712" } ], "reference": [ { "type": "PubMed", "id": "9618483", "url": "https://glygen.org/publication/PubMed/9618483" } ] }, { "title": "The majority of human glutathione peroxidase type 5 (GPX5) transcripts are incorrectly spliced: implications for the role of GPX5 in the male reproductive tract.", "journal": "The Biochemical journal", "date": "1998", "authors": "Hall L, Williams K, Perry AC, Frayne J, Jury JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "9639555", "url": "https://glygen.org/publication/PubMed/9639555" } ] }, { "title": "The copper chaperone CCS directly interacts with copper/zinc superoxide dismutase.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Casareno RL, Waggoner D, Gitlin JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "9726962", "url": "https://glygen.org/publication/PubMed/9726962" } ] }, { "title": "Cloning, sequencing and functional expression of a novel human thioredoxin reductase.", "journal": "FEBS letters", "date": "1999", "authors": "Gasdaska PY, Berggren MM, Berry MJ, Powis G", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "9923614", "url": "https://glygen.org/publication/PubMed/9923614" } ] } ], "pathway": [ { "id": "hsa:2876", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2876", "resource": "KEGG Pathway" }, { "id": "R-HSA-2142688", "name": "Synthesis of 5-eicosatetraenoic acids", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142688", "resource": "Reactome", "description": "Synthesis of 5-eicosatetraenoic acids" }, { "id": "R-HSA-2142712", "name": "Synthesis of 12-eicosatetraenoic acid derivatives", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142712", "resource": "Reactome", "description": "Synthesis of 12-eicosatetraenoic acid derivatives" }, { "id": "R-HSA-2142770", "name": "Synthesis of 15-eicosatetraenoic acid derivatives", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2142770", "resource": "Reactome", "description": "Synthesis of 15-eicosatetraenoic acid derivatives" }, { "id": "R-HSA-3299685", "name": "Detoxification of Reactive Oxygen Species", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685", "resource": "Reactome", "description": "Detoxification of Reactive Oxygen Species" } ], "orthologs": [ { "uniprot_canonical_ac": "P04041-1", "protein_name": "Glutathione peroxidase 1", "gene_name": "Gpx1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSAARLSAVAQSTVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTTRDYTEMNDLQKRLGPRGLVVLGFPCNQFGHQENGKNEEILNSLKYVRPGGGFEPNFTLFEKCEVNGEKAHPLFTFLRNALPAPSDDPTALMTDPKYIIWSPVCRNDISWNFEKFLVGPDGVPVRRYSRRFRTIDIEPDIEALLSKQPSNP", "length": 201 }, "evidence": [ { "id": "45919096", "url": "http://www.informatics.jax.org/homology/45919096", "database": "MGI" }, { "id": "P07203", "url": "https://omabrowser.org/oma/group/P07203/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P11352-1", "protein_name": "Glutathione peroxidase 1", "gene_name": "Gpx1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MCAARLSAAAQSTVYAFSARPLTGGEPVSLGSLRGKVLLIENVASLUGTTIRDYTEMNDLQKRLGPRGLVVLGFPCNQFGHQENGKNEEILNSLKYVRPGGGFEPNFTLFEKCEVNGEKAHPLFTFLRNALPTPSDDPTALMTDPKYIIWSPVCRNDIAWNFEKFLVGPDGVPVRRYSRRFRTIDIEPDIETLLSQQSGNS", "length": 201 }, "evidence": [ { "id": "45919096", "url": "http://www.informatics.jax.org/homology/45919096", "database": "MGI" }, { "id": "P07203", "url": "https://omabrowser.org/oma/group/P07203/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 47, "go_terms": [ { "name": "response to oxidative stress", "id": "GO:0006979", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006979", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "skeletal muscle tissue regeneration", "id": "GO:0043403", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043403", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "biological process involved in interaction with symbiont", "id": "GO:0051702", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051702", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "response to symbiotic bacterium", "id": "GO:0009609", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009609", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "positive regulation of supramolecular fiber organization", "id": "GO:1902905", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902905", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "temperature homeostasis", "id": "GO:0001659", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001659", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "triglyceride metabolic process", "id": "GO:0006641", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006641", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "response to gamma radiation", "id": "GO:0010332", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010332", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "response to nicotine", "id": "GO:0035094", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035094", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "neuron apoptotic process", "id": "GO:0051402", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051402", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction", "id": "GO:0051897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051897", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "cellular response to glucose stimulus", "id": "GO:0071333", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071333", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "vasodilation", "id": "GO:0042311", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042311", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "negative regulation of cysteine-type endopeptidase activity involved in apoptotic process", "id": "GO:0043154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043154", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "heart contraction", "id": "GO:0060047", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060047", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "response to hydrogen peroxide", "id": "GO:0042542", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042542", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "negative regulation of inflammatory response to antigenic stimulus", "id": "GO:0002862", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002862", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "response to vitamin E", "id": "GO:0033197", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033197", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "skeletal muscle fiber development", "id": "GO:0048741", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048741", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "response to estradiol", "id": "GO:0032355", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032355", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "cellular response to oxidative stress", "id": "GO:0034599", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034599", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "fat cell differentiation", "id": "GO:0045444", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045444", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "sensory perception of sound", "id": "GO:0007605", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007605", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "response to hormone", "id": "GO:0009725", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009725", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "response to selenium ion", "id": "GO:0010269", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010269", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "blood vessel endothelial cell migration", "id": "GO:0043534", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043534", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "cell redox homeostasis", "id": "GO:0045454", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045454", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "hydrogen peroxide catabolic process", "id": "GO:0042744", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042744", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "lipoxygenase pathway", "id": "GO:0019372", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019372", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "response to xenobiotic stimulus", "id": "GO:0009410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009410", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "negative regulation of release of cytochrome c from mitochondria", "id": "GO:0090201", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090201", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway", "id": "GO:1902176", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902176", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "fibroblast proliferation", "id": "GO:0048144", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048144", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "negative regulation of extrinsic apoptotic signaling pathway via death domain receptors", "id": "GO:1902042", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902042", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "epigenetic regulation of gene expression", "id": "GO:0040029", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0040029", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "myoblast differentiation", "id": "GO:0045445", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045445", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "response to folic acid", "id": "GO:0051593", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051593", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "regulation of mammary gland epithelial cell proliferation", "id": "GO:0033599", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033599", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "response to hydroperoxide", "id": "GO:0033194", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033194", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "myoblast proliferation", "id": "GO:0051450", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051450", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "intrinsic apoptotic signaling pathway in response to oxidative stress", "id": "GO:0008631", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008631", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "arachidonic acid metabolic process", "id": "GO:0019369", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019369", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "angiogenesis involved in wound healing", "id": "GO:0060055", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060055", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "UV protection", "id": "GO:0009650", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009650", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "endothelial cell development", "id": "GO:0001885", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001885", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "regulation of proteasomal protein catabolic process", "id": "GO:0061136", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061136", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "glutathione metabolic process", "id": "GO:0006749", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006749", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "glutathione peroxidase activity", "id": "GO:0004602", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004602", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "SH3 domain binding", "id": "GO:0017124", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017124", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "phospholipid-hydroperoxide glutathione peroxidase activity", "id": "GO:0047066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047066", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "mitochondrial matrix", "id": "GO:0005759", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005759", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P07203", "url": "https://www.uniprot.org/uniprot/P07203" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "16833", "name": "", "equation": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P23764-1", "P83645-1", "P30710-1", "Q64625-1", "P04041-1", "P36970-1", "Q96SL4-1", "O75715-1", "Q8TED1-1", "P59796-1", "P22352-1", "P18283-1", "P07203-1", "P36969-1", "P11352-1", "Q91WR8-1", "P21765-1", "Q99LJ6-1", "Q9D7B7-1", "P46412-1", "Q9JHC0-1", "O70325-1", "P17695-1", "P23202-1", "P25373-1", "P36014-1" ], "evidence": [ { "id": "16833", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/16833" } ] }, { "id": "19057", "name": "", "equation": "a hydroperoxy polyunsaturated fatty acid + 2 glutathione = a hydroxy polyunsaturated fatty acid + glutathione disulfide + H2O", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P36970-1", "P04041-1", "P83645-1", "P36969-1", "P18283-1", "P07203-1", "O70325-1", "P11352-1", "Q9JHC0-1" ], "evidence": [ { "id": "19057", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/19057" } ] }, { "id": "48620", "name": "", "equation": "(5S)-hydroperoxy-(6E,8Z,11Z,14Z)-eicosatetraenoate + 2 glutathione = (5S)-hydroxy-(6E,8Z,11Z,14Z)-eicosatetraenoate + glutathione disulfide + H2O", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9JHF3-1", "P04041-1", "P83645-1", "P36970-1", "O14880-1", "Q99735-1", "O14684-1", "P18283-1", "P07203-1", "P36969-1", "Q9CPU4-1", "A2RST1-1", "Q9JM51-1", "P11352-1", "Q9JHC0-1", "O70325-1" ], "evidence": [ { "id": "48620", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/48620" } ] }, { "id": "48888", "name": "", "equation": "(13S)-hydroperoxy-(9Z,11E)-octadecadienoate + 2 glutathione = (13S)-hydroxy-(9Z,11E)-octadecadienoate + glutathione disulfide + H2O", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P00502-1", "P36970-1", "P04041-1", "P83645-1", "P08263-1", "P36969-1", "P18283-1", "P07203-1", "P13745-1", "O70325-1", "P11352-1", "Q9JHC0-1" ], "evidence": [ { "id": "48888", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/48888" } ] }, { "id": "50708", "name": "", "equation": "(12S)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate + 2 glutathione = (12S)-hydroxy-(5Z,8Z,10E,14Z)-eicosatetraenoate + glutathione disulfide + H2O", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P36970-1", "P04041-1", "P07203-1", "P36969-1", "P11352-1", "O70325-1" ], "evidence": [ { "id": "50708", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/50708" } ] }, { "id": "69412", "name": "", "equation": "2 glutathione + tert-butyl hydroperoxide = glutathione disulfide + H2O + tert-butanol", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P83645-1", "P23764-1", "P04041-1", "P36970-1", "P22352-1", "P18283-1", "P07203-1", "P36969-1", "P46412-1", "Q9JHC0-1", "P11352-1", "O70325-1" ], "evidence": [ { "id": "69412", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/69412" } ] }, { "id": "69651", "name": "", "equation": "cumene hydroperoxide + 2 glutathione = 2-phenylpropan-2-ol + glutathione disulfide + H2O", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P83645-1", "P04041-1", "P36970-1", "P18283-1", "P07203-1", "P36969-1", "Q9JHC0-1", "P11352-1", "O70325-1" ], "evidence": [ { "id": "69651", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/69651" } ] }, { "id": "76687", "name": "", "equation": "(9S)-hydroperoxy-(10E,12Z)-octadecadienoate + 2 glutathione = (9S)-hydroxy-(10E,12Z)-octadecadienoate + glutathione disulfide + H2O", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P04041-1", "P36970-1", "P07203-1", "P36969-1", "P11352-1", "O70325-1" ], "evidence": [ { "id": "76687", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/76687" } ] }, { "id": "76691", "name": "", "equation": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate + 2 glutathione = (12R)-hydroxy-(5Z,8Z,10E,14Z)-eicosatetraenoate + glutathione disulfide + H2O", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P04041-1", "P83645-1", "P36970-1", "P18283-1", "P07203-1", "P36969-1", "P11352-1", "Q9JHC0-1", "O70325-1" ], "evidence": [ { "id": "76691", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/76691" } ] }, { "id": "76695", "name": "", "equation": "(15S)-hydroperoxy-(5Z,8Z,11Z,13E)-eicosatetraenoate + 2 glutathione = (15S)-hydroxy-(5Z,8Z,11Z,13E)-eicosatetraenoate + glutathione disulfide + H2O", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P04041-1", "P83645-1", "P36970-1", "P18283-1", "P07203-1", "P36969-1", "P11352-1", "Q9JHC0-1", "O70325-1" ], "evidence": [ { "id": "76695", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/76695" } ] }, { "id": "76699", "name": "", "equation": "(5S)-hydroperoxy-(6E,8Z,11Z,14Z,17Z)-eicosapentaenoate + 2 glutathione = (5S)-hydroxy-(6E,8Z,11Z,14Z,17Z)-eicosapentaenoate + glutathione disulfide + H2O", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P04041-1", "P36970-1", "P07203-1", "P36969-1", "P11352-1", "O70325-1" ], "evidence": [ { "id": "76699", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/76699" } ] }, { "id": "76703", "name": "", "equation": "(12S)-hydroperoxy-(5Z,8Z,10E,14Z,17Z)-eicosapentaenoate + 2 glutathione = (12S)-hydroxy-(5Z,8Z,10E,14Z,17Z)-eicosapentaenoate + glutathione disulfide + H2O", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P04041-1", "P36970-1", "P07203-1", "P36969-1", "P11352-1", "O70325-1" ], "evidence": [ { "id": "76703", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/76703" } ] }, { "id": "76707", "name": "", "equation": "(15S)-hydroperoxy-(5Z,8Z,11Z,13E,17Z)-eicosapentaenoate + 2 glutathione = (15S)-hydroxy-(5Z,8Z,11Z,13E,17Z)-eicosapentaenoate + glutathione disulfide + H2O", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P04041-1", "P36970-1", "P07203-1", "P36969-1", "P11352-1", "O70325-1" ], "evidence": [ { "id": "76707", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/76707" } ] }, { "id": "76711", "name": "", "equation": "(15S)-hydroperoxy-(11Z,13E)-eicosadienoate + 2 glutathione = (15S)-hydroxy-(11Z,13E)-eicosadienoate + glutathione disulfide + H2O", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P04041-1", "P36970-1", "P07203-1", "P36969-1", "P11352-1", "O70325-1" ], "evidence": [ { "id": "76711", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/76711" } ] }, { "id": "76715", "name": "", "equation": "(17S)-hydroperoxy-(4Z,7Z,10Z,13Z,15E,19Z)-docosahexaenoate + 2 glutathione = (17S)-hydroxy-(4Z,7Z,10Z,13Z,15E,19Z)-docosahexaenoate + glutathione disulfide + H2O", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P04041-1", "P36970-1", "P07203-1", "P36969-1", "P11352-1", "O70325-1" ], "evidence": [ { "id": "76715", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/76715" } ] }, { "id": "R-HSA-2161791", "name": "15S-HpETE is reduced to 15S-HETE by GPX1/2/4", "equation": "", "summary": "Glutathione peroxidases (GPXs) in human platelets (either GPX1, GPX2, or GPX4 are present in the cytosol) are involved in reducing 15S-hydroperoxyeicosatetraenoic acid (15S-HpETE) to 15S-hydroxyeicosatetraenoic acid (15S-HETE) (Hill et al. 1989).", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [ "R-ALL-2142707" ], "enzyme_list": [ "P07203-1", "P18283-1", "P36969-1" ], "evidence": [ { "id": "R-HSA-2161791", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2161791" } ] }, { "id": "R-HSA-2161946", "name": "5S-HpETE is reduced to 5S-HETE by GPX1/2/4", "equation": "", "summary": "Glutathione peroxidase 1 (GPX1) (Bryant et al. 1982, Sutherland et al. 2001), 2 (GPX2) (Chu et al. 1993), and 4 (Bryant et al. 1982, Sutherland et al. 2001) reduce 5-hydroperoxyeicosatetraenoic acid (5-HpETE) to 5-hydroxyeicosatetraenoic acid (5-HETE) in the presence of glutathione (GSH). This reaction is inferred from the event in rabbit involving the protein GPX1 (Chiba et al. 1999).", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-266010" ], "output_participant_list": [ "R-ALL-2142733" ], "enzyme_list": [ "P07203-1", "P18283-1", "P36969-1" ], "evidence": [ { "id": "R-HSA-2161946", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2161946" } ] }, { "id": "R-HSA-2161959", "name": "12R-HpETE is reduced to 12R-HETE by GPX1/2/4", "equation": "", "summary": "Glutathione peroxidase 1 (GPX1) (Bryant et al. 1982, Sutherland et al. 2001), 2 (GPX2) (Chu et al. 1993), and 4 (Bryant et al. 1982, Sutherland et al. 2001) are involved in converting 12R-hydroperoxy-eicosatetraenoic acid (12R-HpETE) to 12R-hydro-eicosatetraenoic acid (12R-HETE).", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [ "R-ALL-2142716" ], "enzyme_list": [ "P07203-1", "P18283-1", "P36969-1" ], "evidence": [ { "id": "R-HSA-2161959", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2161959" } ] }, { "id": "R-HSA-2161999", "name": "12S-HpETE is reduced to 12S-HETE by GPX1/2/4", "equation": "", "summary": "Glutathione peroxidase 1 (GPX1) (Bryant et al. 1982, Sutherland et al. 2001), 2 (GPX2) (Chu et al. 1993), and 4 (Bryant et al. 1982, Sutherland et al. 2001) are involved in converting 12S-hydroperoxy-eicosatetraenoic acid (12S-HpETE) to 12S-hydro-eicosatetraenoic acid (12S-HETE). GPXs are selenoenzymes that are responsible for reducing the cellular peroxide. Cellular GPXs compete with hepoxilins A3 (HXA3) synthase for 12S-HpETE as substrate either to produce 12S-HETE or to convert to HXA3, respectively.", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-2142811" ], "output_participant_list": [ "R-ALL-2142678" ], "enzyme_list": [ "P07203-1", "P18283-1", "P36969-1" ], "evidence": [ { "id": "R-HSA-2161999", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2161999" } ] }, { "id": "R-HSA-3323013", "name": "GPX1 catalyzes 2 glutathione, reduced + H2O2 => glutathione, oxidized + 2 H2O", "equation": "", "summary": "Glutathione peroxidase 1 (GPX1) located in the mitochondrial matrix (Bera et al. 2014) uses glutathione to reduce hydrogen peroxide (H2O2) to yield oxidized glutathione and water (Legault et al. 2000, Li et al. 2000, Faucher et al. 2003, Lu et al. 2012). As inferred from rat mitochondria, GPX1 is the major determinant of steady-state hydrogen peroxide levels (Antunes et al. 2002).", "cellular_location": "mitochondrial matrix", "input_participant_list": [ "R-ALL-1655887" ], "output_participant_list": [ "R-ALL-1655882" ], "enzyme_list": [ "P07203-1" ], "evidence": [ { "id": "R-HSA-3323013", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3323013" } ] }, { "id": "R-HSA-71676", "name": "GPX1 catalyzes reaction of reduced glutathione and H2O2 to form oxidized glutathione and H2O", "equation": "", "summary": "Cytosolic glutathione peroxidase (GPX1) tetramer catalyzes the reaction of reduced glutathione and hydrogen peroxide to form reduced glutathione and water (Chu et al. 1993).", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P07203-1" ], "evidence": [ { "id": "R-HSA-71676", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71676" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-1655882", "participant_name": "GSSG [mitochondrial matrix]", "crossref": [ { "id": "C00127", "database": "COMPOUND", "url": "" }, { "id": "58297", "database": "ChEBI", "url": "" }, { "id": "000003870129", "database": "ZINC", "url": "" }, { "id": "C00127", "database": "COMPOUND", "url": "" }, { "id": "000003870129", "database": "ZINC", "url": "" }, { "id": "58297", "database": "ChEBI", "url": "" }, { "id": "58297", "database": "ChEBI", "url": "" }, { "id": "C00127", "database": "COMPOUND", "url": "" }, { "id": "000003870129", "database": "ZINC", "url": "" }, { "id": "58297", "database": "ChEBI", "url": "" }, { "id": "C00127", "database": "COMPOUND", "url": "" }, { "id": "000003870129", "database": "ZINC", "url": "" }, { "id": "C00127", "database": "COMPOUND", "url": "" }, { "id": "58297", "database": "ChEBI", "url": "" }, { "id": "000003870129", "database": "ZINC", "url": "" }, { "id": "C00127", "database": "COMPOUND", "url": "" }, { "id": "58297", "database": "ChEBI", "url": "" }, { "id": "000003870129", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-1655887", "participant_name": "GSH [mitochondrial matrix]", "crossref": [ { "id": "C00051", "database": "COMPOUND", "url": "" }, { "id": "16856", "database": "ChEBI", "url": "" }, { "id": "HMDB0000125", "database": "HMDB Metabolite", "url": "" }, { "id": "11533291", "database": "PubChem Substance", "url": "" }, { "id": "6737", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "000003830891", "database": "ZINC", "url": "" }, { "id": "C00051", "database": "COMPOUND", "url": "" }, { "id": "16856", "database": "ChEBI", "url": "" }, { "id": "HMDB0000125", "database": "HMDB Metabolite", "url": "" }, { "id": "11533291", "database": "PubChem Substance", "url": "" }, { "id": "6737", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "000003830891", "database": "ZINC", "url": "" }, { "id": "C00051", "database": "COMPOUND", "url": "" }, { "id": "16856", "database": "ChEBI", "url": "" }, { "id": "HMDB0000125", "database": "HMDB Metabolite", "url": "" }, { "id": "11533291", "database": "PubChem Substance", "url": "" }, { "id": "6737", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "000003830891", "database": "ZINC", "url": "" }, { "id": "C00051", "database": "COMPOUND", "url": "" }, { "id": "16856", "database": "ChEBI", "url": "" }, { "id": "HMDB0000125", "database": "HMDB Metabolite", "url": "" }, { "id": "11533291", "database": "PubChem Substance", "url": "" }, { "id": "6737", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "000003830891", "database": "ZINC", "url": "" }, { "id": "6737", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C00051", "database": "COMPOUND", "url": "" }, { "id": "HMDB0000125", "database": "HMDB Metabolite", "url": "" }, { "id": "000003830891", "database": "ZINC", "url": "" }, { "id": "11533291", "database": "PubChem Substance", "url": "" }, { "id": "16856", "database": "ChEBI", "url": "" }, { "id": "16856", "database": "ChEBI", "url": "" }, { "id": "11533291", "database": "PubChem Substance", "url": "" }, { "id": "000003830891", "database": "ZINC", "url": "" }, { "id": "HMDB0000125", "database": "HMDB Metabolite", "url": "" }, { "id": "C00051", "database": "COMPOUND", "url": "" }, { "id": "6737", "database": "Guide to Pharmacology - Ligands", "url": "" } ] }, { "participant_id": "R-ALL-2142678", "participant_name": "12S-HETE [cytosol]", "crossref": [ { "id": "34146", "database": "ChEBI", "url": "" }, { "id": "C14777", "database": "COMPOUND", "url": "" }, { "id": "000004655428", "database": "ZINC", "url": "" }, { "id": "HMDB0006111", "database": "HMDB Metabolite", "url": "" }, { "id": "3404", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "34146", "database": "ChEBI", "url": "" }, { "id": "000004655428", "database": "ZINC", "url": "" }, { "id": "3404", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0006111", "database": "HMDB Metabolite", "url": "" }, { "id": "C14777", "database": "COMPOUND", "url": "" }, { "id": "HMDB0006111", "database": "HMDB Metabolite", "url": "" }, { "id": "C14777", "database": "COMPOUND", "url": "" }, { "id": "34146", "database": "ChEBI", "url": "" }, { "id": "000004655428", "database": "ZINC", "url": "" }, { "id": "3404", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "34146", "database": "ChEBI", "url": "" }, { "id": "C14777", "database": "COMPOUND", "url": "" }, { "id": "000004655428", "database": "ZINC", "url": "" }, { "id": "HMDB0006111", "database": "HMDB Metabolite", "url": "" }, { "id": "3404", "database": "Guide to Pharmacology - Ligands", "url": "" } ] }, { "participant_id": "R-ALL-2142707", "participant_name": "15S-HETE [cytosol]", "crossref": [ { "id": "15558", "database": "ChEBI", "url": "" }, { "id": "C04742", "database": "COMPOUND", "url": "" }, { "id": "3401", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0003876", "database": "HMDB Metabolite", "url": "" }, { "id": "000004629861", "database": "ZINC", "url": "" }, { "id": "000004629861", "database": "ZINC", "url": "" }, { "id": "3401", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "15558", "database": "ChEBI", "url": "" }, { "id": "C04742", "database": "COMPOUND", "url": "" }, { "id": "HMDB0003876", "database": "HMDB Metabolite", "url": "" }, { "id": "C04742", "database": "COMPOUND", "url": "" }, { "id": "HMDB0003876", "database": "HMDB Metabolite", "url": "" }, { "id": "000004629861", "database": "ZINC", "url": "" }, { "id": "3401", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "15558", "database": "ChEBI", "url": "" }, { "id": "15558", "database": "ChEBI", "url": "" }, { "id": "C04742", "database": "COMPOUND", "url": "" }, { "id": "3401", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0003876", "database": "HMDB Metabolite", "url": "" }, { "id": "000004629861", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-2142716", "participant_name": "12R-HETE [cytosol]", "crossref": [ { "id": "34144", "database": "ChEBI", "url": "" }, { "id": "000004546442", "database": "ZINC", "url": "" }, { "id": "C14822", "database": "COMPOUND", "url": "" }, { "id": "3405", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "34144", "database": "ChEBI", "url": "" }, { "id": "000004546442", "database": "ZINC", "url": "" }, { "id": "3405", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C14822", "database": "COMPOUND", "url": "" }, { "id": "3405", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "000004546442", "database": "ZINC", "url": "" }, { "id": "34144", "database": "ChEBI", "url": "" }, { "id": "C14822", "database": "COMPOUND", "url": "" }, { "id": "34144", "database": "ChEBI", "url": "" }, { "id": "000004546442", "database": "ZINC", "url": "" }, { "id": "C14822", "database": "COMPOUND", "url": "" }, { "id": "3405", "database": "Guide to Pharmacology - Ligands", "url": "" } ] }, { "participant_id": "R-ALL-2142733", "participant_name": "5S-HETE [cytosol]", "crossref": [ { "id": "HMDB0011134", "database": "HMDB Metabolite", "url": "" }, { "id": "C04805", "database": "COMPOUND", "url": "" }, { "id": "3390", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "000004546338", "database": "ZINC", "url": "" }, { "id": "28209", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-2142811", "participant_name": "12S-HpETE [cytosol]", "crossref": [ { "id": "15626", "database": "ChEBI", "url": "" }, { "id": "2481", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C04820", "database": "COMPOUND", "url": "" }, { "id": "HMDB0004243", "database": "HMDB Metabolite", "url": "" }, { "id": "000008220100", "database": "ZINC", "url": "" }, { "id": "15626", "database": "ChEBI", "url": "" }, { "id": "2481", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C04820", "database": "COMPOUND", "url": "" }, { "id": "HMDB0004243", "database": "HMDB Metabolite", "url": "" }, { "id": "000008220100", "database": "ZINC", "url": "" }, { "id": "15626", "database": "ChEBI", "url": "" }, { "id": "2481", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C04820", "database": "COMPOUND", "url": "" }, { "id": "HMDB0004243", "database": "HMDB Metabolite", "url": "" }, { "id": "000008220100", "database": "ZINC", "url": "" }, { "id": "15626", "database": "ChEBI", "url": "" }, { "id": "2481", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C04820", "database": "COMPOUND", "url": "" }, { "id": "HMDB0004243", "database": "HMDB Metabolite", "url": "" }, { "id": "000008220100", "database": "ZINC", "url": "" }, { "id": "15626", "database": "ChEBI", "url": "" }, { "id": "2481", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C04820", "database": "COMPOUND", "url": "" }, { "id": "HMDB0004243", "database": "HMDB Metabolite", "url": "" }, { "id": "000008220100", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-266010", "participant_name": "5S-HpETE [cytosol]", "crossref": [ { "id": "C05356", "database": "COMPOUND", "url": "" }, { "id": "15632", "database": "ChEBI", "url": "" }, { "id": "000008219830", "database": "ZINC", "url": "" }, { "id": "HMDB0001193", "database": "HMDB Metabolite", "url": "" }, { "id": "2483", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C05356", "database": "COMPOUND", "url": "" }, { "id": "15632", "database": "ChEBI", "url": "" }, { "id": "000008219830", "database": "ZINC", "url": "" }, { "id": "HMDB0001193", "database": "HMDB Metabolite", "url": "" }, { "id": "2483", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C05356", "database": "COMPOUND", "url": "" }, { "id": "15632", "database": "ChEBI", "url": "" }, { "id": "000008219830", "database": "ZINC", "url": "" }, { "id": "HMDB0001193", "database": "HMDB Metabolite", "url": "" }, { "id": "2483", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C05356", "database": "COMPOUND", "url": "" }, { "id": "15632", "database": "ChEBI", "url": "" }, { "id": "000008219830", "database": "ZINC", "url": "" }, { "id": "HMDB0001193", "database": "HMDB Metabolite", "url": "" }, { "id": "2483", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C05356", "database": "COMPOUND", "url": "" }, { "id": "15632", "database": "ChEBI", "url": "" }, { "id": "000008219830", "database": "ZINC", "url": "" }, { "id": "HMDB0001193", "database": "HMDB Metabolite", "url": "" }, { "id": "2483", "database": "Guide to Pharmacology - Ligands", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A2RST1", "gene_name": "Mgst2", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "A2RST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2RST1" } ] }, { "ec_number": "4.4.1.20", "activity": "leukotriene C4 = glutathione + leukotriene A4.", "evidence": [ { "id": "A2RST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2RST1" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "A2RST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2RST1" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A2RST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2RST1" } ] } ] }, { "uniprot_ac": "O14684", "gene_name": "PTGES", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "O14684", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14684" } ] }, { "ec_number": "5.3.99.3", "activity": "prostaglandin H2 = prostaglandin E2.", "evidence": [ { "id": "O14684", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14684" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O14684", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14684" } ] }, { "ec_number": "5.3.99.3", "activity": "", "evidence": [ { "id": "O14684", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14684" } ] } ] }, { "uniprot_ac": "O14880", "gene_name": "MGST3", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "O14880", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14880" } ] }, { "ec_number": "4.4.1.20", "activity": "leukotriene C4 = glutathione + leukotriene A4.", "evidence": [ { "id": "O14880", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14880" } ] }, { "ec_number": "2.5.1.-", "activity": "", "evidence": [ { "id": "O14880", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14880" } ] } ] }, { "uniprot_ac": "O70325", "gene_name": "Gpx4", "activity": [ { "ec_number": "1.11.1.12", "activity": "a hydroperoxy polyunsaturated fatty acid + 2 glutathione = a hydroxy polyunsaturated fatty acid + glutathione disulfide + H2O.", "evidence": [ { "id": "O70325", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70325" } ] }, { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "O70325", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70325" } ] }, { "ec_number": "1.11.1.12", "activity": "", "evidence": [ { "id": "O70325", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70325" } ] } ] }, { "uniprot_ac": "O75715", "gene_name": "GPX5", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "O75715", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75715" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "O75715", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75715" } ] } ] }, { "uniprot_ac": "P00502", "gene_name": "Gsta1", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "P00502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00502" } ] }, { "ec_number": "5.3.3.-", "activity": "", "evidence": [ { "id": "P00502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00502" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P00502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00502" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P00502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00502" } ] } ] }, { "uniprot_ac": "P04041", "gene_name": "Gpx1", "activity": [ { "ec_number": "1.11.1.12", "activity": "a hydroperoxy polyunsaturated fatty acid + 2 glutathione = a hydroxy polyunsaturated fatty acid + glutathione disulfide + H2O.", "evidence": [ { "id": "P04041", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04041" } ] }, { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "P04041", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04041" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "P04041", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04041" } ] } ] }, { "uniprot_ac": "P07203", "gene_name": "GPX1", "activity": [ { "ec_number": "1.11.1.12", "activity": "a hydroperoxy polyunsaturated fatty acid + 2 glutathione = a hydroxy polyunsaturated fatty acid + glutathione disulfide + H2O.", "evidence": [ { "id": "P07203", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07203" } ] }, { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "P07203", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07203" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "P07203", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07203" } ] } ] }, { "uniprot_ac": "P08263", "gene_name": "GSTA1", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "P08263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08263" } ] }, { "ec_number": "5.3.3.-", "activity": "", "evidence": [ { "id": "P08263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08263" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P08263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08263" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P08263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08263" } ] } ] }, { "uniprot_ac": "P11352", "gene_name": "Gpx1", "activity": [ { "ec_number": "1.11.1.12", "activity": "a hydroperoxy polyunsaturated fatty acid + 2 glutathione = a hydroxy polyunsaturated fatty acid + glutathione disulfide + H2O.", "evidence": [ { "id": "P11352", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11352" } ] }, { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "P11352", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11352" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "P11352", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11352" } ] } ] }, { "uniprot_ac": "P13745", "gene_name": "Gsta1", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "P13745", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13745" } ] }, { "ec_number": "5.3.3.-", "activity": "", "evidence": [ { "id": "P13745", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13745" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P13745", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13745" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P13745", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13745" } ] } ] }, { "uniprot_ac": "P17695", "gene_name": "GRX2", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "P17695", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17695" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P17695", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17695" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P17695", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17695" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "P17695", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17695" } ] } ] }, { "uniprot_ac": "P18283", "gene_name": "GPX2", "activity": [ { "ec_number": "1.11.1.12", "activity": "a hydroperoxy polyunsaturated fatty acid + 2 glutathione = a hydroxy polyunsaturated fatty acid + glutathione disulfide + H2O.", "evidence": [ { "id": "P18283", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18283" } ] }, { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "P18283", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18283" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "P18283", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18283" } ] } ] }, { "uniprot_ac": "P21765", "gene_name": "Gpx5", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "P21765", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21765" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "P21765", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21765" } ] } ] }, { "uniprot_ac": "P22352", "gene_name": "GPX3", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "P22352", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22352" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "P22352", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22352" } ] } ] }, { "uniprot_ac": "P23202", "gene_name": "URE2", "activity": [ { "ec_number": "1.8.4.-", "activity": "", "evidence": [ { "id": "P23202", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23202" } ] }, { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "P23202", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23202" } ] } ] }, { "uniprot_ac": "P23764", "gene_name": "Gpx3", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "P23764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23764" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "P23764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23764" } ] } ] }, { "uniprot_ac": "P25373", "gene_name": "GRX1", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "P25373", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25373" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P25373", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25373" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "P25373", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25373" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P25373", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25373" } ] } ] }, { "uniprot_ac": "P30710", "gene_name": "Gpx5", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "P30710", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30710" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "P30710", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30710" } ] } ] }, { "uniprot_ac": "P36014", "gene_name": "GPX1", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "P36014", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36014" } ] }, { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "P36014", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36014" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "P36014", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36014" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "P36014", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36014" } ] } ] }, { "uniprot_ac": "P36969", "gene_name": "GPX4", "activity": [ { "ec_number": "1.11.1.12", "activity": "a hydroperoxy polyunsaturated fatty acid + 2 glutathione = a hydroxy polyunsaturated fatty acid + glutathione disulfide + H2O.", "evidence": [ { "id": "P36969", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36969" } ] }, { "ec_number": "1.11.1.12", "activity": "", "evidence": [ { "id": "P36969", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36969" } ] }, { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "P36969", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36969" } ] } ] }, { "uniprot_ac": "P36970", "gene_name": "Gpx4", "activity": [ { "ec_number": "1.11.1.12", "activity": "a hydroperoxy polyunsaturated fatty acid + 2 glutathione = a hydroxy polyunsaturated fatty acid + glutathione disulfide + H2O.", "evidence": [ { "id": "P36970", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36970" } ] }, { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "P36970", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36970" } ] }, { "ec_number": "1.11.1.12", "activity": "", "evidence": [ { "id": "P36970", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36970" } ] } ] }, { "uniprot_ac": "P46412", "gene_name": "Gpx3", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "P46412", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46412" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "P46412", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46412" } ] } ] }, { "uniprot_ac": "P59796", "gene_name": "GPX6", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "P59796", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P59796" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "P59796", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P59796" } ] } ] }, { "uniprot_ac": "P83645", "gene_name": "Gpx2", "activity": [ { "ec_number": "1.11.1.12", "activity": "a hydroperoxy polyunsaturated fatty acid + 2 glutathione = a hydroxy polyunsaturated fatty acid + glutathione disulfide + H2O.", "evidence": [ { "id": "P83645", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83645" } ] }, { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "P83645", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83645" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "P83645", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P83645" } ] } ] }, { "uniprot_ac": "Q64625", "gene_name": "Gpx6", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "Q64625", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64625" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "Q64625", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64625" } ] } ] }, { "uniprot_ac": "Q8TED1", "gene_name": "GPX8", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "Q8TED1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TED1" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "Q8TED1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TED1" } ] } ] }, { "uniprot_ac": "Q91WR8", "gene_name": "Gpx6", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "Q91WR8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91WR8" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "Q91WR8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91WR8" } ] } ] }, { "uniprot_ac": "Q96SL4", "gene_name": "GPX7", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "Q96SL4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96SL4" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "Q96SL4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96SL4" } ] } ] }, { "uniprot_ac": "Q99735", "gene_name": "MGST2", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "Q99735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99735" } ] }, { "ec_number": "4.4.1.20", "activity": "leukotriene C4 = glutathione + leukotriene A4.", "evidence": [ { "id": "Q99735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99735" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q99735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99735" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q99735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99735" } ] } ] }, { "uniprot_ac": "Q99LJ6", "gene_name": "Gpx7", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "Q99LJ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LJ6" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "Q99LJ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LJ6" } ] } ] }, { "uniprot_ac": "Q9CPU4", "gene_name": "Mgst3", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "Q9CPU4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CPU4" } ] }, { "ec_number": "4.4.1.20", "activity": "leukotriene C4 = glutathione + leukotriene A4.", "evidence": [ { "id": "Q9CPU4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CPU4" } ] }, { "ec_number": "2.5.1.-", "activity": "", "evidence": [ { "id": "Q9CPU4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CPU4" } ] } ] }, { "uniprot_ac": "Q9D7B7", "gene_name": "Gpx8", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "Q9D7B7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D7B7" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "Q9D7B7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D7B7" } ] } ] }, { "uniprot_ac": "Q9JHC0", "gene_name": "Gpx2", "activity": [ { "ec_number": "1.11.1.12", "activity": "a hydroperoxy polyunsaturated fatty acid + 2 glutathione = a hydroxy polyunsaturated fatty acid + glutathione disulfide + H2O.", "evidence": [ { "id": "Q9JHC0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHC0" } ] }, { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "Q9JHC0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHC0" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "Q9JHC0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHC0" } ] } ] }, { "uniprot_ac": "Q9JHF3", "gene_name": "Ptges", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "Q9JHF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHF3" } ] }, { "ec_number": "5.3.99.3", "activity": "prostaglandin H2 = prostaglandin E2.", "evidence": [ { "id": "Q9JHF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHF3" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9JHF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHF3" } ] }, { "ec_number": "5.3.99.3", "activity": "", "evidence": [ { "id": "Q9JHF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHF3" } ] } ] }, { "uniprot_ac": "Q9JM51", "gene_name": "Ptges", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "Q9JM51", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JM51" } ] }, { "ec_number": "5.3.99.3", "activity": "prostaglandin H2 = prostaglandin E2.", "evidence": [ { "id": "Q9JM51", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JM51" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9JM51", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JM51" } ] }, { "ec_number": "5.3.99.3", "activity": "", "evidence": [ { "id": "Q9JM51", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JM51" } ] } ] } ], "biomarkers": [ { "assessed_biomarker_entity": "Glutathione peroxidase 1 (GPX1)", "biomarker_id": "A0382", "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "31844035", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31844035" } ], "instances": [ { "best_biomarker_type": "diagnostic", "status": "increased GPX1 level", "disease": { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] }, "tissue": { "name": "kidney", "namespace": "UBERON", "id": "0002113", "url": "http://purl.obolibrary.org/obo/UBERON_0002113" }, "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "31844035", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31844035" } ] } ] } ], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [ 159 ], "glycation_sites": [], "phosphorylation_sites": [ 34, 98, 197, 201 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 119 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }