{ "uniprot_canonical_ac": "P07099-1", "uniprot_ac": "P07099", "uniprot_id": "HYEP_HUMAN", "mass": { "chemical_mass": 52949.0, "monoisotopic_mass": 52949.0 }, "refseq": { "ac": "NP_000111", "name": "epoxide hydrolase 1 isoform a", "summary": "Epoxide hydrolase is a critical biotransformation enzyme that converts epoxides from the degradation of aromatic compounds to trans-dihydrodiols which can be conjugated and excreted from the body. Epoxide hydrolase functions in both the activation and detoxification of epoxides. Mutations in this gene cause preeclampsia, epoxide hydrolase deficiency or increased epoxide hydrolase activity. Alternatively spliced transcript variants encoding the same protein have been found for this gene.[provided by RefSeq, Dec 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000111" }, "gene_names": [ { "name": "EPHX1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P07099", "id": "P07099" }, { "name": "EPHX1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000111", "id": "NP_000111" }, { "name": "EPHX; EPOX; HYL1; MEH", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000111", "id": "NP_000111" }, { "name": "EPHX", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P07099", "id": "P07099" }, { "name": "EPOX", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P07099", "id": "P07099" } ], "protein_names": [ { "name": "Epoxide hydrolase 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P07099" }, { "name": "3.3.2.9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07099" }, { "name": "Epoxide hydratase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07099" }, { "name": "Microsomal epoxide hydrolase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07099" }, { "name": "epoxide hydratase; epoxide hydrolase 1 microsomal; epoxide hydrolase 1, microsomal (xenobiotic)", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000111", "id": "NP_000111" }, { "name": "epoxide hydrolase 1 isoform a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000111", "id": "NP_000111" }, { "name": "mEH", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P07099" } ], "function": [ { "annotation": "ABCB1 c.3435C > T and EPHX1 c.416A > G polymorphisms influence plasma carbamazepine concentration, metabolism, and pharmacoresistance in epileptic patients. Review article", "evidence": [ { "database": "RefSeq", "id": "NP_000111", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000111" }, { "database": "PubMed", "id": "34411648", "url": "https://glygen.org/publication/PubMed/34411648" } ] }, { "annotation": "Biotransformation enzyme that catalyzes the hydrolysis of arene and aliphatic epoxides to less reactive and more water soluble dihydrodiols by the trans addition of water (By similarity). Plays a role in the metabolism of endogenous lipids such as epoxide-containing fatty acids (PubMed:22798687). Metabolizes the abundant endocannabinoid 2-arachidonoylglycerol (2-AG) to free arachidonic acid (AA) and glycerol (PubMed:24958911).", "evidence": [ { "database": "UniProtKB", "id": "P07099", "url": "https://www.uniprot.org/uniprot/P07099#function" }, { "database": "UniProtKB", "id": "P07687", "url": "https://www.uniprot.org/uniprot/P07687#function" }, { "database": "PubMed", "id": "22798687", "url": "https://glygen.org/publication/PubMed/22798687" }, { "database": "PubMed", "id": "24958911", "url": "https://glygen.org/publication/PubMed/24958911" } ] }, { "annotation": "EPHX1 transcript, termed E1-b', drives EPHX1 expression primarily in the ovary.", "evidence": [ { "database": "RefSeq", "id": "NP_000111", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000111" }, { "database": "PubMed", "id": "23564882", "url": "https://glygen.org/publication/PubMed/23564882" } ] }, { "annotation": "EPOXID HYDROLASE SINGLE GENE POLYMORPHISM (RS1051740) AND SEVERITY OF CHRONIC OBSTRUCTIVE DISEASE.", "evidence": [ { "database": "RefSeq", "id": "NP_000111", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000111" }, { "database": "PubMed", "id": "36591768", "url": "https://glygen.org/publication/PubMed/36591768" } ] }, { "annotation": "Epoxide hydrolase is a critical biotransformation enzyme that converts epoxides from the degradation of aromatic compounds to trans-dihydrodiols which can be conjugated and excreted from the body. Epoxide hydrolase functions in both the activation and detoxification of epoxides. Mutations in this gene cause preeclampsia, epoxide hydrolase deficiency or increased epoxide hydrolase activity. Alternatively spliced transcript variants encoding the same protein have been found for this gene.[provided by RefSeq, Dec 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_000111", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000111" } ] }, { "annotation": "Genetic polymorphisms in the mEH gene in relation to tobacco smoking: role in lung cancer susceptibility and survival in north Indian patients with lung cancer undergoing platinum-based chemotherapy.", "evidence": [ { "database": "RefSeq", "id": "NP_000111", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000111" }, { "database": "PubMed", "id": "34672683", "url": "https://glygen.org/publication/PubMed/34672683" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "P07099", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07099" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 113, "end_pos": 113, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "Y", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: Lit. mined (18).", "chr_id": "1", "chr_pos": "225831932", "ref_nt": "T", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "Y113", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "94.41", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000143819", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143819" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "91.69", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000143819", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143819" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "94.62", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000143819", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143819" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "93.87", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000143819", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143819" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "98.81", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000143819", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143819" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "96.04", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000143819", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143819" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "94.04", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000143819", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143819" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "97.53", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000143819", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143819" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "98.02", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000143819", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143819" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "98.18", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000143819", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143819" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "99.37", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000143819", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143819" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "98.17", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000143819", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143819" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "96.56", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000143819", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143819" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P07099", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07099" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P07099", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07099" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P07099", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07099" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P07099", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07099" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P07099", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07099" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P07099", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07099" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P07099", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07099" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P07099", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07099" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P07099", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07099" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P07099", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07099" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P07099", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07099" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P07099", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P07099" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P07099", "url": "https://www.uniprot.org/uniprot/P07099" } ], "common_name": "Human" } ], "gene": [ { "name": "EPHX1", "url": "https://www.uniprot.org/uniprot/P07099", "locus": { "chromosome": "1", "start_pos": 225845563, "end_pos": 225810124, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000143819", "url": "https://www.ensembl.org/id/ENSG00000143819" } ] } } ], "crossref": [ { "id": "ENSG00000143819", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143819", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P07099", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P07099", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "3.3.2.9", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.3.2.9&UniProtAcc=P07099", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "CHEMBL1968", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1968", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "EPHX1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=EPHX1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "2052", "url": "https://www.ncbi.nlm.nih.gov/gene/2052", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "3401", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=3401", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P07099", "url": "https://www.ebi.ac.uk/intact/interactors/id:P07099*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000073", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000073", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000639", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000639", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR010497", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010497", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016292", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016292", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029058", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029058", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:2052", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2052", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "132810", "url": "http://www.omim.org/entry/132810", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P07099", "url": "https://www.nextprot.org/entry/NX_P07099", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P07099", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07099", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "LYIHKPF", "url": "https://omabrowser.org/oma/group/LYIHKPF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5472392at2759", "url": "http://www.orthodb.org/?query=5472392at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR21661", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21661", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR21661:SF78", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21661:SF78", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00561", "url": "http://pfam.xfam.org/family/PF00561", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF06441", "url": "http://pfam.xfam.org/family/PF06441", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P07099", "url": "https://pharos.nih.gov/targets/P07099", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P07099", "url": "http://purl.obolibrary.org/obo/PR_P07099", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000111", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000111", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "23900", "url": "https://www.rhea-db.org/rhea/23900", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "26132", "url": "https://www.rhea-db.org/rhea/26132", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "44044", "url": "https://www.rhea-db.org/rhea/44044", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "44048", "url": "https://www.rhea-db.org/rhea/44048", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "55764", "url": "https://www.rhea-db.org/rhea/55764", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "B1AQP8", "url": "https://www.uniprot.org/uniprot/B1AQP8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B1AQP8-1", "url": "https://www.uniprot.org/uniprot/B1AQP8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07099", "url": "https://www.uniprot.org/uniprot/P07099", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P07099-1", "url": "https://www.uniprot.org/uniprot/P07099-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MWLEILLTSVLGFAIYWFISRDKEETLPLEDGWWGPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYGFNSNYLKKVISYWRNEFDWKKQVEILNRYPHFKTKIEGLDIHFIHVKPPQLPAGHTPKPLLMVHGWPGSFYEFYKIIPLLTDPKNHGLSDEHVFEVICPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLICTNMAQLVPSHVKGLHLNMALVLSNFSTLTLLLGQRFGRFLGLTERDVELLYPVKEKVFYSLMRESGYMHIQCTKPDTVGSALNDSPVGLAAYILEKFSTWTNTEFRYLEDGGLERKFSLDDLLTNVMLYWTTGTIISSQRFYKENLGQGWMTQKHERMKVYVPTGFSAFPFELLHTPEKWVRFKYPKLISYSYMVRGGHFAAFEEPELLAQDIRKFLSVLERQ", "length": 455, "header": "sp|P07099-1|HYEP_HUMAN Isoform 1 of Epoxide hydrolase 1 OS=Homo sapiens OX=9606 GN=EPHX1 PE=1 SV=1 CANONICAL=P07099-1" }, "isoforms": [ { "isoform_ac": "B1AQP8-1", "url": "", "sequence": { "sequence": "MWLEILLTSVLGFAIYWFISRDKEETLPLEDGWWGPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYGFNSNYLKKVISYWRNEFDWKKQVEILNRYPHFKTKIEGLDIHFIHVKPPQLP", "length": 136, "header": "tr|B1AQP8-1|HYEP_HUMAN Computationally mapped isoform of Epoxide hydrolase 1 OS=Homo sapiens OX=9606 GN=EPHX1 PE=1 SV=1 CANONICAL=P07099-1" }, "locus": { "chromosome": "1", "start_pos": 225838697, "end_pos": 225828730, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000448202.5", "url": "https://www.ensembl.org/id/ENST00000448202.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000408469.1", "url": "https://www.ensembl.org/id/ENSP00000408469.1" } ] } }, { "isoform_ac": "P07099-1", "url": "", "sequence": { "sequence": "MWLEILLTSVLGFAIYWFISRDKEETLPLEDGWWGPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYGFNSNYLKKVISYWRNEFDWKKQVEILNRYPHFKTKIEGLDIHFIHVKPPQLPAGHTPKPLLMVHGWPGSFYEFYKIIPLLTDPKNHGLSDEHVFEVICPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLICTNMAQLVPSHVKGLHLNMALVLSNFSTLTLLLGQRFGRFLGLTERDVELLYPVKEKVFYSLMRESGYMHIQCTKPDTVGSALNDSPVGLAAYILEKFSTWTNTEFRYLEDGGLERKFSLDDLLTNVMLYWTTGTIISSQRFYKENLGQGWMTQKHERMKVYVPTGFSAFPFELLHTPEKWVRFKYPKLISYSYMVRGGHFAAFEEPELLAQDIRKFLSVLERQ", "length": 455, "header": "sp|P07099-1|HYEP_HUMAN Isoform 1 of Epoxide hydrolase 1 OS=Homo sapiens OX=9606 GN=EPHX1 PE=1 SV=1 CANONICAL=P07099-1" }, "locus": { "chromosome": "1", "start_pos": 225845344, "end_pos": 225828730, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000272167.10", "url": "https://www.ensembl.org/id/ENST00000272167.10" }, { "database": "Ensembl Peptide", "id": "ENSP00000272167.5", "url": "https://www.ensembl.org/id/ENSP00000272167.5" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P07099", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07099" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" } ] } ], "phosphorylation": [ { "start_pos": 422, "end_pos": 422, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07099", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07099" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser422" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Nefazodone, meta-chlorophenylpiperazine, and their metabolites in vitro: cytochromes mediating transformation, and P450-3A4 inhibitory actions.", "journal": "Psychopharmacology", "date": "1999", "authors": "von Moltke LL, Greenblatt DJ, Granda BW, Grassi JM, Schmider J, Harmatz JS, Shader RI", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "10445380", "url": "https://glygen.org/publication/PubMed/10445380" } ] }, { "title": "Bioactivation of 5-(aziridin-1-yl)-2,4-dinitrobenzamide (CB 1954) by human NAD(P)H quinone oxidoreductase 2: a novel co-substrate-mediated antitumor prodrug therapy.", "journal": "Cancer research", "date": "2000", "authors": "Knox RJ, Jenkins TC, Hobbs SM, Chen S, Melton RG, Burke PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "10945627", "url": "https://glygen.org/publication/PubMed/10945627" } ] }, { "title": "Identification of 6 new polymorphisms, g.11177G>A, g.14622C>T (R49C), g.17540T>C, g.17639T>C, g.30929T>C, g.31074G>A (R454Q), in the human microsomal epoxide hydrolase gene (EPHX1) in a French population.", "journal": "Human mutation", "date": "2000", "authors": "Belmahdi F, Chevalier D, Lo-Guidice JM, Allorge D, Cauffiez C, Lafitte JJ, Broly F", "evidence": [ { "database": "UniProtKB", "id": "P07099", "url": "https://www.uniprot.org/uniprot/P07099" } ], "reference": [ { "type": "PubMed", "id": "11058921", "url": "https://glygen.org/publication/PubMed/11058921" } ] }, { "title": "Epoxide hydrolases: biochemistry and molecular biology.", "journal": "Chemico-biological interactions", "date": "2000", "authors": "Fretland AJ, Omiecinski CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "11154734", "url": "https://glygen.org/publication/PubMed/11154734" } ] }, { "title": "The microsomal epoxide hydrolase Tyr113His polymorphism: association with risk of ovarian cancer.", "journal": "Molecular carcinogenesis", "date": "2001", "authors": "Spurdle AB, Purdie DM, Webb PM, Chen X, Green A, Chenevix-Trench G", "evidence": [ { "database": "Entrez", "id": "2052", "url": "https://www.ncbi.nlm.nih.gov/gene/2052" } ], "reference": [ { "type": "PubMed", "id": "11255266", "url": "https://glygen.org/publication/PubMed/11255266" } ] }, { "title": "Inhibitory effects of verapamil and diltiazem on simvastatin metabolism in human liver microsomes.", "journal": "British journal of clinical pharmacology", "date": "2001", "authors": "Yeo KR, Yeo WW", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "11422004", "url": "https://glygen.org/publication/PubMed/11422004" } ] }, { "title": "Two exonic single nucleotide polymorphisms in the microsomal epoxide hydrolase gene are jointly associated with preeclampsia.", "journal": "European journal of human genetics : EJHG", "date": "2002", "authors": "Laasanen J, Romppanen EL, Hiltunen M, Helisalmi S, Mannermaa A, Punnonen K, Heinonen S", "evidence": [ { "database": "UniProtKB", "id": "P07099", "url": "https://www.uniprot.org/uniprot/P07099" } ], "reference": [ { "type": "PubMed", "id": "12173035", "url": "https://glygen.org/publication/PubMed/12173035" } ] }, { "title": "Crystal structure of human carboxylesterase 1 complexed with the Alzheimer's drug tacrine: from binding promiscuity to selective inhibition.", "journal": "Chemistry & biology", "date": "2003", "authors": "Bencharit S, Morton CL, Hyatt JL, Kuhn P, Danks MK, Potter PM, Redinbo MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "12725862", "url": "https://glygen.org/publication/PubMed/12725862" } ] }, { "title": "Identification of a human valacyclovirase: biphenyl hydrolase-like protein as valacyclovir hydrolase.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Kim I, Chu XY, Kim S, Provoda CJ, Lee KD, Amidon GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "12732646", "url": "https://glygen.org/publication/PubMed/12732646" } ] }, { "title": "Inhibition of human m-epoxide hydrolase gene expression in a case of hypercholanemia.", "journal": "Biochim. Biophys. Acta", "date": "2003", "authors": "Zhu Qin-shi, Xing Wenxue, Qian Bin, von Dippe Patricia, Shneider Benjamin L, Fox Victor L, Levy Daniel", "evidence": [ { "database": "UniProtKB", "id": "P07099", "url": "https://www.uniprot.org/uniprot/P07099" } ], "reference": [ { "type": "PubMed", "id": "12878321", "url": "https://glygen.org/publication/PubMed/12878321" } ] }, { "title": "Wine, alcohol, platelets, and the French paradox for coronary heart disease.", "journal": "Lancet (London, England)", "date": "1992", "authors": "Renaud S, de Lorgeril M", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "1351198", "url": "https://glygen.org/publication/PubMed/1351198" } ] }, { "title": "Epoxide hydrolase Tyr113His polymorphism is not associated with susceptibility to esophageal squamous cell carcinoma in population of North China.", "journal": "World journal of gastroenterology", "date": "2003", "authors": "Zhang JH, Jin X, Li Y, Wang R, Guo W, Wang N, Wen DG, Chen ZF, Kuang G, Wei LZ, Wang SJ", "evidence": [ { "database": "Entrez", "id": "2052", "url": "https://www.ncbi.nlm.nih.gov/gene/2052" } ], "reference": [ { "type": "PubMed", "id": "14669306", "url": "https://glygen.org/publication/PubMed/14669306" } ] }, { "title": "Crystal structure of quinone reductase 2 in complex with resveratrol.", "journal": "Biochemistry", "date": "2004", "authors": "Buryanovskyy L, Fu Y, Boyd M, Ma Y, Hsieh TC, Wu JM, Zhang Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "15350128", "url": "https://glygen.org/publication/PubMed/15350128" } ] }, { "title": "Cardiovascular protective effects of resveratrol.", "journal": "Cardiovascular drug reviews", "date": "2004", "authors": "Bradamante S, Barenghi L, Villa A", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "15492766", "url": "https://glygen.org/publication/PubMed/15492766" } ] }, { "title": "Mechanism-based inactivation of CYP3A by HIV protease inhibitors.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2005", "authors": "Ernest CS 2nd, Hall SD, Jones DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "15523003", "url": "https://glygen.org/publication/PubMed/15523003" } ] }, { "title": "Functional analysis of human microsomal epoxide hydrolase genetic variants.", "journal": "Chemico-biological interactions", "date": "2004", "authors": "Hosagrahara VP, Rettie AE, Hassett C, Omiecinski CJ", "evidence": [ { "database": "UniProtKB", "id": "P07099", "url": "https://www.uniprot.org/uniprot/P07099" }, { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "15535985", "url": "https://glygen.org/publication/PubMed/15535985" } ] }, { "title": "Five novel single nucleotide polymorphisms in the EPHX1 gene encoding microsomal epoxide hydrolase.", "journal": "Drug Metab. Pharmacokinet.", "date": "2003", "authors": "Shiseki Kisho, Itoda Masaya, Saito Yoshiro, Nakajima Yukiko, Maekawa Keiko, Kimura Hideo, Goto Yu-ichi, Saitoh Osamu, Katoh Masaaki, Ohnuma Teiichi, Kawai Mitsuru, Sugai Kenji, Ohtsuki Taisuke, Suzuki Chieko, Minami Narihiro, Ozawa Shogo, Sawada Jun-ichi", "evidence": [ { "database": "UniProtKB", "id": "P07099", "url": "https://www.uniprot.org/uniprot/P07099" } ], "reference": [ { "type": "PubMed", "id": "15618730", "url": "https://glygen.org/publication/PubMed/15618730" } ] }, { "title": "EPHX1 gene polymorphisms and individual susceptibility to lung cancer.", "journal": "Cancer letters", "date": "2006", "authors": "Voho A, Metsola K, Anttila S, Impivaara O, Jarvisalo J, Vainio H, Husgafvel-Pursiainen K, Hirvonen A", "evidence": [ { "database": "Entrez", "id": "2052", "url": "https://www.ncbi.nlm.nih.gov/gene/2052" } ], "reference": [ { "type": "PubMed", "id": "16005144", "url": "https://glygen.org/publication/PubMed/16005144" } ] }, { "title": "RNAi-mediated knockdown of aldehyde dehydrogenase class-1A1 and class-3A1 is specific and reveals that each contributes equally to the resistance against 4-hydroperoxycyclophosphamide.", "journal": "Cancer chemotherapy and pharmacology", "date": "2007", "authors": "Moreb JS, Mohuczy D, Ostmark B, Zucali JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "16614850", "url": "https://glygen.org/publication/PubMed/16614850" } ] }, { "title": "NRH:quinone oxidoreductase 2 (NQO2) catalyzes metabolic activation of quinones and anti-tumor drugs.", "journal": "Biochemical pharmacology", "date": "2006", "authors": "Celli CM, Tran N, Knox R, Jaiswal AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "16765324", "url": "https://glygen.org/publication/PubMed/16765324" } ] }, { "title": "Adipogenesis-related increase of semicarbazide-sensitive amine oxidase and monoamine oxidase in human adipocytes.", "journal": "Biochimie", "date": "2007", "authors": "Bour S, Daviaud D, Gres S, Lefort C, Prevot D, Zorzano A, Wabitsch M, Saulnier-Blache JS, Valet P, Carpene C", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "17400359", "url": "https://glygen.org/publication/PubMed/17400359" } ] }, { "title": "SNPs of GSTM1, T1, P1, epoxide hydrolase and DNA repair enzyme XRCC1 and risk of urinary transitional cell carcinoma in southwestern Taiwan.", "journal": "Toxicology and applied pharmacology", "date": "2008", "authors": "Hsu LI, Chiu AW, Huan SK, Chen CL, Wang YH, Hsieh FI, Chou WL, Wang LH, Chen CJ", "evidence": [ { "database": "Entrez", "id": "2052", "url": "https://www.ncbi.nlm.nih.gov/gene/2052" } ], "reference": [ { "type": "PubMed", "id": "18199464", "url": "https://glygen.org/publication/PubMed/18199464" } ] }, { "title": "Kinetic, thermodynamic and X-ray structural insights into the interaction of melatonin and analogues with quinone reductase 2.", "journal": "The Biochemical journal", "date": "2008", "authors": "Calamini B, Santarsiero BD, Boutin JA, Mesecar AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "18254726", "url": "https://glygen.org/publication/PubMed/18254726" } ] }, { "title": "Molecular basis of prodrug activation by human valacyclovirase, an alpha-amino acid ester hydrolase.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Lai L, Xu Z, Zhou J, Lee KD, Amidon GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "18256025", "url": "https://glygen.org/publication/PubMed/18256025" } ] }, { "title": "A comprehensive analysis of phase I and phase II metabolism gene polymorphisms and risk of non-small cell lung cancer in smokers.", "journal": "Carcinogenesis", "date": "2008", "authors": "Zienolddiny S, Campa D, Lind H, Ryberg D, Skaug V, Stangeland LB, Canzian F, Haugen A", "evidence": [ { "database": "Entrez", "id": "2052", "url": "https://www.ncbi.nlm.nih.gov/gene/2052" } ], "reference": [ { "type": "PubMed", "id": "18258609", "url": "https://glygen.org/publication/PubMed/18258609" } ] }, { "title": "Rapid clinical induction of hepatic cytochrome P4502B6 activity by ritonavir.", "journal": "Antimicrobial agents and chemotherapy", "date": "2008", "authors": "Kharasch ED, Mitchell D, Coles R, Blanco R", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "18285471", "url": "https://glygen.org/publication/PubMed/18285471" } ] }, { "title": "Microsomal epoxide hydrolase (EPHX1), slow (exon 3, 113His) and fast (exon 4, 139Arg) alleles confer susceptibility to squamous cell esophageal cancer.", "journal": "Toxicology and applied pharmacology", "date": "2008", "authors": "Jain M, Tilak AR, Upadhyay R, Kumar A, Mittal B", "evidence": [ { "database": "Entrez", "id": "2052", "url": "https://www.ncbi.nlm.nih.gov/gene/2052" } ], "reference": [ { "type": "PubMed", "id": "18406439", "url": "https://glygen.org/publication/PubMed/18406439" } ] }, { "title": "The fourth molybdenum containing enzyme mARC: cloning and involvement in the activation of N-hydroxylated prodrugs.", "journal": "Journal of medicinal chemistry", "date": "2008", "authors": "Gruenewald S, Wahl B, Bittner F, Hungeling H, Kanzow S, Kotthaus J, Schwering U, Mendel RR, Clement B", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "19053771", "url": "https://glygen.org/publication/PubMed/19053771" } ] }, { "title": "The unique substrate specificity of human AOC2, a semicarbazide-sensitive amine oxidase.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2009", "authors": "Kaitaniemi S, Elovaara H, Gron K, Kidron H, Liukkonen J, Salminen T, Salmi M, Jalkanen S, Elima K", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "19588076", "url": "https://glygen.org/publication/PubMed/19588076" } ] }, { "title": "Structure and inhibition of human diamine oxidase.", "journal": "Biochemistry", "date": "2009", "authors": "McGrath AP, Hilmer KM, Collyer CA, Shepard EM, Elmore BO, Brown DE, Dooley DM, Guss JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "19764817", "url": "https://glygen.org/publication/PubMed/19764817" } ] }, { "title": "Naturally occurring variants of human CBR3 alter anthracycline in vitro metabolism.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2010", "authors": "Bains OS, Karkling MJ, Lubieniecka JM, Grigliatti TA, Reid RE, Riggs KW", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "20007405", "url": "https://glygen.org/publication/PubMed/20007405" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P07099", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07099" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Human carboxymethylenebutenolidase as a bioactivating hydrolase of olmesartan medoxomil in liver and intestine.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Ishizuka T, Fujimori I, Kato M, Noji-Sakikawa C, Saito M, Yoshigae Y, Kubota K, Kurihara A, Izumi T, Ikeda T, Okazaki O", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "20177059", "url": "https://glygen.org/publication/PubMed/20177059" } ] }, { "title": "Mammalian carboxylesterase 3: comparative genomics and proteomics.", "journal": "Genetica", "date": "2010", "authors": "Holmes RS, Cox LA, VandeBerg JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "20422440", "url": "https://glygen.org/publication/PubMed/20422440" } ] }, { "title": "Arylacetamide deacetylase is a determinant enzyme for the difference in hydrolase activities of phenacetin and acetaminophen.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2010", "authors": "Watanabe A, Fukami T, Takahashi S, Kobayashi Y, Nakagawa N, Nakajima M, Yokoi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "20542992", "url": "https://glygen.org/publication/PubMed/20542992" } ] }, { "title": "Polymorphisms in the microsomal epoxide hydrolase gene: role in lung cancer susceptibility and prognosis.", "journal": "Tumori", "date": "2010", "authors": "Erkisi Z, Yaylim-Eraltan I, Turna A, Gormus U, Camlica H, Isbir T", "evidence": [ { "database": "Entrez", "id": "2052", "url": "https://www.ncbi.nlm.nih.gov/gene/2052" } ], "reference": [ { "type": "PubMed", "id": "21302624", "url": "https://glygen.org/publication/PubMed/21302624" } ] }, { "title": "Investigation of a possible relationship between EPHX1 gene polymorphisms and colorectal cancer in Turkish society.", "journal": "Genetic testing and molecular biomarkers", "date": "2012", "authors": "Sahin O, Arikan S, Oltulu YM, Coskunpinar E, Eren A, Cacina C, Guler E, Yaylim I", "evidence": [ { "database": "Entrez", "id": "2052", "url": "https://www.ncbi.nlm.nih.gov/gene/2052" } ], "reference": [ { "type": "PubMed", "id": "22352736", "url": "https://glygen.org/publication/PubMed/22352736" } ] }, { "title": "Identification of a novel intracellular cholesteryl ester hydrolase (carboxylesterase 3) in human macrophages: compensatory increase in its expression after carboxylesterase 1 silencing.", "journal": "American journal of physiology. Cell physiology", "date": "2012", "authors": "Zhao B, Bie J, Wang J, Marqueen SA, Ghosh S", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "22700792", "url": "https://glygen.org/publication/PubMed/22700792" } ] }, { "title": "EH3 (ABHD9): the first member of a new epoxide hydrolase family with high activity for fatty acid epoxides.", "journal": "Journal of lipid research", "date": "2012", "authors": "Decker M, Adamska M, Cronin A, Di Giallonardo F, Burgener J, Marowsky A, Falck JR, Morisseau C, Hammock BD, Gruzdev A, Zeldin DC, Arand M", "evidence": [ { "database": "UniProtKB", "id": "P07099", "url": "https://www.uniprot.org/uniprot/P07099" } ], "reference": [ { "type": "PubMed", "id": "22798687", "url": "https://glygen.org/publication/PubMed/22798687" } ] }, { "title": "The emerging role of human esterases.", "journal": "Drug metabolism and pharmacokinetics", "date": "2012", "authors": "Fukami T, Yokoi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "22813719", "url": "https://glygen.org/publication/PubMed/22813719" } ] }, { "title": "Expression of a novel mRNA transcript for human microsomal epoxide hydrolase (EPHX1) is regulated by short open reading frames within its 5'-untranslated region.", "journal": "RNA (New York, N.Y.)", "date": "2013", "authors": "Nguyen HL, Yang X, Omiecinski CJ", "evidence": [ { "database": "RefSeq", "id": "NP_000111", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000111" } ], "reference": [ { "type": "PubMed", "id": "23564882", "url": "https://glygen.org/publication/PubMed/23564882" } ] }, { "title": "Cobicistat, a pharmacoenhancer for HIV treatments.", "journal": "Drugs of today (Barcelona, Spain : 1998)", "date": "2013", "authors": "Temesgen Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "23616950", "url": "https://glygen.org/publication/PubMed/23616950" } ] }, { "title": "Association between microsomal epoxide hydrolase 1 polymorphisms and susceptibility to esophageal cancer: a meta-analysis.", "journal": "Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine", "date": "2013", "authors": "Zhao W, Luo J, Cai X", "evidence": [ { "database": "Entrez", "id": "2052", "url": "https://www.ncbi.nlm.nih.gov/gene/2052" } ], "reference": [ { "type": "PubMed", "id": "23681797", "url": "https://glygen.org/publication/PubMed/23681797" } ] }, { "title": "Design, synthesis, biological and structural evaluation of functionalized resveratrol analogues as inhibitors of quinone reductase 2.", "journal": "Bioorganic & medicinal chemistry", "date": "2013", "authors": "St John SE, Jensen KC, Kang S, Chen Y, Calamini B, Mesecar AD, Lipton MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "23953689", "url": "https://glygen.org/publication/PubMed/23953689" } ] }, { "title": "Meta-analysis demonstrates lack of an association of microsomal epoxide hydrolase 1 polymorphisms with esophageal cancer risk.", "journal": "Genetics and molecular research : GMR", "date": "2013", "authors": "Hu JJ, Wang ZT, Li B", "evidence": [ { "database": "Entrez", "id": "2052", "url": "https://www.ncbi.nlm.nih.gov/gene/2052" } ], "reference": [ { "type": "PubMed", "id": "24222229", "url": "https://glygen.org/publication/PubMed/24222229" } ] }, { "title": "Functional characterization of protein variants encoded by nonsynonymous single nucleotide polymorphisms in MARC1 and MARC2 in healthy Caucasians.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2014", "authors": "Ott G, Reichmann D, Boerger C, Cascorbi I, Bittner F, Mendel RR, Kunze T, Clement B, Havemeyer A", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "24423752", "url": "https://glygen.org/publication/PubMed/24423752" } ] }, { "title": "EPHX1 Tyr113His and His139Arg polymorphisms in esophageal cancer risk: a meta-analysis.", "journal": "Genetics and molecular research : GMR", "date": "2014", "authors": "Tan X, He WW, Wang YY, Shi LJ, Chen MW", "evidence": [ { "database": "Entrez", "id": "2052", "url": "https://www.ncbi.nlm.nih.gov/gene/2052" } ], "reference": [ { "type": "PubMed", "id": "24615030", "url": "https://glygen.org/publication/PubMed/24615030" } ] }, { "title": "Development of selective inhibitors for human aldehyde dehydrogenase 3A1 (ALDH3A1) for the enhancement of cyclophosphamide cytotoxicity.", "journal": "Chembiochem : a European journal of chemical biology", "date": "2014", "authors": "Parajuli B, Georgiadis TM, Fishel ML, Hurley TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "24677340", "url": "https://glygen.org/publication/PubMed/24677340" } ] }, { "title": "Cobicistat (GS-9350): A Potent and Selective Inhibitor of Human CYP3A as a Novel Pharmacoenhancer.", "journal": "ACS medicinal chemistry letters", "date": "2010", "authors": "Xu L, Liu H, Murray BP, Callebaut C, Lee MS, Hong A, Strickley RG, Tsai LK, Stray KM, Wang Y, Rhodes GR, Desai MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "24900196", "url": "https://glygen.org/publication/PubMed/24900196" } ] }, { "title": "A novel activity of microsomal epoxide hydrolase: metabolism of the endocannabinoid 2-arachidonoylglycerol.", "journal": "Journal of lipid research", "date": "2014-10", "authors": "Nithipatikom Kasem, Endsley Michael P, Pfeiffer Adam W, Falck John R, Campbell William B", "evidence": [ { "database": "UniProtKB", "id": "P07099", "url": "https://www.uniprot.org/uniprot/P07099" } ], "reference": [ { "type": "PubMed", "id": "24958911", "url": "https://glygen.org/publication/PubMed/24958911" } ] }, { "title": "The N-reductive system composed of mitochondrial amidoxime reducing component (mARC), cytochrome b5 (CYB5B) and cytochrome b5 reductase (CYB5R) is regulated by fasting and high fat diet in mice.", "journal": "PloS one", "date": "2014", "authors": "Jakobs HH, Mikula M, Havemeyer A, Strzalkowska A, Borowa-Chmielak M, Dzwonek A, Gajewska M, Hennig EE, Ostrowski J, Clement B", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "25144769", "url": "https://glygen.org/publication/PubMed/25144769" } ] }, { "title": "Quantitative assessment of the effects of the EPHX1 Tyr113His polymorphism on lung and breast cancer.", "journal": "Genetics and molecular research : GMR", "date": "2014", "authors": "Tan X, Wang YY, Chen XY, Xian L, Guo JJ, Liang GB, Chen MW", "evidence": [ { "database": "Entrez", "id": "2052", "url": "https://www.ncbi.nlm.nih.gov/gene/2052" } ], "reference": [ { "type": "PubMed", "id": "25222243", "url": "https://glygen.org/publication/PubMed/25222243" } ] }, { "title": "The mammalian molybdenum enzymes of mARC.", "journal": "Journal of biological inorganic chemistry : JBIC : a publication of the Society of Biological Inorganic Chemistry", "date": "2015", "authors": "Ott G, Havemeyer A, Clement B", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "25425164", "url": "https://glygen.org/publication/PubMed/25425164" } ] }, { "title": "Metabolism of doxorubicin to the cardiotoxic metabolite doxorubicinol is increased in a mouse model of chronic glutathione deficiency: A potential role for carbonyl reductase 3.", "journal": "Chemico-biological interactions", "date": "2015", "authors": "Schaupp CM, White CC, Merrill GF, Kavanagh TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "25446851", "url": "https://glygen.org/publication/PubMed/25446851" } ] }, { "title": "Lack of association between EPHX1 polymorphism and esophageal cancer risk: evidence from meta-analysis.", "journal": "Diseases of the esophagus : official journal of the International Society for Diseases of the Esophagus", "date": "2015", "authors": "Yan YL, Chen X, Liang HJ, Wang J, Li TJ, Li RL, Li S, Qin X", "evidence": [ { "database": "Entrez", "id": "2052", "url": "https://www.ncbi.nlm.nih.gov/gene/2052" } ], "reference": [ { "type": "PubMed", "id": "25714851", "url": "https://glygen.org/publication/PubMed/25714851" } ] }, { "title": "Ritonavir is the best alternative to ketoconazole as an index inhibitor of cytochrome P450-3A in drug-drug interaction studies.", "journal": "British journal of clinical pharmacology", "date": "2015", "authors": "Greenblatt DJ, Harmatz JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "25923589", "url": "https://glygen.org/publication/PubMed/25923589" } ] }, { "title": "Systematic Review and Meta-Analysis of the Relationship between EPHX1 Polymorphisms and the Risk of Head and Neck Cancer.", "journal": "PloS one", "date": "2015", "authors": "Chen H, Ge L, Sui Q, Lin M", "evidence": [ { "database": "Entrez", "id": "2052", "url": "https://www.ncbi.nlm.nih.gov/gene/2052" } ], "reference": [ { "type": "PubMed", "id": "25923690", "url": "https://glygen.org/publication/PubMed/25923690" } ] }, { "title": "[EPHX1 Tyr113His polymorphism contributes to hepatocellular carcinoma risk: evidfnce from a meta-analysis].", "journal": "Molekuliarnaia biologiia", "date": "2015", "authors": "Wang D, Zhai JX, Zhang LM, Liu DW, Liu XH", "evidence": [ { "database": "Entrez", "id": "2052", "url": "https://www.ncbi.nlm.nih.gov/gene/2052" } ], "reference": [ { "type": "PubMed", "id": "26065263", "url": "https://glygen.org/publication/PubMed/26065263" } ] }, { "title": "Association of Environmental Arsenic Exposure, Genetic Polymorphisms of Susceptible Genes, and Skin Cancers in Taiwan.", "journal": "BioMed research international", "date": "2015", "authors": "Hsu LI, Wu MM, Wang YH, Lee CY, Yang TY, Hsiao BY, Chen CJ", "evidence": [ { "database": "Entrez", "id": "2052", "url": "https://www.ncbi.nlm.nih.gov/gene/2052" } ], "reference": [ { "type": "PubMed", "id": "26295053", "url": "https://glygen.org/publication/PubMed/26295053" } ] }, { "title": "Comparative analysis of Cu (I)-catalyzed alkyne-azide cycloaddition (CuAAC) and strain-promoted alkyne-azide cycloaddition (SPAAC) in O-GlcNAc proteomics.", "journal": "Electrophoresis", "date": "2016", "authors": "Li S, Zhu H, Wang J, Wang X, Li X, Ma C, Wen L, Yu B, Wang Y, Li J, Wang PG", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07099", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07099" } ], "reference": [ { "type": "PubMed", "id": "26853435", "url": "https://glygen.org/publication/PubMed/26853435" } ] }, { "title": "CYP1A1, CYP2E1 and EPHX1 polymorphisms in sporadic colorectal neoplasms.", "journal": "World journal of gastroenterology", "date": "2016", "authors": "Fernandes GM, Russo A, Proenca MA, Gazola NF, Rodrigues GH, Biselli-Chicote PM, Silva AE, Netinho JG, Pavarino EC, Goloni-Bertollo EM", "evidence": [ { "database": "Entrez", "id": "2052", "url": "https://www.ncbi.nlm.nih.gov/gene/2052" } ], "reference": [ { "type": "PubMed", "id": "28018104", "url": "https://glygen.org/publication/PubMed/28018104" } ] }, { "title": "Synthesis of a Highly Azide-Reactive and Thermosensitive Biofunctional Reagent for Efficient Enrichment and Large-Scale Identification of O-GlcNAc Proteins by Mass Spectrometry.", "journal": "Analytical chemistry", "date": "2017", "authors": "Zhang W, Liu T, Dong H, Bai H, Tian F, Shi Z, Chen M, Wang J, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07099", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07099" } ], "reference": [ { "type": "PubMed", "id": "28510447", "url": "https://glygen.org/publication/PubMed/28510447" } ] }, { "title": "Human microsomal xenobiotic epoxide hydrolase. Complementary DNA sequence, complementary DNA-directed expression in COS-1 cells, and chromosomal localization.", "journal": "J. Biol. Chem.", "date": "1988", "authors": "Skoda R C, Demierre A, McBride O W, Gonzalez F J, Meyer U A", "evidence": [ { "database": "UniProtKB", "id": "P07099", "url": "https://www.uniprot.org/uniprot/P07099" } ], "reference": [ { "type": "PubMed", "id": "2891713", "url": "https://glygen.org/publication/PubMed/2891713" } ] }, { "title": "Doxorubicin cardiotoxicity may be caused by its metabolite, doxorubicinol.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1988", "authors": "Olson RD, Mushlin PS, Brenner DE, Fleischer S, Cusack BJ, Chang BK, Boucek RJ Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "2897122", "url": "https://glygen.org/publication/PubMed/2897122" } ] }, { "title": "EPHX1 rs1051740 T>C (Tyr113His) is strongly associated with acute myeloid leukemia and KMT2A rearrangements in early age.", "journal": "Archives of toxicology", "date": "2018", "authors": "Brisson GD, de Almeida Lopes B, Andrade FG, Dos Santos Bueno FV, Sardou-Cezar I, de Aguiar Goncalves BA, Terra-Granado E, Paraguassu-Braga FH, Pombo-de-Oliveira MS", "evidence": [ { "database": "Entrez", "id": "2052", "url": "https://www.ncbi.nlm.nih.gov/gene/2052" } ], "reference": [ { "type": "PubMed", "id": "29605894", "url": "https://glygen.org/publication/PubMed/29605894" } ] }, { "title": "Compounds with Therapeutic Potential against Novel Respiratory 2019 Coronavirus.", "journal": "Antimicrobial agents and chemotherapy", "date": "2020", "authors": "Martinez MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "32152082", "url": "https://glygen.org/publication/PubMed/32152082" } ] }, { "title": "Arbidol combined with LPV/r versus LPV/r alone against Corona Virus Disease 2019: A retrospective cohort study.", "journal": "The Journal of infection", "date": "2020", "authors": "Deng L, Li C, Zeng Q, Liu X, Li X, Zhang H, Hong Z, Xia J", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "32171872", "url": "https://glygen.org/publication/PubMed/32171872" } ] }, { "title": "A Trial of Lopinavir-Ritonavir in Adults Hospitalized with Severe Covid-19.", "journal": "The New England journal of medicine", "date": "2020", "authors": "Cao B, Wang Y, Wen D, Liu W, Wang J, Fan G, Ruan L, Song B, Cai Y, Wei M, Li X, Xia J, Chen N, Xiang J, Yu T, Bai T, Xie X, Zhang L, Li C, Yuan Y, Chen H, Li H, Huang H, Tu S, Gong F, Liu Y, Wei Y, Dong C, Zhou F, Gu X, Xu J, Liu Z, Zhang Y, Li H, Shang L, Wang K, Li K, Zhou X, Dong X, Qu Z, Lu S, Hu X, Ruan S, Luo S, Wu J, Peng L, Cheng F, Pan L, Zou J, Jia C, Wang J, Liu X, Wang S, Wu X, Ge Q, He J, Zhan H, Qiu F, Guo L, Huang C, Jaki T, Hayden FG, Horby PW, Zhang D, Wang C", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "32187464", "url": "https://glygen.org/publication/PubMed/32187464" } ] }, { "title": "Coronavirus puts drug repurposing on the fast track.", "journal": "Nature biotechnology", "date": "2020", "authors": "Harrison C", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "32205870", "url": "https://glygen.org/publication/PubMed/32205870" } ] }, { "title": "Unrevealing sequence and structural features of novel coronavirus using in silico approaches: The main protease as molecular target.", "journal": "EXCLI journal", "date": "2020", "authors": "Ortega JT, Serrano ML, Pujol FH, Rangel HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "32210741", "url": "https://glygen.org/publication/PubMed/32210741" } ] }, { "title": "ABCB1 c.3435C > T and EPHX1 c.416A > G polymorphisms influence plasma carbamazepine concentration, metabolism, and pharmacoresistance in epileptic patients.", "journal": "Gene", "date": "2021", "authors": "Zhang ML, Chen XL, Bai ZF, Zhao X, Li WX, Wang XY, Zhang H, Chen XF, Zhang SQ, Tang JF, Xiao XH, Zhao YL", "evidence": [ { "database": "RefSeq", "id": "NP_000111", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000111" } ], "reference": [ { "type": "PubMed", "id": "34411648", "url": "https://glygen.org/publication/PubMed/34411648" } ] }, { "title": "Genetic polymorphisms in the mEH gene in relation to tobacco smoking: role in lung cancer susceptibility and survival in north Indian patients with lung cancer undergoing platinum-based chemotherapy.", "journal": "Future oncology (London, England)", "date": "2021", "authors": "Walia HK, Singh N, Sharma S", "evidence": [ { "database": "RefSeq", "id": "NP_000111", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000111" } ], "reference": [ { "type": "PubMed", "id": "34672683", "url": "https://glygen.org/publication/PubMed/34672683" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P07099", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07099" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "Nucleotide and deduced amino acid sequence of human liver microsomal epoxide hydrolase.", "journal": "Nucleic Acids Res.", "date": "1987", "authors": "Jackson MR, Craft JA, Burchell B", "evidence": [ { "database": "UniProtKB", "id": "P07099", "url": "https://www.uniprot.org/uniprot/P07099" } ], "reference": [ { "type": "PubMed", "id": "3502697", "url": "https://glygen.org/publication/PubMed/3502697" } ] }, { "title": "EPOXID HYDROLASE SINGLE GENE POLYMORPHISM (RS1051740) AND SEVERITY OF CHRONIC OBSTRUCTIVE DISEASE.", "journal": "Wiadomosci lekarskie (Warsaw, Poland : 1960)", "date": "2022", "authors": "Antonova Inna, Gridnyev Oleksiy, Galchinskaya Valentina", "evidence": [ { "database": "RefSeq", "id": "NP_000111", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000111" } ], "reference": [ { "type": "PubMed", "id": "36591768", "url": "https://glygen.org/publication/PubMed/36591768" } ] }, { "title": "Human microsomal epoxide hydrolase: genetic polymorphism and functional expression in vitro of amino acid variants.", "journal": "Human molecular genetics", "date": "1994", "authors": "Hassett C, Aicher L, Sidhu JS, Omiecinski CJ", "evidence": [ { "database": "UniProtKB", "id": "P07099", "url": "https://www.uniprot.org/uniprot/P07099" } ], "reference": [ { "type": "PubMed", "id": "7516776", "url": "https://glygen.org/publication/PubMed/7516776" } ] }, { "title": "The human microsomal epoxide hydrolase gene (EPHX1): complete nucleotide sequence and structural characterization.", "journal": "Genomics", "date": "1994", "authors": "Hassett C, Robinson K B, Beck N B, Omiecinski C J", "evidence": [ { "database": "UniProtKB", "id": "P07099", "url": "https://www.uniprot.org/uniprot/P07099" } ], "reference": [ { "type": "PubMed", "id": "7835893", "url": "https://glygen.org/publication/PubMed/7835893" } ] }, { "title": "Purification and characterization of a human liver cocaine carboxylesterase that catalyzes the production of benzoylecgonine and the formation of cocaethylene from alcohol and cocaine.", "journal": "Biochemical pharmacology", "date": "1994", "authors": "Brzezinski MR, Abraham TL, Stone CL, Dean RA, Bosron WF", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "7980644", "url": "https://glygen.org/publication/PubMed/7980644" } ] }, { "title": "Microsomal epoxide hydrolase polymorphism as a risk factor for ovarian cancer.", "journal": "Molecular carcinogenesis", "date": "1996", "authors": "Lancaster JM, Brownlee HA, Bell DA, Futreal PA, Marks JR, Berchuck A, Wiseman RW, Taylor JA", "evidence": [ { "database": "Entrez", "id": "2052", "url": "https://www.ncbi.nlm.nih.gov/gene/2052" } ], "reference": [ { "type": "PubMed", "id": "8944076", "url": "https://glygen.org/publication/PubMed/8944076" } ] }, { "title": "Cancer chemopreventive activity of resveratrol, a natural product derived from grapes.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Jang M, Cai L, Udeani GO, Slowing KV, Thomas CF, Beecher CW, Fong HH, Farnsworth NR, Kinghorn AD, Mehta RG, Moon RC, Pezzuto JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "8985016", "url": "https://glygen.org/publication/PubMed/8985016" } ] }, { "title": "Purification and cloning of a broad substrate specificity human liver carboxylesterase that catalyzes the hydrolysis of cocaine and heroin.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Pindel EV, Kedishvili NY, Abraham TL, Brzezinski MR, Zhang J, Dean RA, Bosron WF", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "9169443", "url": "https://glygen.org/publication/PubMed/9169443" } ] }, { "title": "Catalytic properties of NAD(P)H:quinone oxidoreductase-2 (NQO2), a dihydronicotinamide riboside dependent oxidoreductase.", "journal": "Archives of biochemistry and biophysics", "date": "1997", "authors": "Wu K, Knox R, Sun XZ, Joseph P, Jaiswal AK, Zhang D, Deng PS, Chen S", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "9367528", "url": "https://glygen.org/publication/PubMed/9367528" } ] }, { "title": "Cloning of vascular adhesion protein 1 reveals a novel multifunctional adhesion molecule.", "journal": "The Journal of experimental medicine", "date": "1998", "authors": "Smith DJ, Salmi M, Bono P, Hellman J, Leu T, Jalkanen S", "evidence": [ { "database": "Reactome", "id": "R-HSA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945" } ], "reference": [ { "type": "PubMed", "id": "9653080", "url": "https://glygen.org/publication/PubMed/9653080" } ] } ], "pathway": [ { "id": "hsa:2052", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2052", "resource": "KEGG Pathway" }, { "id": "R-HSA-211945", "name": "Phase I - Functionalization of compounds", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211945", "resource": "Reactome", "description": "Phase I - Functionalization of compounds" } ], "orthologs": [ { "uniprot_canonical_ac": "P07687-1", "protein_name": "Epoxide hydrolase 1", "gene_name": "Ephx1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MWLELVLASLLGFVIYWFVSRDKEETLPLGDGWWGPGSKPSAKEDESIRPFKVETSDEEIKDLHQRIDRFRASPPLEGSRFHYGFNSNYMKKVVSYWRNEFDWRKQVEILNQYPHFKTKIEGLDIHFIHVKPPQLPSGRTPKPLLMVHGWPGSFYEFYKIIPLLTDPKSHGLSDEHVFEVICPSIPGYGYSEASSKKGLNSVATARIFYKLMTRLGFQKFYIQGGDWGSLICTNMAQMVPNHVKGLHLNMAFISRSFYTMTPLLGQRFGRFLGYTEKDIELLYPYKEKVFYSIMRESGYLHIQATKPDTVGCALNDSPVGLAAYILEKFSTWTKSEYRELEDGGLERKFSLDDLLVNIMIYWTTGTIVSSQRYYKENLGQGIMVHKHEGMKVFVPTGFSAFPSELLHAPEKWVKVKYPKLISYSYMERGGHFAAFEEPKLLAQDIRKFVSLAELQ", "length": 455 }, "evidence": [ { "id": "45925227", "url": "http://www.informatics.jax.org/homology/45925227", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9D379-1", "protein_name": "Epoxide hydrolase 1", "gene_name": "Ephx1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MWLELILASVLGFVIYWFVSRDKEETLPLEDGWWGPGSKPSAKEDESIRPFKVETSDEEIKDLHQRIDRFRASPPLEGSRFHYGFNSSYLKKVVSFWRNEFDWRKQVEILNQYPHFKTKIEGLDIHFIHVKPPQLPSGRTPKPLLMVHGWPGSFYEFYKIIPLLTDPKTHGLSDEHVFEVICPSIPGYGFSEASSKKGLNSVATARIFYKLMSRLGFQKFYIQGGDWGSLICTNIAQMVPNHVKGLHLNMSFISRNIYSLTPLLGQRFGRFLGYTEKDLELLYPFKEKVFYNIMRESGYLHIQATKPDTVGCALNDSPVGLAAYILEKFSTWTKSEYRELEDGGLERKFSLEDLLTNIMIYWTTGTIVSSQRFYKENLGQGVMVHRHEGMKVFVPTGYSAFPSEILHAPEKWVKVKYPKLISYSYMERGGHFAAFEEPKLLAQDIRKFVSLAELQ", "length": 455 }, "evidence": [ { "id": "45925227", "url": "http://www.informatics.jax.org/homology/45925227", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "P07099", "url": "https://www.uniprot.org/uniprot/P07099" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "response to organic cyclic compound", "id": "GO:0014070", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014070", "evidence": [ { "database": "UniProtKB", "id": "P07099", "url": "https://www.uniprot.org/uniprot/P07099" } ], "pmid": "" }, { "name": "xenobiotic metabolic process", "id": "GO:0006805", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006805", "evidence": [ { "database": "UniProtKB", "id": "P07099", "url": "https://www.uniprot.org/uniprot/P07099" } ], "pmid": "" }, { "name": "response to toxic substance", "id": "GO:0009636", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009636", "evidence": [ { "database": "UniProtKB", "id": "P07099", "url": "https://www.uniprot.org/uniprot/P07099" } ], "pmid": "" }, { "name": "aromatic compound catabolic process", "id": "GO:0019439", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019439", "evidence": [ { "database": "UniProtKB", "id": "P07099", "url": "https://www.uniprot.org/uniprot/P07099" } ], "pmid": "" }, { "name": "arachidonic acid metabolic process", "id": "GO:0019369", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019369", "evidence": [ { "database": "UniProtKB", "id": "P07099", "url": "https://www.uniprot.org/uniprot/P07099" } ], "pmid": "" }, { "name": "epoxide metabolic process", "id": "GO:0097176", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097176", "evidence": [ { "database": "UniProtKB", "id": "P07099", "url": "https://www.uniprot.org/uniprot/P07099" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "epoxide hydrolase activity", "id": "GO:0004301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004301", "evidence": [ { "database": "UniProtKB", "id": "P07099", "url": "https://www.uniprot.org/uniprot/P07099" } ], "pmid": "" }, { "name": "cis-stilbene-oxide hydrolase activity", "id": "GO:0033961", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033961", "evidence": [ { "database": "UniProtKB", "id": "P07099", "url": "https://www.uniprot.org/uniprot/P07099" } ], "pmid": "" }, { "name": "hydrolase activity", "id": "GO:0016787", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016787", "evidence": [ { "database": "UniProtKB", "id": "P07099", "url": "https://www.uniprot.org/uniprot/P07099" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 256, "end_pos": 258, "annotation": "n_glycosylation_sequon" }, { "start_pos": 315, "end_pos": 317, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "23900", "name": "", "equation": "cis-stilbene oxide + H2O = (1R,2R)-hydrobenzoin", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P07687-1", "P07099-1", "Q9D379-1", "Q7KB18-1", "Q7K1W4-1", "Q7JRC3-1" ], "evidence": [ { "id": "23900", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/23900" } ] }, { "id": "26132", "name": "", "equation": "2-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-glycerol + H2O = (5Z,8Z,11Z,14Z)-eicosatetraenoate + glycerol + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q5XI64-1", "P97612-1", "Q6AYT7-1", "Q6MG55-1", "Q8R431-1", "P15304-1", "P07687-1", "Q8N2K0-1", "P08910-1", "Q9BV23-1", "O95870-1", "O00519-1", "Q99685-1", "O00748-1", "P23141-1", "P07099-1", "Q05469-1", "Q8IY17-4", "Q8R2Y0-1", "Q9Z1Q2-1", "Q99LR1-1", "Q9QXM0-1", "O08914-1", "O35678-1", "P54310-1", "Q3TRM4-1", "Q8VCC2-1", "Q9D379-1" ], "evidence": [ { "id": "26132", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/26132" } ] }, { "id": "44044", "name": "", "equation": "11,12-epoxy-(5Z,8Z,14Z)-eicosatrienoate + H2O = 11,12-dihydroxy-(5Z,8Z,14Z)-eicosatrienoate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P80299-1", "P07687-1", "Q9H6B9-1", "P34913-1", "P07099-1", "Q3V1F8-1", "P34914-1", "Q9D379-1" ], "evidence": [ { "id": "44044", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/44044" } ] }, { "id": "44048", "name": "", "equation": "8,9-epoxy-(5Z,11Z,14Z)-eicosatrienoate + H2O = 8,9-dihydroxy-(5Z,11Z,14Z)-eicosatrienoate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P80299-1", "P07687-1", "Q9H6B9-1", "P34913-1", "P07099-1", "Q3V1F8-1", "P34914-1", "Q9D379-1" ], "evidence": [ { "id": "44048", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/44048" } ] }, { "id": "55764", "name": "", "equation": "1-(4-methoxyphenyl)-N-methyl-N-[(3-methyloxetan-3-yl)methyl]methanamine + H2O = 2-{[(4-methoxybenzyl)(methyl)amino]methyl}-2-methylpropane-1,3-diol", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P07687-1", "P07099-1", "Q9D379-1", "Q7KB18-1", "Q7K1W4-1", "Q7JRC3-1" ], "evidence": [ { "id": "55764", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/55764" } ] }, { "id": "R-HSA-5694077", "name": "EPHX1 hydrates BaP4,5O to BaP4,5-DHD", "equation": "", "summary": "Microsomal epoxide hydrolase 1 (EPHX1) is involved in the metabolism of many potentially carcinogenic and/or genotoxic epoxides, such as those derived from the oxidation of polyaromatic hydrocarbons. It catalyses the hydration of arene and aliphatic epoxides to less reactive and more water-soluble dihydrodiols. An example substrate is epoxide benzo(a)pyrene 4,5-oxide (BaP4,5O), hydrated to benzo(a)pyrene 4,5-dihydrodiol (BaP4,5DHD) (Hosagrahara et al. 2004, Fretland & Omiecinski 2000).", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-5694080" ], "output_participant_list": [ "R-ALL-5694091" ], "enzyme_list": [ "P07099-1" ], "evidence": [ { "id": "R-HSA-5694077", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694077" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-5694080", "participant_name": "BaP4,5O [cytosol]", "crossref": [ { "id": "34560", "database": "ChEBI", "url": "" }, { "id": "HMDB0060091", "database": "HMDB Metabolite", "url": "" }, { "id": "C14851", "database": "COMPOUND", "url": "" }, { "id": "34560", "database": "ChEBI", "url": "" }, { "id": "C14851", "database": "COMPOUND", "url": "" }, { "id": "HMDB0060091", "database": "HMDB Metabolite", "url": "" }, { "id": "34560", "database": "ChEBI", "url": "" }, { "id": "C14851", "database": "COMPOUND", "url": "" }, { "id": "HMDB0060091", "database": "HMDB Metabolite", "url": "" }, { "id": "HMDB0060091", "database": "HMDB Metabolite", "url": "" }, { "id": "34560", "database": "ChEBI", "url": "" }, { "id": "C14851", "database": "COMPOUND", "url": "" }, { "id": "C14851", "database": "COMPOUND", "url": "" }, { "id": "34560", "database": "ChEBI", "url": "" }, { "id": "HMDB0060091", "database": "HMDB Metabolite", "url": "" } ] }, { "participant_id": "R-ALL-5694091", "participant_name": "BaP4,5-DHD [cytosol]", "crossref": [ { "id": "81621", "database": "ChEBI", "url": "" }, { "id": "C18270", "database": "COMPOUND", "url": "" }, { "id": "81621", "database": "ChEBI", "url": "" }, { "id": "C18270", "database": "COMPOUND", "url": "" }, { "id": "81621", "database": "ChEBI", "url": "" }, { "id": "C18270", "database": "COMPOUND", "url": "" }, { "id": "81621", "database": "ChEBI", "url": "" }, { "id": "C18270", "database": "COMPOUND", "url": "" }, { "id": "81621", "database": "ChEBI", "url": "" }, { "id": "C18270", "database": "COMPOUND", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "O00519", "gene_name": "FAAH", "activity": [ { "ec_number": "3.5.1.99", "activity": "(9Z)-octadecenamide + H2O = (9Z)-octadecenoate + NH4(+).", "evidence": [ { "id": "O00519", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00519" } ] }, { "ec_number": "3.1.1.-", "activity": "", "evidence": [ { "id": "O00519", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00519" } ] }, { "ec_number": "3.5.1.99", "activity": "", "evidence": [ { "id": "O00519", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00519" } ] } ] }, { "uniprot_ac": "O00748", "gene_name": "CES2", "activity": [ { "ec_number": "3.1.1.1", "activity": "a carboxylic ester + H2O = a carboxylate + an alcohol + H(+).", "evidence": [ { "id": "O00748", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00748" } ] }, { "ec_number": "3.1.1.56", "activity": "4-methylumbelliferyl acetate + H2O = 4-methylumbelliferone + acetate + H(+).", "evidence": [ { "id": "O00748", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00748" } ] }, { "ec_number": "3.1.1.84", "activity": "cocaine + H2O = benzoate + ecgonine methyl ester + H(+).", "evidence": [ { "id": "O00748", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00748" } ] }, { "ec_number": "3.1.1.84", "activity": "", "evidence": [ { "id": "O00748", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00748" } ] } ] }, { "uniprot_ac": "O08914", "gene_name": "Faah", "activity": [ { "ec_number": "3.5.1.99", "activity": "(9Z)-octadecenamide + H2O = (9Z)-octadecenoate + NH4(+).", "evidence": [ { "id": "O08914", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08914" } ] }, { "ec_number": "3.1.1.-", "activity": "", "evidence": [ { "id": "O08914", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08914" } ] }, { "ec_number": "3.5.1.99", "activity": "", "evidence": [ { "id": "O08914", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08914" } ] } ] }, { "uniprot_ac": "O35678", "gene_name": "Mgll", "activity": [ { "ec_number": "3.1.1.23", "activity": "Hydrolyzes glycerol monoesters of long-chain fatty acids.", "evidence": [ { "id": "O35678", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35678" } ] }, { "ec_number": "3.1.1.23", "activity": "", "evidence": [ { "id": "O35678", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35678" } ] } ] }, { "uniprot_ac": "O95870", "gene_name": "ABHD16A", "activity": [ { "ec_number": "3.1.1.23", "activity": "Hydrolyzes glycerol monoesters of long-chain fatty acids.", "evidence": [ { "id": "O95870", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95870" } ] }, { "ec_number": "3.1.1.23", "activity": "", "evidence": [ { "id": "O95870", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95870" } ] }, { "ec_number": "3.1.-.-", "activity": "", "evidence": [ { "id": "O95870", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95870" } ] } ] }, { "uniprot_ac": "P07099", "gene_name": "EPHX1", "activity": [ { "ec_number": "3.3.2.9", "activity": "1-(4-methoxyphenyl)-N-methyl-N-[(3-methyloxetan-3-yl)methyl]methanamine + H2O = 2-{[(4-methoxybenzyl)(methyl)amino]methyl}-2-methylpropane-1,3-diol.", "evidence": [ { "id": "P07099", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07099" } ] }, { "ec_number": "3.3.2.9", "activity": "", "evidence": [ { "id": "P07099", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07099" } ] } ] }, { "uniprot_ac": "P07687", "gene_name": "Ephx1", "activity": [ { "ec_number": "3.3.2.9", "activity": "1-(4-methoxyphenyl)-N-methyl-N-[(3-methyloxetan-3-yl)methyl]methanamine + H2O = 2-{[(4-methoxybenzyl)(methyl)amino]methyl}-2-methylpropane-1,3-diol.", "evidence": [ { "id": "P07687", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07687" } ] }, { "ec_number": "3.3.2.9", "activity": "", "evidence": [ { "id": "P07687", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07687" } ] } ] }, { "uniprot_ac": "P08910", "gene_name": "ABHD2", "activity": [ { "ec_number": "3.1.1.23", "activity": "Hydrolyzes glycerol monoesters of long-chain fatty acids.", "evidence": [ { "id": "P08910", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08910" } ] }, { "ec_number": "3.1.1.79", "activity": "a monoacylglycerol + H2O = a fatty acid + glycerol + H(+).", "evidence": [ { "id": "P08910", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08910" } ] }, { "ec_number": "3.1.1.6", "activity": "an acetyl ester + H2O = acetate + an aliphatic alcohol + H(+).", "evidence": [ { "id": "P08910", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08910" } ] }, { "ec_number": "3.1.1.23", "activity": "", "evidence": [ { "id": "P08910", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08910" } ] } ] }, { "uniprot_ac": "P15304", "gene_name": "Lipe", "activity": [ { "ec_number": "3.1.1.23", "activity": "Hydrolyzes glycerol monoesters of long-chain fatty acids.", "evidence": [ { "id": "P15304", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15304" } ] }, { "ec_number": "3.1.1.79", "activity": "a monoacylglycerol + H2O = a fatty acid + glycerol + H(+).", "evidence": [ { "id": "P15304", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15304" } ] }, { "ec_number": "3.1.1.23", "activity": "", "evidence": [ { "id": "P15304", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15304" } ] }, { "ec_number": "3.1.1.79", "activity": "", "evidence": [ { "id": "P15304", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15304" } ] } ] }, { "uniprot_ac": "P23141", "gene_name": "CES1", "activity": [ { "ec_number": "3.1.1.13", "activity": "a cholesterol ester + H2O = a fatty acid + cholesterol + H(+).", "evidence": [ { "id": "P23141", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23141" } ] }, { "ec_number": "3.1.1.1", "activity": "a carboxylic ester + H2O = a carboxylate + an alcohol + H(+).", "evidence": [ { "id": "P23141", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23141" } ] }, { "ec_number": "3.1.1.56", "activity": "4-methylumbelliferyl acetate + H2O = 4-methylumbelliferone + acetate + H(+).", "evidence": [ { "id": "P23141", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23141" } ] } ] }, { "uniprot_ac": "P34913", "gene_name": "EPHX2", "activity": [ { "ec_number": "3.1.3.76", "activity": "(9S,10S)-10-hydroxy-9-(phosphooxy)octadecanoate + H2O = (9S,10S)-9,10-dihydroxyoctadecanoate + phosphate.", "evidence": [ { "id": "P34913", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34913" } ] }, { "ec_number": "3.3.2.10", "activity": "an epoxide + H2O = an ethanediol.", "evidence": [ { "id": "P34913", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34913" } ] } ] }, { "uniprot_ac": "P34914", "gene_name": "Ephx2", "activity": [ { "ec_number": "3.1.3.76", "activity": "(9S,10S)-10-hydroxy-9-(phosphooxy)octadecanoate + H2O = (9S,10S)-9,10-dihydroxyoctadecanoate + phosphate.", "evidence": [ { "id": "P34914", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34914" } ] }, { "ec_number": "3.3.2.10", "activity": "an epoxide + H2O = an ethanediol.", "evidence": [ { "id": "P34914", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34914" } ] } ] }, { "uniprot_ac": "P54310", "gene_name": "Lipe", "activity": [ { "ec_number": "3.1.1.23", "activity": "Hydrolyzes glycerol monoesters of long-chain fatty acids.", "evidence": [ { "id": "P54310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54310" } ] }, { "ec_number": "3.1.1.79", "activity": "a monoacylglycerol + H2O = a fatty acid + glycerol + H(+).", "evidence": [ { "id": "P54310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54310" } ] }, { "ec_number": "3.1.1.23", "activity": "", "evidence": [ { "id": "P54310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54310" } ] }, { "ec_number": "3.1.1.79", "activity": "", "evidence": [ { "id": "P54310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54310" } ] } ] }, { "uniprot_ac": "P80299", "gene_name": "Ephx2", "activity": [ { "ec_number": "3.1.3.76", "activity": "(9S,10S)-10-hydroxy-9-(phosphooxy)octadecanoate + H2O = (9S,10S)-9,10-dihydroxyoctadecanoate + phosphate.", "evidence": [ { "id": "P80299", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P80299" } ] }, { "ec_number": "3.3.2.10", "activity": "an epoxide + H2O = an ethanediol.", "evidence": [ { "id": "P80299", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P80299" } ] } ] }, { "uniprot_ac": "P97612", "gene_name": "Faah", "activity": [ { "ec_number": "3.5.1.99", "activity": "(9Z)-octadecenamide + H2O = (9Z)-octadecenoate + NH4(+).", "evidence": [ { "id": "P97612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97612" } ] }, { "ec_number": "3.5.1.99", "activity": "", "evidence": [ { "id": "P97612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97612" } ] }, { "ec_number": "3.1.1.-", "activity": "", "evidence": [ { "id": "P97612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97612" } ] } ] }, { "uniprot_ac": "Q05469", "gene_name": "LIPE", "activity": [ { "ec_number": "3.1.1.23", "activity": "Hydrolyzes glycerol monoesters of long-chain fatty acids.", "evidence": [ { "id": "Q05469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05469" } ] }, { "ec_number": "3.1.1.79", "activity": "a monoacylglycerol + H2O = a fatty acid + glycerol + H(+).", "evidence": [ { "id": "Q05469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05469" } ] }, { "ec_number": "3.1.1.79", "activity": "", "evidence": [ { "id": "Q05469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05469" } ] } ] }, { "uniprot_ac": "Q3TRM4", "gene_name": "Pnpla6", "activity": [ { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "Q3TRM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TRM4" } ] } ] }, { "uniprot_ac": "Q3V1F8", "gene_name": "Ephx3", "activity": [ { "ec_number": "3.3.2.10", "activity": "an epoxide + H2O = an ethanediol.", "evidence": [ { "id": "Q3V1F8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3V1F8" } ] }, { "ec_number": "3.3.2.10", "activity": "", "evidence": [ { "id": "Q3V1F8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3V1F8" } ] } ] }, { "uniprot_ac": "Q5XI64", "gene_name": "Abhd6", "activity": [ { "ec_number": "3.1.1.23", "activity": "Hydrolyzes glycerol monoesters of long-chain fatty acids.", "evidence": [ { "id": "Q5XI64", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XI64" } ] }, { "ec_number": "3.1.1.23", "activity": "", "evidence": [ { "id": "Q5XI64", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XI64" } ] } ] }, { "uniprot_ac": "Q6AYT7", "gene_name": "Abhd12", "activity": [ { "ec_number": "3.1.1.23", "activity": "Hydrolyzes glycerol monoesters of long-chain fatty acids.", "evidence": [ { "id": "Q6AYT7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AYT7" } ] }, { "ec_number": "3.1.1.23", "activity": "", "evidence": [ { "id": "Q6AYT7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AYT7" } ] }, { "ec_number": "3.1.-.-", "activity": "", "evidence": [ { "id": "Q6AYT7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AYT7" } ] } ] }, { "uniprot_ac": "Q6MG55", "gene_name": "Abhd16a", "activity": [ { "ec_number": "3.1.1.23", "activity": "Hydrolyzes glycerol monoesters of long-chain fatty acids.", "evidence": [ { "id": "Q6MG55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6MG55" } ] }, { "ec_number": "3.1.-.-", "activity": "", "evidence": [ { "id": "Q6MG55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6MG55" } ] }, { "ec_number": "3.1.1.23", "activity": "", "evidence": [ { "id": "Q6MG55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6MG55" } ] } ] }, { "uniprot_ac": "Q7JRC3", "gene_name": "Jheh1", "activity": [ { "ec_number": "3.3.2.9", "activity": "1-(4-methoxyphenyl)-N-methyl-N-[(3-methyloxetan-3-yl)methyl]methanamine + H2O = 2-{[(4-methoxybenzyl)(methyl)amino]methyl}-2-methylpropane-1,3-diol.", "evidence": [ { "id": "Q7JRC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7JRC3" } ] }, { "ec_number": "3.3.2.9", "activity": "", "evidence": [ { "id": "Q7JRC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7JRC3" } ] } ] }, { "uniprot_ac": "Q7K1W4", "gene_name": "Jheh3", "activity": [ { "ec_number": "3.3.2.9", "activity": "1-(4-methoxyphenyl)-N-methyl-N-[(3-methyloxetan-3-yl)methyl]methanamine + H2O = 2-{[(4-methoxybenzyl)(methyl)amino]methyl}-2-methylpropane-1,3-diol.", "evidence": [ { "id": "Q7K1W4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7K1W4" } ] }, { "ec_number": "3.3.2.9", "activity": "", "evidence": [ { "id": "Q7K1W4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7K1W4" } ] } ] }, { "uniprot_ac": "Q7KB18", "gene_name": "Jheh2", "activity": [ { "ec_number": "3.3.2.9", "activity": "1-(4-methoxyphenyl)-N-methyl-N-[(3-methyloxetan-3-yl)methyl]methanamine + H2O = 2-{[(4-methoxybenzyl)(methyl)amino]methyl}-2-methylpropane-1,3-diol.", "evidence": [ { "id": "Q7KB18", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KB18" } ] }, { "ec_number": "3.3.2.9", "activity": "", "evidence": [ { "id": "Q7KB18", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KB18" } ] } ] }, { "uniprot_ac": "Q8IY17", "gene_name": "PNPLA6", "activity": [ { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "Q8IY17", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IY17" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "Q8IY17", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IY17" } ] } ] }, { "uniprot_ac": "Q8N2K0", "gene_name": "ABHD12", "activity": [ { "ec_number": "3.1.1.23", "activity": "Hydrolyzes glycerol monoesters of long-chain fatty acids.", "evidence": [ { "id": "Q8N2K0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N2K0" } ] }, { "ec_number": "3.1.1.23", "activity": "", "evidence": [ { "id": "Q8N2K0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N2K0" } ] }, { "ec_number": "3.1.-.-", "activity": "", "evidence": [ { "id": "Q8N2K0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N2K0" } ] } ] }, { "uniprot_ac": "Q8R2Y0", "gene_name": "Abhd6", "activity": [ { "ec_number": "3.1.1.23", "activity": "Hydrolyzes glycerol monoesters of long-chain fatty acids.", "evidence": [ { "id": "Q8R2Y0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R2Y0" } ] }, { "ec_number": "3.1.1.23", "activity": "", "evidence": [ { "id": "Q8R2Y0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R2Y0" } ] } ] }, { "uniprot_ac": "Q8R431", "gene_name": "Mgll", "activity": [ { "ec_number": "3.1.1.23", "activity": "Hydrolyzes glycerol monoesters of long-chain fatty acids.", "evidence": [ { "id": "Q8R431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R431" } ] }, { "ec_number": "3.1.1.23", "activity": "", "evidence": [ { "id": "Q8R431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R431" } ] } ] }, { "uniprot_ac": "Q8VCC2", "gene_name": "Ces1", "activity": [ { "ec_number": "3.1.1.13", "activity": "a cholesterol ester + H2O = a fatty acid + cholesterol + H(+).", "evidence": [ { "id": "Q8VCC2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCC2" } ] }, { "ec_number": "3.1.1.1", "activity": "a carboxylic ester + H2O = a carboxylate + an alcohol + H(+).", "evidence": [ { "id": "Q8VCC2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCC2" } ] }, { "ec_number": "3.1.1.1", "activity": "", "evidence": [ { "id": "Q8VCC2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCC2" } ] } ] }, { "uniprot_ac": "Q99685", "gene_name": "MGLL", "activity": [ { "ec_number": "3.1.1.23", "activity": "Hydrolyzes glycerol monoesters of long-chain fatty acids.", "evidence": [ { "id": "Q99685", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99685" } ] }, { "ec_number": "3.1.1.23", "activity": "", "evidence": [ { "id": "Q99685", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99685" } ] } ] }, { "uniprot_ac": "Q99LR1", "gene_name": "Abhd12", "activity": [ { "ec_number": "3.1.1.23", "activity": "Hydrolyzes glycerol monoesters of long-chain fatty acids.", "evidence": [ { "id": "Q99LR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LR1" } ] }, { "ec_number": "3.1.1.23", "activity": "", "evidence": [ { "id": "Q99LR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LR1" } ] }, { "ec_number": "3.1.1.-", "activity": "", "evidence": [ { "id": "Q99LR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LR1" } ] }, { "ec_number": "3.1.-.-", "activity": "", "evidence": [ { "id": "Q99LR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LR1" } ] } ] }, { "uniprot_ac": "Q9BV23", "gene_name": "ABHD6", "activity": [ { "ec_number": "3.1.1.23", "activity": "Hydrolyzes glycerol monoesters of long-chain fatty acids.", "evidence": [ { "id": "Q9BV23", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BV23" } ] }, { "ec_number": "3.1.1.23", "activity": "", "evidence": [ { "id": "Q9BV23", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BV23" } ] } ] }, { "uniprot_ac": "Q9D379", "gene_name": "Ephx1", "activity": [ { "ec_number": "3.3.2.9", "activity": "1-(4-methoxyphenyl)-N-methyl-N-[(3-methyloxetan-3-yl)methyl]methanamine + H2O = 2-{[(4-methoxybenzyl)(methyl)amino]methyl}-2-methylpropane-1,3-diol.", "evidence": [ { "id": "Q9D379", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D379" } ] }, { "ec_number": "3.3.2.9", "activity": "", "evidence": [ { "id": "Q9D379", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D379" } ] } ] }, { "uniprot_ac": "Q9H6B9", "gene_name": "EPHX3", "activity": [ { "ec_number": "3.3.2.10", "activity": "an epoxide + H2O = an ethanediol.", "evidence": [ { "id": "Q9H6B9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H6B9" } ] }, { "ec_number": "3.3.2.10", "activity": "", "evidence": [ { "id": "Q9H6B9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H6B9" } ] } ] }, { "uniprot_ac": "Q9QXM0", "gene_name": "Abhd2", "activity": [ { "ec_number": "3.1.1.23", "activity": "Hydrolyzes glycerol monoesters of long-chain fatty acids.", "evidence": [ { "id": "Q9QXM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXM0" } ] }, { "ec_number": "3.1.1.79", "activity": "a monoacylglycerol + H2O = a fatty acid + glycerol + H(+).", "evidence": [ { "id": "Q9QXM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXM0" } ] }, { "ec_number": "3.1.1.6", "activity": "an acetyl ester + H2O = acetate + an aliphatic alcohol + H(+).", "evidence": [ { "id": "Q9QXM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXM0" } ] }, { "ec_number": "3.1.1.23", "activity": "", "evidence": [ { "id": "Q9QXM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXM0" } ] } ] }, { "uniprot_ac": "Q9Z1Q2", "gene_name": "Abhd16a", "activity": [ { "ec_number": "3.1.1.23", "activity": "Hydrolyzes glycerol monoesters of long-chain fatty acids.", "evidence": [ { "id": "Q9Z1Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1Q2" } ] }, { "ec_number": "3.1.-.-", "activity": "", "evidence": [ { "id": "Q9Z1Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1Q2" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [ 113 ], "glycation_sites": [], "phosphorylation_sites": [ 422 ], "sequon_annotation_sites": [ { "start_pos": 256, "end_pos": 258 }, { "start_pos": 315, "end_pos": 317 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 83 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }